Tian, Zhang; Yanfeng, Gong
2017-05-01
In order to solve the contradiction between demand and distribution range of primary energy resource, Ultra High Voltage (UHV) power grids should be developed rapidly to meet development of energy bases and accessing of large-scale renewable energy. This paper reviewed the latest research processes of AC/DC transmission technologies, summarized the characteristics of AC/DC power grids, concluded that China’s power grids certainly enter a new period of large -scale hybrid UHV AC/DC power grids and characteristics of “strong DC and weak AC” becomes increasingly pro minent; possible problems in operation of AC/DC power grids was discussed, and interaction or effect between AC/DC power grids was made an intensive study of; according to above problems in operation of power grids, preliminary scheme is summarized as fo llows: strengthening backbone structures, enhancing AC/DC transmission technologies, promoting protection measures of clean energ y accessing grids, and taking actions to solve stability problems of voltage and frequency etc. It’s valuable for making hybrid UHV AC/DC power grids adapt to operating mode of large power grids, thus guaranteeing security and stability of power system.
Offshore windfarm connection with low frequency AC transmission technology
DEFF Research Database (Denmark)
Qin, Nan; Xu, Zhao; You, Shi
2009-01-01
This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared...... to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...... developed, which consists of three parts, the fixed-speed wind turbine representing a wind farm, the transmission line and the frequency converter. Although the transmission capability is greatly improved by the LFAC system, simulation shows it gives negative influences on the wind turbine operation due...
UHV A.C. transmission: Technology and prospects
International Nuclear Information System (INIS)
Cauzillo, B.A.; Manzoni, G.; Nicolini, P.
1992-04-01
At the beginning of the 70's, UHV transmission was regarded as imminent in many countries in view of the expected concentration of generating units (possibly of the nuclear type and grouped together in a few large plants, each of several GW), and research projects were therefore launched in the U.S.A., Canada, Italy, Japan, USSR, etc. Nowadays, the expected introduction of UHV transmission seems remote due to the slowdown in electricity growth and to the tendency towards distributed generation. Nevertheless, there are exceptions: the 1,200 kV 2,400 km-long transmission system in operation in Siberia-Kazahkstan-Urals, and the 1,100 kV 200 km double-circuit line under construction in Japan (which will, however, be operated at 500 kV up to the end of the century). In addition, in Italy, the research programme of a 1000 kV project has now been completed and a 1,050 kV pilot plant is under construction in Tuscany, consisting of a short 1,050kV line and a 420/1,050 kV 1,200 MVA substation. The technology of UHV AC transmission has therefore been proved effective and may represent an available option for the power systems of the next century. From the power system planning point-of-view, UHV's favourable characteristics lie in the possibility of transmitting large amount of power, of the order of 5 GW per circuit, with lower costs, reduced losses, and less land occupation than in the case of EHV lines
Electric transmission technology
International Nuclear Information System (INIS)
Shah, K.R.
1990-01-01
Electric transmission technology has matured and can transmit bulk power more reliably and economically than the technology 10 years ago.In 1882, Marcel Depres transmitted 15 kW electric power at 2 kV, using a constant direct current; present transmission voltages have risen to ± 600 kV direct current (DC) and 765 kV alternating current (AC), and it is now possible to transmit bulk electric power at voltages as high as ± 1000 kV DC and 1500 kV AC. Affordable computer systems are now available to optimize transmission reliably. New materials have reduced the bulk of insulation for lines and equipment. New conducting materials and configurations have reduced losses in transmission. Advances in line structures and conductor motion, understanding of flashover characteristics of insulators and air-gaps and electrical performance of lines have resulted in more compact urban transmission lines. (author). 15 refs., 7 tabs., 11 figs
DC Vs AC - War Of Currents For Future Power Systems A HVDC Technology Overview
Directory of Open Access Journals (Sweden)
Anil K. Rai
2015-08-01
Full Text Available DC vs AC discussion began in 1880s with development of first commercial power transmission in Wall Street New York. Later when AC technology came into notice by efforts of inventor and researcher Sir Nicola Tesla soon the advantages of AC transmission and AC devices overtook the DC technology. It was hoped that DC technology had lost battle of currents. Today with researches going on FACTS devices and bulk power transmission HVDC has again gained a reputation in power sector. Solution of this centuries old debate is to develop HVDC systems that assists HVAC systems for better performance stability and control
HVDC power transmission technology assessment
Energy Technology Data Exchange (ETDEWEB)
Hauth, R.L.; Tatro, P.J.; Railing, B.D. [New England Power Service Co., Westborough, MA (United States); Johnson, B.K.; Stewart, J.R. [Power Technologies, Inc., Schenectady, NY (United States); Fink, J.L.
1997-04-01
The purpose of this study was to develop an assessment of the national utility system`s needs for electric transmission during the period 1995-2020 that could be met by future reduced-cost HVDC systems. The assessment was to include an economic evaluation of HVDC as a means for meeting those needs as well as a comparison with competing technologies such as ac transmission with and without Flexible AC Transmission System (FACTS) controllers. The role of force commutated dc converters was to be assumed where appropriate. The assessment begins by identifying the general needs for transmission in the U.S. in the context of a future deregulated power industry. The possible roles for direct current transmission are then postulated in terms of representative scenarios. A few of the scenarios are illustrated with the help of actual U.S. system examples. non-traditional applications as well as traditional applications such as long lines and asynchronous interconnections are discussed. The classical ``break-even distance`` concept for comparing HVDC and ac lines is used to assess the selected scenarios. The impact of reduced-cost converters is reflected in terms of the break-even distance. This report presents a comprehensive review of the functional benefits of HVDC transmission and updated cost data for both ac and dc system components. It also provides some provocative thoughts on how direct current transmission might be applied to better utilize and expand our nation`s increasingly stressed transmission assets.
DEFF Research Database (Denmark)
Hu, Zhenda; Wu, Rui; Yang, Xiaodong
2014-01-01
With the development of High Voltage DC Transmission (HVDC) technology, there will be more and more HVDC-AC hybrid transmission system in the world. A basic challenge in HVDC-AC hybrid transmission systems is to optimize the power sharing between DC and AC lines, which become more severe when sup...... control strategy of Modular Multi-level Converter in VSC-HVDC, which can optimize converter output power according to passive network loading variation. Proposal method is studied with a case study of a VSC-HVDC AC hybrid project by PSCAD/EMTDC simulations....
Flexible AC transmission systems: the state of the art
Energy Technology Data Exchange (ETDEWEB)
Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division
1994-12-31
Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
Adapting AC Lines to DC Grids for Large-Scale Renewable Power Transmission
Directory of Open Access Journals (Sweden)
D. Marene Larruskain
2014-10-01
Full Text Available All over the world, governments of different countries are nowadays promoting the use of clean energies in order to achieve sustainable energy systems. In this scenario, since the installed capacity is continuously increasing, renewable sources can play an important role. Notwithstanding that, some important problems may appear when connecting these sources to the grid, being the overload of distribution lines one of the most relevant. In fact, renewable generation is usually connected to the nearest AC grid, although this HV system may not have been designed considering distributed generation. In the particular case of large wind farms, the electrical grid has to transmit all the power generated by wind energy and, as a consequence, the AC system may get overloaded. It is therefore necessary to determine the impact of wind power transmission so that appropriate measures can be taken. Not only are these measures influenced by the amount of power transmitted, but also by the quality of the transmitted power, due to the output voltage fluctuation caused by the highly variable nature of wind. When designing a power grid, although AC systems are usually the most economical solution because of its highly proven technology, HVDC may arise in some cases (e.g. offshore wind farms as an interesting alternative, offering some added values such as lower losses and better controllability. This way, HVDC technology can solve most of the aforementioned problems and has a good potential for future use. Additionally, the fast development of power electronics based on new and powerful semiconductor devices allow the spread of innovative technologies, such as VSC-HVDC, which can be applied to create DC grids. This paper focuses on the main aspects involved in adapting the existing overhead AC lines to DC grids, with the objective of improving the transmission of distributed renewable energy to the centers of consumption.
Composite Based EHV AC Overhead Transmission Lines
DEFF Research Database (Denmark)
Sørensen, Thomas Kjærsgaard
and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...
Energy Technology Data Exchange (ETDEWEB)
Litzenberger, Wayne; Lava, Val
1994-08-01
References are contained for HVDC systems, converter stations and components, overhead transmission lines, cable transmission, system design and operations, simulation of high voltage direct current systems, high-voltage direct current installations, and flexible AC transmission system (FACTS).
HVDC transmission preferred to 750 kV ac
Energy Technology Data Exchange (ETDEWEB)
1965-06-25
It is unlikely that there will be a need in Britain for ac transmission voltages above 400 kV. But with the growing load density in the large conurbations with no possibility of local generation, high voltage dc transmission is likely to be most useful. It was concluded that by 1971 the 400 kV supergrid would be nation-wide and 6,200 circuit miles should be in service. With the expansion to accommodate the large new generating stations, the 400 kV supergrid would become an extremely high power distribution network rather than a transmission system. A higher voltage for transmission is outside the rational limit of speculation for a country the size of Britain.
A novel wireless power and data transmission AC to DC converter for an implantable device.
Liu, Jhao-Yan; Tang, Kea-Tiong
2013-01-01
This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz.
Flexible AC transmission systems modelling and control
Zhang, Xiao-Ping; Pal, Bikash
2012-01-01
The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and
DEFF Research Database (Denmark)
Xu, Fengda; Guo, Qinglai; Sun, Hongbin
2015-01-01
For an AC/DC coupled transmission system, the change of transmission power on the DC lines will significantly influence the AC systems’ voltage. This paper describes a method to coordinated control the reactive power of power plants and shunt capacitors at DC converter stations nearby, in order t...
International Nuclear Information System (INIS)
Hooshmand, Rahmat-Allah; Hemmati, Reza; Parastegari, Moein
2012-01-01
Highlights: ► To overcome the disadvantages of DC model in Transmission Expansion Planning, AC model should be used. ► The Transmission Expansion Planning associated with Reactive Power Planning results in fewer new transmission lines. ► Electricity market concepts should be considered in Transmission Expansion Planning problem. ► Reliability aspects should be considered in Transmission Expansion Planning problem. ► Particle Swarm Optimization is a suitable optimization method to solve Transmission Expansion Planning problem. - Abstract: Transmission Expansion Planning (TEP) is an important issue in power system studies. It involves decisions on location and number of new transmission lines. Before deregulation of the power system, the goal of TEP problem was investment cost minimization. But in the restructured power system, nodal prices, congestion management, congestion surplus and so on, have been considered too. In this paper, an AC model of TEP problem (AC-TEP) associated with Reactive Power Planning (RPP) is presented. The goals of the proposed planning problem are to minimize investment cost and maximize social benefit at the same time. In the proposed planning problem, in order to improve the reliability of the system the Expected Energy Not Supplied (EENS) index of the system is limited by a constraint. For this purpose, Monte Carlo simulation method is used to determine the EENS. Particle Swarm Optimization (PSO) method is used to solve the proposed planning problem which is a nonlinear mixed integer optimization problem. Simulation results on Garver and RTS systems verify the effectiveness of the proposed planning problem for reduction of the total investment cost, EENS index and also increasing social welfare of the system.
Directory of Open Access Journals (Sweden)
Sungyoon Song
2017-08-01
Full Text Available In the Korean power system, growing power loads have recently created the problems of voltage instability and fault current in the Seoul Capital Area (SCA. Accordingly, the back-to-back (BTB voltage source converter (VSC high-voltage direct-current (HVDC system is emerging to resolve such problems with grid segmentation. However, non-convergence problems occur in this metropolitan area, due to the large change of power flow in some contingencies. Therefore, this paper proposes two kinds of AC transmission emulation control (ATEC strategies to improve the metropolitan transient stability, and to resolve the non-convergence problem. The proposed ATEC strategies are able to mitigate possible overloading of adjacent AC transmission, and maintain power balance between metropolitan regions. The first ATEC strategy uses a monitoring system that permits the reverse power flow of AC transmission, and thus effectively improves the grid stability based on the power transfer equation. The second ATEC strategy emulates AC transmission with DC link capacitors in a permissible DC-link voltage range according to angle difference, and securely improves the gird stability, without requiring grid operator schedule decisions. This paper compares two kinds of ATEC schemes: it demonstrates the first ATEC strategy with specific fault scenario with PSS/E (Power Transmission System Planning Software, and evaluates the second ATEC strategy with internal controller performance with PSCAD/EMTDC (Power System Electromagnetic Transients Simulation Software.
AC Electric Field Communication for Human-Area Networking
Kado, Yuichi; Shinagawa, Mitsuru
We have proposed a human-area networking technology that uses the surface of the human body as a data transmission path and uses an AC electric field signal below the resonant frequency of the human body. This technology aims to achieve a “touch and connect” intuitive form of communication by using the electric field signal that propagates along the surface of the human body, while suppressing both the electric field radiating from the human body and mutual interference. To suppress the radiation field, the frequency of the AC signal that excites the transmitter electrode must be lowered, and the sensitivity of the receiver must be raised while reducing transmission power to its minimally required level. We describe how we are developing AC electric field communication technologies to promote the further evolution of a human-area network in support of ubiquitous services, focusing on three main characteristics, enabling-transceiver technique, application-scenario modeling, and communications quality evaluation. Special attention is paid to the relationship between electro-magnetic compatibility evaluation and regulations for extremely low-power radio stations based on Japan's Radio Law.
Beamforming transmission in IEEE 802.11ac under time-varying channels.
Yu, Heejung; Kim, Taejoon
2014-01-01
The IEEE 802.11ac wireless local area network (WLAN) standard has adopted beamforming (BF) schemes to improve spectral efficiency and throughput with multiple antennas. To design the transmit beam, a channel sounding process to feedback channel state information (CSI) is required. Due to sounding overhead, throughput increases with the amount of transmit data under static channels. Under practical channel conditions with mobility, however, the mismatch between the transmit beam and the channel at transmission time causes performance loss when transmission duration after channel sounding is too long. When the fading rate, payload size, and operating signal-to-noise ratio are given, the optimal transmission duration (i.e., packet length) can be determined to maximize throughput. The relationship between packet length and throughput is also investigated for single-user and multiuser BF modes.
Directory of Open Access Journals (Sweden)
Fuangpian Phanupong
2016-01-01
Full Text Available Nowadays, using of High Voltage Direct Current (HVDC transmission to maximize the transmission efficiency, bulk power transmission, connection of renewable power source from wind farm to the grid is of prime concern for the utility. However, due to the high electric field stress from Direct Current (DC line, the corona discharge can easily be occurred at the conductor surface leading to transmission loss. Therefore, the polarity effect of DC lines on corona inception and breakdown voltage should be investigated. In this work, the effect of DC polarity and Alternating Current (AC field stress on corona inception voltage and corona discharge is investigated on various test objects, such as High Voltage (HV needle, needle at ground plane, internal defect, surface discharge, underground cable without cable termination, cable termination with simulated defect and bare overhead conductor. The corona discharge is measured by partial discharge measurement device with high-frequency current transformer. Finally, the relationship between supply voltage and discharge intensity on each DC polarity and AC field stress can be successfully determined.
Directory of Open Access Journals (Sweden)
Zhongzhou Du
2015-04-01
Full Text Available The signal transmission module of a magnetic nanoparticle thermometer (MNPT was established in this study to analyze the error sources introduced during the signal flow in the hardware system. The underlying error sources that significantly affected the precision of the MNPT were determined through mathematical modeling and simulation. A transfer module path with the minimum error in the hardware system was then proposed through the analysis of the variations of the system error caused by the significant error sources when the signal flew through the signal transmission module. In addition, a system parameter, named the signal-to-AC bias ratio (i.e., the ratio between the signal and AC bias, was identified as a direct determinant of the precision of the measured temperature. The temperature error was below 0.1 K when the signal-to-AC bias ratio was higher than 80 dB, and other system errors were not considered. The temperature error was below 0.1 K in the experiments with a commercial magnetic fluid (Sample SOR-10, Ocean Nanotechnology, Springdale, AR, USA when the hardware system of the MNPT was designed with the aforementioned method.
Progress on advanced dc and ac induction drives for electric vehicles
Schwartz, H. J.
1982-01-01
Progress is reported in the development of complete electric vehicle propulsion systems, and the results of tests on the Road Load Simulator of two such systems representative of advanced dc and ac drive technology are presented. One is the system used in the DOE's ETV-1 integrated test vehicle which consists of a shunt wound dc traction motor under microprocessor control using a transistorized controller. The motor drives the vehicle through a fixed ratio transmission. The second system uses an ac induction motor controlled by transistorized pulse width modulated inverter which drives through a two speed automatically shifted transmission. The inverter and transmission both operate under the control of a microprocessor. The characteristics of these systems are also compared with the propulsion system technology available in vehicles being manufactured at the inception of the DOE program and with an advanced, highly integrated propulsion system upon which technology development was recently initiated.
A Proposal on Low Frequency AC Transmission as a Multi-Terminal Transmission System
Directory of Open Access Journals (Sweden)
Achara Pichetjamroen
2016-08-01
Full Text Available This paper is focused on the discussion and comparison of characteristics and behavior of three low frequency ac (LFAC transmission system configurations operating under the same control scheme and conditions to identify the most promising operation system for LFAC. Merits of LFAC over high voltage direct current (HVDC are mentioned first. By changing power flow direction without auxiliary switches in multi-terminal application and easiness of short circuit protection are explained. The three configurations of LFACs are described and applied by the control scheme with the aid of the tool of the PSCAD/EMTDC software to consider the behavior of each LFAC system on line frequency and low frequency sides. For two-phase system, no fluctuation occurs on the line frequency side, which is the advantage over single-phase system. Furthermore, current rating on thyristor devices during operation and number of devices that used in each type of LFAC are calculated and compared. These results can lead to determine the most suitable transmission system for the LFAC system operation.
Offshore Transmission Technology
Energy Technology Data Exchange (ETDEWEB)
NONE
2012-10-15
The purpose of this document is to give an overview of offshore electricity transmission technologies. In particular this document is concerned with the use of High Voltage Direct Current (HVDC) systems and more specifically with the development of Voltage Source Converter (VSC) technology. This report outlines the current state of the main technology groups required for offshore HVDC transmission as well as giving examples of offshore projects (both current and future). Finally some indications of likely unit costs for HV assets are given.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
International Nuclear Information System (INIS)
Dinh, Minh-Chau; Ju, Chang-Hyeon; Kim, Sung-Kyu; Kim, Jin-Geun; Park, Minwon; Yu, In-Keun
2013-01-01
Highlights: ► A model-sized superconducting VSC-HVDC system was designed and fabricated. ► A real-time simulation using Real Time Digital Simulator has been performed. ► The AC loss characteristics of HTS DC power cable caused by harmonics were analyzed. ► The AC loss of the HTS DC power cable will be used as a parameter to design the cable cooling system. -- Abstract: The combination of a high temperature superconducting DC power cable and a voltage source converter based HVDC (VSC-HVDC) creates a new option for transmitting power with multiple collection and distribution points for long distance and bulk power transmissions. It offers some greater advantages compared with HVAC or conventional HVDC transmission systems, and it is well suited for the grid integration of renewable energy sources in existing distribution or transmission systems. For this reason, a superconducting DC transmission system based HVDC transmission technologies is planned to be set up in the Jeju power system, Korea. Before applying this system to a real power system on Jeju Island, system analysis should be performed through a real time test. In this paper, a model-sized superconducting VSC-HVDC system, which consists of a small model-sized VSC-HVDC connected to a 2 m YBCO HTS DC model cable, is implemented. The authors have performed the real-time simulation method that incorporates the model-sized superconducting VSC-HVDC system into the simulated Jeju power system using Real Time Digital Simulator (RTDS). The performance analysis of the superconducting VSC-HVDC systems has been verified by the proposed test platform and the results were discussed in detail
Energy Technology Data Exchange (ETDEWEB)
Dinh, Minh-Chau, E-mail: thanchau7787@gmail.com [Changwon National University, 9 Sarim-Dong, Changwon 641-733 (Korea, Republic of); Ju, Chang-Hyeon; Kim, Sung-Kyu; Kim, Jin-Geun; Park, Minwon [Changwon National University, 9 Sarim-Dong, Changwon 641-733 (Korea, Republic of); Yu, In-Keun, E-mail: yuik@changwon.ac.kr [Changwon National University, 9 Sarim-Dong, Changwon 641-733 (Korea, Republic of)
2013-01-15
Highlights: ► A model-sized superconducting VSC-HVDC system was designed and fabricated. ► A real-time simulation using Real Time Digital Simulator has been performed. ► The AC loss characteristics of HTS DC power cable caused by harmonics were analyzed. ► The AC loss of the HTS DC power cable will be used as a parameter to design the cable cooling system. -- Abstract: The combination of a high temperature superconducting DC power cable and a voltage source converter based HVDC (VSC-HVDC) creates a new option for transmitting power with multiple collection and distribution points for long distance and bulk power transmissions. It offers some greater advantages compared with HVAC or conventional HVDC transmission systems, and it is well suited for the grid integration of renewable energy sources in existing distribution or transmission systems. For this reason, a superconducting DC transmission system based HVDC transmission technologies is planned to be set up in the Jeju power system, Korea. Before applying this system to a real power system on Jeju Island, system analysis should be performed through a real time test. In this paper, a model-sized superconducting VSC-HVDC system, which consists of a small model-sized VSC-HVDC connected to a 2 m YBCO HTS DC model cable, is implemented. The authors have performed the real-time simulation method that incorporates the model-sized superconducting VSC-HVDC system into the simulated Jeju power system using Real Time Digital Simulator (RTDS). The performance analysis of the superconducting VSC-HVDC systems has been verified by the proposed test platform and the results were discussed in detail.
Energy Technology Data Exchange (ETDEWEB)
Mora-Cantallops, Marcal; Gomis-Bellmunt, Oriol; Sumper, Andreas; Rull-Duran, Joan [Univ. Politecnica de Catalunya, Barcelona (ES). Centre d' Innovacio Tecnologica en Convertidors Estatics i Accionaments (CITCEA-UPC)
2009-07-01
Wind power constitutes one of the more viable alternatives to conventional power generation technology. In the previous years, wind power penetration on electric grids has grown notably, and has brought several new issues related to its integration into power grids. Flexible AC Transmission Systems (FACTS) installed in the right place and controlled conveniently are able to mitigate and solve many of these issues. In the present work, a STATCOM and a SSSC are used coordinately to fully support an electric grid. Simulations include normal and fault operation. (orig.)
High Voltage AC underground cable systems for power transmission
DEFF Research Database (Denmark)
Bak, Claus Leth; Silva, Filipe Miguel Faria da
2016-01-01
researching electrical engineering topics related to using underground cables for power transmission at EHV level and including the 420 kV level. The research topics were laid down by ET/AAU and Energinet.dk in the DANPAC (DANish Power systems with AC Cables) research project. The main topics are discussed...... on the basis of 39 references published by ET/AAU and Energinet.dk. Part I of the paper explains the events that lead to the research project, reactive power compensation, modelling for transient studies, including field measurements and improvements to the existing models, and temporary overvoltages due...... to resonances. Part II covers transient phenomena, harmonics in cables, system modelling for different phenomena, main and backup protections in cable-based networks, online fault detection and future trends....
High Voltage AC underground cable systems for power transmission
DEFF Research Database (Denmark)
Bak, Claus Leth; Silva, Filipe Miguel Faria da
2016-01-01
researching electrical engineering topics related to using underground cables for power transmission at EHV level and including the 420 kV level. The research topics were laid down by ET/AAU and Energinet.dk in the DANPAC (DANish Power systems with Ac Cables) research project. The main topics are discussed...... on the basis of 39 references published by ET/AAU and Energinet.dk. Part I of the paper explains the events that lead to the research project, reactive power compensation, modelling for transient studies, including field measurements and improvements to the existing models, and temporary overvoltages due...... to resonances. Part II covers transient phenomena, harmonics in cables, system modelling for different phenomena, main and backup protections in cable-based networks, online fault detection and future trends....
Research on key technology of planning and design for AC/DC hybrid distribution network
Shen, Yu; Wu, Guilian; Zheng, Huan; Deng, Junpeng; Shi, Pengjia
2018-04-01
With the increasing demand of DC generation and DC load, the development of DC technology, AC and DC distribution network integrating will become an important form of future distribution network. In this paper, the key technology of planning and design for AC/DC hybrid distribution network is proposed, including the selection of AC and DC voltage series, the design of typical grid structure and the comprehensive evaluation method of planning scheme. The research results provide some ideas and directions for the future development of AC/DC hybrid distribution network.
High-voltage direct current (HVDC) transmission - a key technology for our power supply
International Nuclear Information System (INIS)
Dorn, J.
2016-01-01
The phasing-out of nuclear power in some countries and the aspirations of reducing carbon dioxide emissions have far-reaching implications for electric power generation in Europe. In the future, renewable electricity generation will account for a considerable share of the energy mix, but this type of production is often far from the load centers. In Germany, for example, large quantities of wind energy are already generated in the north and in the North Sea, but large load centers are located several hundred kilometers south of there. This requires an expansion of the transmission network with innovative solutions. High-voltage direct-current (HVDC) transmission plays an important role, since it brings a number of advantages over conventional AC technology and makes certain requirements feasible, for example Cable transmission over longer distances. The lecture presents the advantages of HVDC, the semiconductors used as well as the basic functions and typical performance of the used converter topopologies. The plant configurations and main components are illustrated using current projects. (rössner) [de
High voltage transmission of electrical energy over long distances
Energy Technology Data Exchange (ETDEWEB)
Tewari, S W
1962-07-01
Technical aspects of ac transmission lines, additional means of improving stability ac transmisson lines, insulation problems, ac transmission by cables, high voltage dc transmission, advantages of dc over ac transmission, disadvantages of dc transmission, use of underground cables for dc transmission, history of the development of conversion equipment; transmission schemes adopted on Gotland Island, Sweden; and economics of ac and dc transmission are discussed.
AC losses in multilayer power transmission cables comprised of YBCO tapes
International Nuclear Information System (INIS)
Noji, H.
2011-01-01
I calculate AC properties in YBCO cable by an electric circuit model. The optimal helical pitches are determined by the calculation. The layer's current distribution is uniform on the optimal helical pitches. The calculation is useful as a first approximation of AC losses. AC losses in multilayer power transmission cables can be reduced by adjusting the helical winding pitch of each layer to make the layer's current distribution uniform. The optimum helical pitch can be estimated using an electric circuit (EC) model based on the expression that calculates the losses in the superconducting tapes composing the cable. It is known that the losses in a monolayer cable depend on the cable parameters (i.e., the gap between neighboring tapes, number of tapes N, diameter of the cable former and width of the tape). However, regarding Amemiya et al.'s measurement on the losses in monolayer cables, the numerical results of the losses calculated using the Norris formula for an isolated thin strip N times are close to the experimental results. Then, to determine the losses in a three-layer cable that Mukoyama et al. have reported, the losses are calculated by the EC model based on the Norris formula. The helical pitch of each layer is adjusted to make the layer's current distribution uniform in the cable reported by Mukoyama et al. The optimum helical pitches are calculated using the condition where the standard deviation of the layer currents is minimum, and the losses of the cable at the optimum helical pitches are calculated at 1 kA rms . By comparing the results of these calculations with the previously measured results, it was found that the mean error of the calculated values relative to the measured values is 23.7%, which indicates that the calculation using the EC model is useful as a first approximation.
Directory of Open Access Journals (Sweden)
Jaime A. López-López
2016-07-01
Full Text Available This paper deals with the Transmission Network Expansion Planning (TNEP problem. The TNEP consists of finding a set of new circuits on a power system, which is needed to attend a future demand. In its classical version, the TNEP only considers as solution candidates the addition of new lines and transformers. The main contribution of this paper consists in the inclusion of nonconventional solution candidates, namely the repowering of existing circuits and the location of capacitor banks. To take into account these last ones an AC model of the transmission network is considered. The solution of the proposed model is carried out using a Hybrid Genetic Algorithm. Results are compared and validated with previous works in the technical literature. The test systems used are the Garver system and IEEE 24 bus system. The results obtained in both systems showed that the inclusion of the non-conventional candidates, proposed in this paper, allows to reduce the cost of network expansion. This fact may be useful as an indicator for the system planner to consider new possibilities in the expansion studies.
Efficiency estimation method of three-wired AC to DC line transfer
Solovev, S. V.; Bardanov, A. I.
2018-05-01
The development of power semiconductor converters technology expands the scope of their application to medium voltage distribution networks (6-35 kV). Particularly rectifiers and inverters of appropriate power capacity complement the topology of such voltage level networks with the DC links and lines. The article presents a coefficient that allows taking into account the increase of transmission line capacity depending on the parameters of it. The application of the coefficient is presented by the example of transfer three-wired AC line to DC in various methods. Dependences of the change in the capacity from the load power factor of the line and the reactive component of the resistance of the transmission line are obtained. Conclusions are drawn about the most efficient ways of converting a three-wired AC line to direct current.
Offshore VSC-HVDC Networks : Impact on Transient Stability of AC Transmission Systems
van der Meer, A.A.
2017-01-01
The transition towards a sustainable society calls for the massive deployment of renewable energy sources such as large wind parks located far offshore. High-voltage direct current transmission based on voltage sourced converter technology (VSC-HVDC) offers a wide range of technological benefits
Modelling of long High Voltage AC Cables in the Transmission System
DEFF Research Database (Denmark)
Gudmundsdottir, Unnur Stella
: conductor-insulation (with or without SC layers)-conductor-insulation(-conductor-insulation), whereas a transmission line single core XLPE cable will normally have the configuration: conductor-SC layerinsulation-SC layer-conductor-SC layer-conductor-insulation. Furthermore the existing cable models use......, EMTDC/PSCAD is provided. A typical HV AC underground power cable is formed by 4 main layers, namely; Conductor-Insulation-Screen-Insulation. In addition to these main layers, the cable also has semiconductive screens, swelling tapes and metal foil. For high frequency modelling in EMT-based software......-SC layer-solid hollow conductor) is implemented in the model. These improvements result in a more correct series impedance and hence a more correct damping of the simulations. Even though the series impedance is more correct, it does still not include the proximity effect and high frequency oscillations...
Trends of HVDC technology - highly reliable converting equipment
International Nuclear Information System (INIS)
Muraoka, Yasuo; Kato, Yasushi; Watanabe, Atsumi; Kano, Takashi; Kawai, Tadao
1983-01-01
At present, the DC power transmission in Japan is practically used for the system connection of relatively small capacity, and the reliability of AC-DC converting system has been proven to exceed the world level by the operational results. However, when the application of this system to trunk power transmission of large capacity in future is considered, it is desirable to raise the reliability of converting equipment further and to develop the stabilized control techniques in harmony with connected AC system. Hitachi Ltd. has developed diversified system-related technologies centering around DC power transmission and the techniques for raising the reliability of converting equipment tending to large capacity. In this report, the results and the future prospect are described. The recent trend of DC power transmission, the development of DC power transmission technology such as the simulation analysis, the stable operation of a DC system connected to a weak AC system and the DC independent transmission from nuclear power stations, the technical development of light direct ignition thyristor bulbs and control protection equipment are reported. (Kako, I.)
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
Forni, F.; Shi, Y.; Van Den Boom, H.P.A.; Tangdiongga, E.; Koonen, A.M.J.
2017-01-01
We demonstrated the simultaneous transmission of multiband LTE-A signals, a WiFi IEEE802.11ac and a gigabit/s baseband 4-PAM signal over 1mm core diameter PMMA GI-POF. The optical link used a red light 650 nm laser diode and a p-i-n photodiode with a transimpedance amplifier. The 4-PAM transmission
Full-duplex transmission of IEEE 802.11ac-compliant MIMO WLAN signals over a 2-km 7-core fiber
Fan, Yuting; Li, Jianqiang; Lei, Yi; Tang, Ming; Yin, Feifei; Dai, Yitang; Xu, Kun
2017-01-01
In this Letter, we experimentally demonstrate a full-duplex transmission system of IEEE 802.11ac-compliant multiple-input multiple-output (MIMO) signals over a 2-km 7-core fiber for in-building wireless local-area network (WLAN) distributed antenna systems. For full-duplex 3 � 3 MIMO
Transmission investment problems in Europe: Going beyond standard solutions
International Nuclear Information System (INIS)
Buijs, Patrik; Bekaert, David; Cole, Stijn; Van Hertem, Dirk; Belmans, Ronnie
2011-01-01
The European transmission grid is facing an investment challenge. There is a strong call for more transmission capacity. At the same time, the investment climate is fierce and troubled by public opposition, a complex regulatory framework, etc. Many transmission capacity expansion projects are delayed or canceled. In this paper different technology options suitable for increasing transmission capacity are discussed. The aim is to provide policy-makers with information on technologies without going too much into technical details. The focus is on opportunities and limitations to implement various technological alternatives in practice, including technical solutions that go beyond constructing new connection lines. The criteria used in this technology assessment are based on the obstacles reported in the European Priority Interconnection Plan. This ensures a realistic approach based on problems encountered in real projects. Although AC overhead lines (OHL) will remain the standard solution for grid expansion, it is argued that different technology options can overcome many obstacles that OHL face. Additionally, it is illustrated that the higher investment costs for some solutions can be offset with an increased benefit, e.g. by accomplishing investments with smaller delays due to fewer obstacles encountered. - Research highlights: → Assessment of real problems encountered in transmission investments. → Comparison of transmission technologies. → Techno-economic evaluation of transmission technologies.
Hybrid AC-High Voltage DC Grid Stability and Controls
Yu, Jicheng
The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient
Introduction of hvdc transmission into a predominantly ac network
Energy Technology Data Exchange (ETDEWEB)
Casson, W; Last, F H; Huddart, K W
1966-02-01
Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.
Spacecraft TT&C and information transmission theory and technologies
Liu, Jiaxing
2015-01-01
Spacecraft TT&C and Information Transmission Theory and Technologies introduces the basic theory of spacecraft TT&C (telemetry, track and command) and information transmission. Combining TT&C and information transmission, the book presents several technologies for continuous wave radar including measurements for range, range rate and angle, analog and digital information transmissions, telecommand, telemetry, remote sensing and spread spectrum TT&C. For special problems occurred in the channels for TT&C and information transmission, the book represents radio propagation features and its impact on orbit measurement accuracy, and the effects caused by rain attenuation, atmospheric attenuation and multi-path effect, and polarization composition technology. This book can benefit researchers and engineers in the field of spacecraft TT&C and communication systems. Liu Jiaxing is a professor at The 10th Institute of China Electronics Technology Group Corporation.
Lei, Yi; Li, Jianqiang; Meng, Ziyi; Wu, Rui; Wan, Zhiquan; Fan, Yuting; Zhang, Wenjia; Yin, Feifei; Dai, Yitang; Xu, Kun
2018-01-01
In this paper, we have experimentally demonstrated the feasibility of space-division-multiplexed 3 × 3 multiple-input multiple-output (MIMO) transmission over a single OM3 multimode fiber (MMF) using commercial IEEE 802.11 n/ac access points. Throughput performance for different fiber length links
Recent Progress in Space-Division Multiplexed Transmission Technologies
DEFF Research Database (Denmark)
Morioka, Toshio
2013-01-01
Recent development of transmission technologies based on space-division multiplexing is described with future perspectives including a recent achievement of one Pb/s transmission in a single strand of fiber....
Directory of Open Access Journals (Sweden)
Jikai Chen
2016-12-01
Full Text Available At present, the research is still in the primary stage in the process of fault disturbance energy transfer in the multilevel modular converter based high voltage direct current (HVDC-MMC. An urgent problem is how to extract and analyze the fault features hidden in MMC electrical information in further studies on the HVDC system. Aiming at the above, this article analyzes the influence of AC transient disturbance on electrical signals of MMC. At the same time, it is found that the energy distribution of electrical signals in MMC is different for different arms in the same frequency bands after the discrete wavelet packet transformation (DWPT. Renyi wavelet packet energy entropy (RWPEE and Renyi wavelet packet time entropy (RWPTE are proposed and applied to AC transient fault feature extraction from electrical signals in MMC. Using the feature extraction results of Renyi wavelet packet entropy (RWPE, a novel recognition method is put forward to recognize AC transient faults using the information fusion technology. Theoretical analysis and experimental results show that the proposed method is available to recognize transient AC faults.
Coordinating Flexibility under Uncertainty in Multi-Area AC and DC Grids
DEFF Research Database (Denmark)
Halilbasic, Lejla; Chatzivasileiadis, Spyros; Pinson, Pierre
2017-01-01
In the future, mixed AC and DC grids, spanning multiple areas operated by different transmission system operators (TSO), are expected to offer the necessary controllability for integrating large amounts of intermittent renewable generation. This is facilitated by high voltage direct current...... transmission based on voltage source converter technology that can offer recourse actions in the form of preventive and corrective control of both active and reactive power. Market-clearing procedures, based on optimal power flow algorithms, need to be revised to account for DC transmission, flexibility...... and privacy requirements. To this end, we propose a decentralized two-stage stochastic market-clearing algorithm that incorporates meshed DC grids and allows the sharing of flexibility resources between areas. The benefit of this approach lies in its pricing mechanism, used for coordinating the different area...
Large rotorcraft transmission technology development program
Mack, J. C.
1983-01-01
Testing of a U.S. Army XCH-62 HLH aft rotor transmission under NASA Contract NAS 3-22143 was successfully completed. This test establishes the feasibility of large, high power rotorcraft transmissions as well as demonstrating the resolution of deficiencies identified during the HLH advanced technology programs and reported by USAAMRDLTR-77-38. Over 100 hours of testing was conducted. At the 100% design power rating of 10,620 horsepower, the power transferred through a single spiral bevel gear mesh is more than twice that of current helicopter bevel gearing. In the original design of these gears, industry-wide design methods were employed and failures were experienced which identified problem areas unique to gear size. To remedy this technology shortfall, a program was developed to predict gear stresses using finite element analysis for complete and accurate representation of the gear tooth and supporting structure. To validate the finite element methodology gear strain data from the existing U.S. Army HLH aft transmission was acquired, and existing data from smaller gears were made available.
Transmission line capital costs
International Nuclear Information System (INIS)
Hughes, K.R.; Brown, D.R.
1995-05-01
The displacement or deferral of conventional AC transmission line installation is a key benefit associated with several technologies being developed with the support of the U.S. Department of Energy's Office of Energy Management (OEM). Previous benefits assessments conducted within OEM have been based on significantly different assumptions for the average cost per mile of AC transmission line. In response to this uncertainty, an investigation of transmission line capital cost data was initiated. The objective of this study was to develop a database for preparing preliminary estimates of transmission line costs. An extensive search of potential data sources identified databases maintained by the Bonneville Power Administration (BPA) and the Western Area Power Administration (WAPA) as superior sources of transmission line cost data. The BPA and WAPA data were adjusted to a common basis and combined together. The composite database covers voltage levels from 13.8 to 765 W, with cost estimates for a given voltage level varying depending on conductor size, tower material type, tower frame type, and number of circuits. Reported transmission line costs vary significantly, even for a given voltage level. This can usually be explained by variation in the design factors noted above and variation in environmental and land (right-of-way) costs, which are extremely site-specific. Cost estimates prepared from the composite database were compared to cost data collected by the Federal Energy Regulatory Commission (FERC) for investor-owned utilities from across the United States. The comparison was hampered because the only design specifications included with the FERC data were voltage level and line length. Working within this limitation, the FERC data were not found to differ significantly from the composite database. Therefore, the composite database was judged to be a reasonable proxy for estimating national average costs
Optimisation of VSC-HVDC Transmission for Wind Power Plants
DEFF Research Database (Denmark)
Silva, Rodrigo Da
Connection of Wind Power Plants (WPP), typically oshore, using VSCHVDC transmission is an emerging solution with many benefits compared to the traditional AC solution, especially concerning the impact on control architecture of the wind farms and the grid. The VSC-HVDC solution is likely to meet...... more stringent grid codes than a conventional AC transmission connection. The purpose of this project is to analyse how HVDC solution, considering the voltage-source converter based technology, for grid connection of large wind power plants can be designed and optimised. By optimisation, the project...... the robust control technique is applied is compared with the classical proportional-integral (PI) performance, by means of time domain simulation in a point-to-point HVDC connection. The three main parameters in the discussion are the wind power delivered from the offshore wind power plant, the variation...
Electric power transmission for a Hanford Nuclear Energy Center (HNEC)
International Nuclear Information System (INIS)
1975-09-01
The major issues examined in the comparison of the DIST and HNEC transmission concepts are: (1) type of transmission to be employed and an assessment of its technical feasibility, (2) availability of rights-of-way, (3) economics, (4) environmental impact, and (5) overall reliability of the transmission system. The type of transmission selected for bulk power transfer from an HNEC for the time period studied is overhead AC, 500 kV double or single circuit, a voltage currently used in the PNW system. This type of system can accommodate growth up to at least 23,000 MW of thermal capacity at an HNEC. Significant additional transmountain capacity needs would require 1100 kV transmission, which should be technologically proved by the end of the 1970s. (auth)
Development of a fabrication technology for double-sided AC-coupled silicon microstrip detectors
International Nuclear Information System (INIS)
Dalla Betta, G.-F.; Boscardin, M.; Bosisio, L.; Rachevskaia, I.; Zen, M.; Zorzi, N.
2001-01-01
We report on the development of a fabrication technology for double-sided, AC-coupled silicon microstrip detectors for tracking applications. Two batches of detectors with good electrical figures and a low defect rate were successfully manufactured at IRST Laboratory. The processing techniques and the experimental results obtained from these detector prototypes are presented and discussed
High voltage direct current transmission converters, systems and DC grids
Jovcic, Dragan
2015-01-01
This comprehensive reference guides the reader through all HVDC technologies, including LCC (Line Commutated Converter), 2-level VSC and VSC HVDC based on modular multilevel converters (MMC) for an in-depth understanding of converters, system level design, operating principles and modeling. Written in a tutorial style, the book also describes the key principles of design, control, protection and operation of DC transmission grids, which will be substantially different from the practice with AC transmission grids. The first dedicated reference to the latest HVDC technologies and DC grid developments; this is an essential resource for graduate students and researchers as well as engineers and professionals working on the design, modeling and operation of DC grids and HVDC.
HVDC transmission from nuclear power plant
International Nuclear Information System (INIS)
Yoshida, Yukio; Takenaka, Kiyoshi; Ichikawa, Takemi; Ueda, Kiyotaka; Machida, Takehiko
1979-01-01
The HVDC transmission directly from nuclear power plants is one of the patterns of long distance and large capacity HVDC transmission systems. In this report, the double pole, two-circuit HVDC transmission from a BWR nuclear power plant is considered, and the dynamic response characteristics due to the faults in dc line and ac line of inverter side are analyzed, to clarify the dynamic characteristics of the BWR nuclear power plant and dc system due to system faults and the effects of dc power control to prevent reactor scram. (1) In the instantaneous earthing fault of one dc line, the reactor is not scrammed by start-up within 0.8 sec. (2) When the earthing fault continues, power transmission drops to 75% by suspending the faulty pole, and the reactor is scrammed. (3) In the instantaneous ground fault of 2 dc lines, the reactor is not scrammed if the faulty dc lines are started up within 0.4 sec. (4) In the existing control of dc lines, the reactor is scrammed when the ac voltage at an ac-dc connection point largely drops due to ac failure. (J.P.N.)
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
For widening the application of photovoltaic power generation, the AC (alternating current) module technology was examined for validity, and effective ways to utilize the technology and tasks to solve for its further development were studied. In fiscal 1999, concerning the validity of the AC module technology, it was shown quantitatively that attention should be paid to the inhibition of radio interference although the AC module was the more advantageous when under the influence of shadow. In the study of various measures for utilizing the technology, it was shown that, although the technology contained many tasks to discharge, such as need for downsizing and cost reduction, improvement on environmental resistance, and the prevention of radio interference, yet it had many advantages expected to turn up in the future, such as reduced influence of shadow, high flexibility in system design, and decreased installation cost. In the study of technical tasks to discharge in the course of development, it was stated that AC module integrated inverters (MICs) were already on the market, that an autonomous distributed type system control method suited the purpose of AC module systems, and that it was important to develop a thin MIC technology for application in the next generation. (NEDO)
Facts controllers in power transmission and distribution
Padiyar, KR
2007-01-01
About the Book: The emerging technology of Flexible AC Transmission System (FACTS) enables planning and operation of power systems at minimum costs, without compromising security. This is based on modern high power electronic systems that provide fast controllability to ensure ''flexible'' operation under changing system conditions. This book presents a comprehensive treatment of the subject by discussing the operating principles, mathematical models, control design and issues that affect the applications. The concepts are explained often with illustrative examples and case studies. In partic
Research on UAV Intelligent Obstacle Avoidance Technology During Inspection of Transmission Line
Wei, Chuanhu; Zhang, Fei; Yin, Chaoyuan; Liu, Yue; Liu, Liang; Li, Zongyu; Wang, Wanguo
Autonomous obstacle avoidance of unmanned aerial vehicle (hereinafter referred to as UAV) in electric power line inspection process has important significance for operation safety and economy for UAV intelligent inspection system of transmission line as main content of UAV intelligent inspection system on transmission line. In the paper, principles of UAV inspection obstacle avoidance technology of transmission line are introduced. UAV inspection obstacle avoidance technology based on particle swarm global optimization algorithm is proposed after common obstacle avoidance technologies are studied. Stimulation comparison is implemented with traditional UAV inspection obstacle avoidance technology which adopts artificial potential field method. Results show that UAV inspection strategy of particle swarm optimization algorithm, adopted in the paper, is prominently better than UAV inspection strategy of artificial potential field method in the aspects of obstacle avoidance effect and the ability of returning to preset inspection track after passing through the obstacle. An effective method is provided for UAV inspection obstacle avoidance of transmission line.
International Nuclear Information System (INIS)
Cong Haoxi; Li Qingmin; Xing Jinyuan; Li Jinsong; Chen Qiang
2015-01-01
The prompt extinction of the secondary arc is critical to the single-phase reclosing of AC transmission lines, including half-wavelength power transmission lines. In this paper, a low-voltage physical experimental platform was established and the motion process of the secondary arc was recorded by a high-speed camera. It was found that the arcing time of the secondary arc rendered a close relationship with its arc length. Through the input and output power energy analysis of the secondary arc, a new critical length criterion for the arcing time was proposed. The arc chain model was then adopted to calculate the arcing time with both the traditional and the proposed critical length criteria, and the simulation results were compared with the experimental data. The study showed that the arcing time calculated from the new critical length criterion gave more accurate results, which can provide a reliable criterion in term of arcing time for modeling and simulation of the secondary arc related with power transmission lines. (paper)
Energy Technology Data Exchange (ETDEWEB)
Melo, A C.G. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil); Fontoura Filho, R N [ELETROBRAS, Rio de Janeiro, RJ (Brazil); Peres, L A.P. Pecorelli [FURNAS, Rio de Janeiro, RJ (Brazil); Morozowski Filho, M [Santa Catarina Univ., Florianopolis, SC (Brazil)
1994-12-31
Initially, this paper summarizes the approach developed by the Brazilian Planning Criteria Working Group (GTCP/ELETROBRAS) for identifying which subset of transmission investments should be postponed to meet a pre-stablished budget constraint with the least possible impact on system performance. Next, this paper presents the main features of the computational model PRIO, which allows the application of the ranking process to large scale power systems (2,000 buses and 3,000 circuits), with as many as 100 projects to be ranked. In this model, the adequacy analysis of each system state is carried out through an AC power flow coupled to a successive linear programming based remedial actions model. Case studies with the IEEE-RTS system and a configuration of the Brazilian Southeastern are presented and discussed. (author) 7 refs., 6 figs., 5 tabs.
FEV's new parallel hybrid transmission with single dry clutch and electric torque support
Energy Technology Data Exchange (ETDEWEB)
Hellenbroich, Gereon [VKA, RWTH Aachen (Germany); Rosenburg, Volker [FEV Motorentechnik GmbH, Aachen (Germany)
2009-07-01
FEV is currently developing a new 7-speed hybrid transmission for transverse installation. The transmission with a design torque of 320 Nm is based on AMT (automated manual transmission) technology and uses a single electric motor. The innovative gear set layout combines the advantages of modern AMTs such as best efficiency, low costs and few components with full hybrid capabilities and electric torque support during all gear shifts. Furthermore, the gear set layout allows for very short-shift-times due to the favorable distribution of inertias. Other features include an A/C compressor being electrically driven by the electric motor of the transmission during start/stop phases. (orig.)
AC loss in superconducting tapes and cables
Oomen, M.P.
2000-01-01
The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers
Advanced DC/AC inverters applications in renewable energy
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Highly efficient solutions for smart and bulk power transmission of 'green energy'
Energy Technology Data Exchange (ETDEWEB)
Breuer, Wilfried; Retzmann, Dietmar; Uecker, Karl
2010-09-15
Environmental constraints, loss minimization and CO2 reduction will play an increasingly more important role in future. Security and sustainability of power supply as well as economic efficiency needs application of advanced technologies. Innovative solutions with HVDC (High Voltage Direct Current) and FACTS (Flexible AC Transmission Systems) have the potential to cope with these challenges. They provide the features which are necessary to avoid technical problems in power systems, they increase the transmission capacity and system stability very efficiently and help prevent cascading outages. Furthermore, they are essential for Grid Access of Renewable Energy Sources such as Hydro, Wind and Solar-Energy.
A Vision of China-Arab Interconnection Transmission Network Planning with UHVDC Technology
Wu, Dan; Liu, Yujun; Yin, Hongyuan; Xu, Qingshan; Xu, Xiaohui; Ding, Maosheng
2017-05-01
Developments in ultra-high-voltage (UHV) power systems and clean energy technologies are paving the way towards unprecedented energy market globalization. In accordance with the international community’s enthusiasm for building up the Global Energy Internet, this paper focuses on the feasibility of transmitting large-size electricity from northwest China to Arab world through a long-distance transnational power interconnection. The complete investigations on the grids of both the sending-end and receiving-end is firstly presented. Then system configuration of the transmission scheme and corridor route planning is proposed with UHVDC technology. Based on transmission costs’ investigation about similar transmission projects worldwide, the costs of the proposed transmission scheme are estimated through adjustment factors which represent differences in latitude, topography and economy. The proposed China-Arab transmission line sheds light on the prospects of power cooperation and resource sharing between China and Arab states, and appeals for more emphasis on green energy concentrated power interconnections from a global perspective.
Interior point algorithm-based power flow optimisation of a combined AC and DC multi-terminal grid
Directory of Open Access Journals (Sweden)
Farhan Beg
2015-01-01
Full Text Available The high cost of power electronic equipment, lower reliability and poor power handling capacity of the semiconductor devices had stalled the deployment of systems based on DC (multi-terminal direct current system (MTDC networks. The introduction of voltage source converters (VSCs for transmission has renewed the interest in the development of large interconnected grids based on both alternate current (AC and DC transmission networks. Such a grid platform also realises the added advantage of integrating the renewable energy sources into the grid. Thus a grid based on DC MTDC network is a possible solution to improve energy security and check the increasing supply demand gap. An optimal power solution for combined AC and DC grids obtained by the solution of the interior point algorithm is proposed in this study. Multi-terminal HVDC grids lie at the heart of various suggested transmission capacity increases. A significant difference is observed when MTDC grids are solved for power flows in place of conventional AC grids. This study deals with the power flow problem of a combined MTDC and an AC grid. The AC side is modelled with the full power flow equations and the VSCs are modelled using a connecting line, two generators and an AC node. The VSC and the DC losses are also considered. The optimisation focuses on several different goals. Three different scenarios are presented in an arbitrary grid network with ten AC nodes and five converter stations.
Upgrading transmission lines with aerial LiDAR technology
Energy Technology Data Exchange (ETDEWEB)
Koop, J.E. [Manitoba Hydro, Winnipeg, MB (Canada)
2003-04-01
LiDAR (Light Detection and Ranging) technology is described as an example of techniques used by hydro companies to increase their capacity with existing plants, and within tight budget constraints. LiDAR was chosen by Manitoba Hydro primarily because LiDAR's data collection method offers very fast turn-around time from collection to delivery, and most importantly because of LiDAR's highly accurate ability to map terrain and wire catenary shape in every span. The article describes a case study of the 'Nip and Tuck' method of wire re-tensioning based on LiDAR data, which was used by Manitoba Hydro to create a computer model of Saskatchewan Hydro's transmission line capacity on its 138 kV transmission line between Saskatoon and North Battleford. The model was needed to analyze the existing line conditions in an effort to minimize cascading failures on the 40-year old line. Using the 'Nip and Tuck' technology in combination with LiDAR, SaskPower engineers were able to complete the required modifications to raise transmission wire operating temperatures on the 135 km long line to 66 degree C in only 36 days, and at a cost that was 80 per cent less than the cost would have been using conventional techniques ($232,000 instead of the estimated $1.25 million).
ac propulsion system for an electric vehicle
Geppert, S.
1980-01-01
It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.
Directory of Open Access Journals (Sweden)
Daniel Ludois
2010-06-01
Full Text Available The application of high voltage dc (HVDC transmission for integrating large scale and/or off-shore wind generation systems with the electric grid is attractive in comparison to extra high voltage (EHV ac transmission due to a variety of reasons. While the technology of classical current sourced converters (CSC using thyristors is well established for realization of large HVDC systems, the technology of voltage sourced converters (VSC is emerging to be an alternative approach, particularly suitable for multi-terminal interconnections. More recently, a more modular scheme that may be termed ‘bridge of bridge’ converters (BoBC has been introduced to realize HVDC systems. While all these three approaches are functionally capable of realizing HVDC systems, the converter power circuit design trade-offs between these alternatives are not readily apparent. This paper presents an examination of these topologies from the point of view of power semiconductor requirements, reactive component requirements, operating losses, fault tolerance, multi-terminal operation, modularity, complexity, etc. Detailed analytical models will be used along with a benchmark application to develop a comparative evaluation of the alternatives that maybe used by wind energy/bulk transmission developers for performing engineering trade-off studies.
New long-distance transmissions in Russia may use hvdc
Energy Technology Data Exchange (ETDEWEB)
1940-09-01
Hvdc is considered for Kuibyshev-Moscow and other future Russian long-distance transmissions as a means to obtain higher transmission capacity and lower losses. A total saving of 46% is calculated as compared with ac transmission. An experimental transmission line will be built shortly.
Highly efficient solutions for smart and bulk power transmission of 'green energy'
Energy Technology Data Exchange (ETDEWEB)
Breuer, Wilfried; Retzmann, Dietmar; Uecker, Karl
2010-09-15
Environmental constraints, loss minimization and CO2 reduction will play an increasingly more important role in future. Security and sustainability of power supply as well as economic efficiency needs application of advanced technologies. Innovative solutions with HVDC (High Voltage Direct Current) and FACTS (Flexible AC Transmission Systems) have the potential to cope with these challenges. They provide the features which are necessary to avoid technical problems in power systems, they increase the transmission capacity and system stability very efficiently and help prevent cascading outages. Furthermore, they are essential for Grid Access of Renewable Energy Sources such as Hydro, Wind and Solar-Energy.
HVDC transmission from nuclear power plant
International Nuclear Information System (INIS)
Yoshida, Yukio; Takenaka, Kiyoshi; Taniguchi, Haruto; Ueda, Kiyotaka
1980-01-01
HVDC transmission directly from a nuclear power plant is expected as one of the bulk power transmission systems from distant power generating area. Successively from the analysis of HVDC transmission from BWR-type nuclear power plant, this report discusses dynamic response characteristics of HVDC transmission (double poles, two circuits) from PWR type nuclear power plant due to dc-line faults (DC-1LG, 2LG) and ac-line faults (3LG) near inverter station. (author)
A decomposition method for network-constrained unit commitment with AC power flow constraints
International Nuclear Information System (INIS)
Bai, Yang; Zhong, Haiwang; Xia, Qing; Kang, Chongqing; Xie, Le
2015-01-01
To meet the increasingly high requirement of smart grid operations, considering AC power flow constraints in the NCUC (network-constrained unit commitment) is of great significance in terms of both security and economy. This paper proposes a decomposition method to solve NCUC with AC power flow constraints. With conic approximations of the AC power flow equations, the master problem is formulated as a MISOCP (mixed integer second-order cone programming) model. The key advantage of this model is that the active power and reactive power are co-optimised, and the transmission losses are considered. With the AC optimal power flow model, the AC feasibility of the UC result of the master problem is checked in subproblems. If infeasibility is detected, feedback constraints are generated based on the sensitivity of bus voltages to a change in the unit reactive power generation. They are then introduced into the master problem in the next iteration until all AC violations are eliminated. A 6-bus system, a modified IEEE 30-bus system and the IEEE 118-bus system are used to validate the performance of the proposed method, which provides a satisfactory solution with approximately 44-fold greater computational efficiency. - Highlights: • A decomposition method is proposed to solve the NCUC with AC power flow constraints • The master problem considers active power, reactive power and transmission losses. • OPF-based subproblems check the AC feasibility using parallel computing techniques. • An effective feedback constraint interacts between the master problem and subproblem. • Computational efficiency is significantly improved with satisfactory accuracy
Feasibility Analysis of a Type of Soft Firing Technology with Pneumatic Transmission
Institute of Scientific and Technical Information of China (English)
YANG Jun-rong; MI Liang-chuan; ZHAO Hua
2006-01-01
Aimed at solving the conflict between the requirements of reducing gun recoil and increasing muzzle velocity, a new type of soft firing technology with pneumatic transmission is put forward. By mathematical model and instance simulation, the feasibility analysis of this technique is made. The result shows that the soft firing technology with pneumatic transmission can reduce the maximum pressure on the breechblock by 27 % and increase the muzzle velocity by 20 %. The proposed new approach has the significance to the compatibility of power and flexibility.
Investigation of Transmission Warming Technologies at Various Ambient Conditions
Energy Technology Data Exchange (ETDEWEB)
Jehlik, Forrest; Iliev, Simeon; Wood, Eric; Gonder, Jeff
2017-03-28
This work details two approaches for evaluating transmission warming technology: experimental dynamometer testing and development of a simplified transmission efficiency model to quantify effects under varied real world ambient and driving conditions. Two vehicles were used for this investigation: a 2013 Ford Taurus and a 2011 Ford Fusion. The Taurus included a production transmission warming system and was tested over hot and cold ambient temperatures with the transmission warming system enabled and disabled. A robot driver was used to minimize driver variability and increase repeatability. Additionally the Fusion was tested cold and with the transmission pre-heated prior to completing the test cycles. These data were used to develop a simplified thermally responsive transmission model to estimate effects of transmission warming in real world conditions. For the Taurus, the fuel consumption variability within one standard deviation was shown to be under 0.5% for eight repeat Urban Dynamometer Driving Cycles (UDDS). These results were valid with the transmission warming system active or passive. Using the transmission warming system under 22 degrees C ambient temperature, fuel consumption reduction was shown to be 1.4%. For the Fusion, pre-warming the transmission reduced fuel consumption 2.5% for an urban drive cycle at -7 degrees C ambient temperature, with 1.5% of the 2.5% gain associated with the transmission, while consumption for the US06 test was shown to be reduced by 7% with 5.5% of the 7% gain associated with the transmission. It was found that engine warming due to conduction between the pre-heated transmission and the engine resulted in the remainder of the benefit. For +22 degrees C ambient tests, the pre-heated transmission was shown to reduce fuel consumption approximately 1% on an urban cycle, while no benefit was seen for the US06 cycle. The simplified modeling results showed gains in efficiency ranging from 0-1.5% depending on the ambient
Operation and control of a DC-grid offshore wind farm under DC transmission system faults
DEFF Research Database (Denmark)
Deng, Fujin; Chen, Zhe
2013-01-01
. Consequently, the protection and control strategies of dc systems need to be established. This paper studies a dc-grid offshore wind farm, where the wind power collection system and power transmission system adopt dc technology. In this paper, the redundancy of the HVDC transmission system under faults...... is studied, and a fault ridethrough strategy for the dc-grid offshore wind farm is proposed. The proposed strategy can effectively minimize the impacts of the power transmission system disturbance on the offshore wind farm, and on the ac grid. A dc-grid offshore wind farm example is simulated with PSCAD....../EMTDC, and the results validate the feasibility of the presented redundancy configuration and operation approach, and the fault ridethrough control strategy....
Improvements in or relating to data transmission in radiographic apparatus
International Nuclear Information System (INIS)
Fairbairn, I.A.
1980-01-01
In conventional tomography, the source and detector are rotated about the patient axis through angles which are usually less than 360 0 and hence conventional data transmission via cables is possible. However, greater speed of examination can be obtained if the rotation extends through many revolutions thus allowing a high rotational velocity to be obtained before the examination commences. In such an apparatus, the data transmission is performed by encoding an AC signal which can then be transmitted by a series of slip rings and brushes. Suitable codes for AC transmission are discussed. The problems of good contact between brushes and slip rings at high speed are discussed and it is shown that, by choosing a suitable AC code and its associated electrical circuits, spurious signals are eliminated. (U.K.)
Development of a coordinated control system for BWR nuclear power plant and HVDC transmission system
International Nuclear Information System (INIS)
Ishikawa, M.; Hara, T.; Hirayama, K.; Sekiya, K.
1986-01-01
The combined use of dc and ac transmissions or so-called hybrid transmission was under study, employing both dc and ac systems to enable stable transmission of 10,000 MW of electric power generated by the BWR nuclear plant, scheduled to be built about 800 km away from the center of the load. It was thus necessary to develop a hybrid power transmission control system, the hybrid power transmission system consisting of a high voltage dc transmission system (HVDC) and an ultrahigh ac transmission system (UHVAC). It was also necessary to develop a control system for HVDC transmission which protects the BWR nuclear power plant from being influenced by any change in transmission mode that occurs as a result of faults on the UHVAC side when the entire power of the BWR plant is being sent by the HVDC transmission. This paper clarifies the requirements for the HVDC system control during hybrid transmission and also during dc transmission. The control method that satisfies these requirements was studied to develop a control algorithm
HVDC transmission from isorated nuclear power plant
International Nuclear Information System (INIS)
Takenaka, Kiyoshi; Takasaki, Masahiro; Ichikawa, Tatemi; Hayashi, Toshiyuki
1985-01-01
HVDC transmission directly from nuclear power plant is considered as one of the patterns of long distance and large capacity transmission system. This reports considers two route HVDC transmission from PWR type nuclear power plant, and analyzes dynamic response characteristics due to bus fault, main protection failure and etc. using the AC-DC Power System Simulator. (author)
Energy Technology Data Exchange (ETDEWEB)
Kaya, N [Kobe University, Kobe (Japan). Faculty of Engineering
1994-11-05
This paper explains the principles of microwave power transmission as a long-distance power transmission technology, and the status of its development. Under an assumption of using a wave length of 12 cm (2.45 GHz) and a transmission distance of 1 km, an ideal wireless power transmission can realize transmitting the power at an efficiency of 95% or higher if transmitting and receiving antennas with a radius of 8.8 m are used. What remains as important requirements is raising the efficiency of conversion from power supply into microwaves, and the efficiency of rectification after the power has been received. By using microwave energy sent from a transmission antenna installed on the roof of an automobile, a model airplane with a receiving antenna installed at its rear flew successfully for 40 seconds under the microwave lifted airplane experiment (MILAX). In an experiment of transmitting microwave power in space, power was successfully transmitted to the child rocket as an event under the International Space Year - Microwave Energy Transmission in Space (ISY-METS). The microwave wireless power transmission on the ground would have a possibility of taking over the overhead line transmission into islands. An attempt is scheduled to send power of 5 kW by using transmission and receiving antennas with a diameter of 3 m to investigate effects on transmission efficiency, and communications and electromagnetic environments, and to collect basic data. 3 refs., 3 figs.
International Nuclear Information System (INIS)
Ludwig, Frank; Heim, Erik; Schilling, Meinhard
2009-01-01
We have compared the structure parameters of magnetic core-shell nanoparticles determined from fluxgate magnetorelaxometry measurements applying the moment superposition model with the results from other methods. For the characterization of the magnetic cores, the nanoparticles are immobilized by freeze-drying. The core size distribution estimated for superparamagnetic Fe 3 O 4 magnetic nanoparticles (MNPs) with polyacrylic acid shell agrees well with that from transmission electron microscopy measurements. The distribution of hydrodynamic diameters of nanoparticle suspensions estimated from magnetorelaxometry measurements is in good agreement with that obtained from ac susceptibility and photon correlation spectroscopy measurements. Advantages of magnetorelaxometry compared to the other two integral techniques are that it is fast and the signal is less dominated by larger particles.
Ammonia treated Mo/AC catalysts for CO hydrogenation with ...
Indian Academy of Sciences (India)
SHARIF F ZAMAN
the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.
Electrical and Biological Effects of Transmission Lines: A Review.
Energy Technology Data Exchange (ETDEWEB)
Lee, Jack M.
1989-06-01
This review describes the electrical properties of a-c and d-c transmission lines and the resulting effects on plants, animals, and people. Methods used by BPA to mitigate undesirable effects are also discussed. Although much of the information in this review pertains to high-voltage transmission lines, information on distribution lines and electrical appliances is included. The electrical properties discussed are electric and magnetic fields and corona: first for alternating-current (a-c) lines, then for direct current (d-c).
Interregional power transmission: a component in planning for renewable energy technologies
International Nuclear Information System (INIS)
Krueger Nielsen, S.; Soerensen, B.
2000-01-01
We discuss the role played by interregional power transmission on the basis of recent scenario work. In a project dealing with long-term planning for energy efficiency and renewable energy in Europe we modelled a scenario for the present 15 EU countries' energy system in 2050. The basis for the scenario is the concept of 'fair pricing' for energy services, meaning that the price of energy should reflect all externalities, but not otherwise be taxed or subsidized. The project assessed resource availability and expected technology price developments over time for a number of energy-related technologies, both on the supply side, the intermediate conversion chain and on the demand side. Among these, transmission technologies play an important role, both in smoothing out renewable energy supplies within the European Union region, and also allowing substantial import of energy from countries outside the EU having a surplus of renewable energy based power. (orig.)
Huang, Shuo; Liu, Jing
2010-05-01
Application of clinical digital medical imaging has raised many tough issues to tackle, such as data storage, management, and information sharing. Here we investigated a mobile phone based medical image management system which is capable of achieving personal medical imaging information storage, management and comprehensive health information analysis. The technologies related to the management system spanning the wireless transmission technology, the technical capabilities of phone in mobile health care and management of mobile medical database were discussed. Taking medical infrared images transmission between phone and computer as an example, the working principle of the present system was demonstrated.
Calculation of single phase AC and monopolar DC hybrid corona effects
International Nuclear Information System (INIS)
Zhao, T.; Sebo, S.A.; Kasten, D.G.
1996-01-01
Operating a hybrid HVac and HVdc line is an option for increasing the efficiency of power transmission and overcoming the difficulties in obtaining a new right-of-way. This paper proposes a new calculation method for the study of hybrid line corona. The proposed method can be used to calculate dc corona losses and corona currents in dc or ac conductors for single phase ac and monopolar dc hybrid lines. Profiles of electric field strength and ion current density at ground level can be estimated. The effects of the presence of an energized ac conductor on dc conductor corona and dc voltage on ac conductor corona are included in the method. Full-scale and reduced-scale experiments were utilized to investigate the hybrid line corona effects. Verification of the proposed calculation method is given
Directory of Open Access Journals (Sweden)
Beibei Wang
2017-01-01
Full Text Available There are many uncertain factors in the modern distribution network, including the access of renewable energy sources and the heavy load level. The existence of these factors has brought challenges to the stability of the power distribution network, as well as increasing the risk of exceeding transmission capacity of distribution lines. The appearance of flexible load control technology provides a new idea to solve the above problems. Air conditioners (ACs account for a great proportion of all loads. In this paper, the model of dispatching AC loads in the regional power grid is constructed, and the direct load control (DLC method is adopted to reduce the load of ACs. An improved tabu search technique is proposed to solve the problem of network dispatch in distribution systems in order to reduce the resistive line losses and to eliminate the transmission congestion in lines under normal operating conditions. The optimal node solution is obtained to find the best location and reduction capacity of ACs for load control. To demonstrate the validity and effectiveness of the proposed method, a test system is studied. The numerical results are also given in this article, which reveal that the proposed method is promising.
Novel AC Servo Rotating and Linear Composite Driving Device for Plastic Forming Equipment
Liang, Jin-Tao; Zhao, Sheng-Dun; Li, Yong-Yi; Zhu, Mu-Zhi
2017-07-01
The existing plastic forming equipment are mostly driven by traditional AC motors with long transmission chains, low efficiency, large size, low precision and poor dynamic response are the common disadvantages. In order to realize high performance forming processes, the driving device should be improved, especially for complicated processing motions. Based on electric servo direct drive technology, a novel AC servo rotating and linear composite driving device is proposed, which features implementing both spindle rotation and feed motion without transmission, so that compact structure and precise control can be achieved. Flux switching topology is employed in the rotating drive component for strong robustness, and fractional slot is employed in the linear direct drive component for large force capability. Then the mechanical structure for compositing rotation and linear motion is designed. A device prototype is manufactured, machining of each component and the whole assembly are presented respectively. Commercial servo amplifiers are utilized to construct the control system of the proposed device. To validate the effectiveness of the proposed composite driving device, experimental study on the dynamic test benches are conducted. The results indicate that the output torque can attain to 420 N·m and the dynamic tracking errors are less than about 0.3 rad in the rotating drive. the dynamic tracking errors are less than about 1.6 mm in the linear feed. The proposed research provides a method to construct high efficiency and accuracy direct driving device in plastic forming equipment.
Synthesis, characterization and a.c. magnetic analysis of magnetite nanoparticles
International Nuclear Information System (INIS)
Riani, P.; Napoletano, M.; Canepa, F.
2011-01-01
In the last years, the study of Fe-based magnetic nanoparticles (MNP) has attracted increasing interest either for the physical properties shown by nanosized materials (electric and magnetic properties are strongly affected by dimension and surface effects) either for the different technological applications of these materials (catalysis, drug delivery, magnetic resonance imaging, contaminants removal from groundwater, new exchange coupled magnets, soft nanomagnets for high frequency applications, etc.). In this article, the results obtained in the synthesis and characterization of the Fe 3 O 4 MNP is reported. The magnetite nanoparticles were synthesized by a modified Massart method. Structural characterization was performed using X-ray diffraction analysis and a complete morphological and dimensional study was carried out by means of Transmission Electron Microscopy, and a.c. magnetic susceptibility measured as a function of the frequency of the applied magnetic field. Diameters of the superparamagnetic Fe 3 O 4 nanoparticles are ranging from 2 to 10 nm, as evidenced by all the techniques employed. The size distribution of the hydrated aggregates in solution has been obtained by quantitative analysis of the frequency dependence of the a.c. susceptibility. The mathematical approach adopted will be described and all the obtained results will be compared and discussed.
Ajay Kumar, M.; Srikanth, N. V.
2014-03-01
In HVDC Light transmission systems, converter control is one of the major fields of present day research works. In this paper, fuzzy logic controller is utilized for controlling both the converters of the space vector pulse width modulation (SVPWM) based HVDC Light transmission systems. Due to its complexity in the rule base formation, an intelligent controller known as adaptive neuro fuzzy inference system (ANFIS) controller is also introduced in this paper. The proposed ANFIS controller changes the PI gains automatically for different operating conditions. A hybrid learning method which combines and exploits the best features of both the back propagation algorithm and least square estimation method is used to train the 5-layer ANFIS controller. The performance of the proposed ANFIS controller is compared and validated with the fuzzy logic controller and also with the fixed gain conventional PI controller. The simulations are carried out in the MATLAB/SIMULINK environment. The results reveal that the proposed ANFIS controller is reducing power fluctuations at both the converters. It also improves the dynamic performance of the test power system effectively when tested for various ac fault conditions.
Lizcano, Maricela
2017-01-01
High voltage hybrid electric propulsion systems are now pushing new technology development efforts for air transportation. A key challenge in hybrid electric aircraft is safe high voltage distribution and transmission of megawatts of power (>20 MW). For the past two years, a multidisciplinary materials research team at NASA Glenn Research Center has investigated the feasibility of distributing high voltage power on future hybrid electric aircraft. This presentation describes the team's approach to addressing this challenge, significant technical findings, and next steps in GRC's materials research effort for MW power distribution on aircraft.
Bi, Siwen; Zhen, Ming; Yang, Song; Lin, Xuling; Wu, Zhiqiang
2017-08-01
According to the development and application needs of Remote Sensing Science and technology, Prof. Siwen Bi proposed quantum remote sensing. Firstly, the paper gives a brief introduction of the background of quantum remote sensing, the research status and related researches at home and abroad on the theory, information mechanism and imaging experiments of quantum remote sensing and the production of principle prototype.Then, the quantization of pure remote sensing radiation field, the state function and squeezing effect of quantum remote sensing radiation field are emphasized. It also describes the squeezing optical operator of quantum light field in active imaging information transmission experiment and imaging experiments, achieving 2-3 times higher resolution than that of coherent light detection imaging and completing the production of quantum remote sensing imaging prototype. The application of quantum remote sensing technology can significantly improve both the signal-to-noise ratio of information transmission imaging and the spatial resolution of quantum remote sensing .On the above basis, Prof.Bi proposed the technical solution of active imaging information transmission technology of satellite borne quantum remote sensing, launched researches on its system composition and operation principle and on quantum noiseless amplifying devices, providing solutions and technical basis for implementing active imaging information technology of satellite borne Quantum Remote Sensing.
Solar pumped laser technology options for space power transmission
Conway, E. J.
1986-01-01
An overview of long-range options for in-space laser power transmission is presented. The focus is on the new technology and research status of solar-pumped lasers and their solar concentration needs. The laser options include gas photodissociation lasers, optically-pumped solid-state lasers, and blackbody-pumped transfer lasers. The paper concludes with a summary of current research thrusts.
Improved transistorized AC motor controller for battery powered urban electric passenger vehicles
Peak, S. C.
1982-01-01
An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.
International Nuclear Information System (INIS)
Dinh, Minh-Chau; Ju, Chang-Hyeon; Kim, Sung-Kyu; Kim, Jin-Geun; Park, Minwon; Yu, In-Keun
2012-01-01
The combination of a high temperature superconducting DC power cable and a voltage source converter based HVDC (VSC-HVDC) creates a new option for transmitting power with multiple collection and distribution points for long distance and bulk power transmissions. It offers some greater advantages compared with HVAC or conventional HVDC transmission systems, and it is well suited for the grid integration of renewable energy sources in existing distribution or transmission systems. For this reason, a superconducting DC transmission system based HVDC transmission technologies is planned to be set up in the Jeju power system, Korea. Before applying this system to a real power system on Jeju Island, system analysis should be performed through a real time test. In this paper, a model-sized superconducting VSC-HVDC system, which consists of a small model-sized VSC-HVDC connected to a 2 m YBCO HTS DC model cable, is implemented. The authors have performed the real-time simulation method that incorporates the model-sized superconducting VSC-HVDC system into the simulated Jeju power system using Real Time Digital Simulator (RTDS). The performance analysis of the superconducting VSC-HVDC systems has been verified by the proposed test platform and the results were discussed in detail.
Energy Technology Data Exchange (ETDEWEB)
Dinh, Minh-Chau, E-mail: thanchau7787@gmail.com [Changwon National University, 9 Sarim-Dong, Changwon 641-733 (Korea, Republic of); Ju, Chang-Hyeon; Kim, Sung-Kyu; Kim, Jin-Geun; Park, Minwon [Changwon National University, 9 Sarim-Dong, Changwon 641-733 (Korea, Republic of); Yu, In-Keun, E-mail: yuik@changwon.ac.kr [Changwon National University, 9 Sarim-Dong, Changwon 641-733 (Korea, Republic of)
2012-08-15
The combination of a high temperature superconducting DC power cable and a voltage source converter based HVDC (VSC-HVDC) creates a new option for transmitting power with multiple collection and distribution points for long distance and bulk power transmissions. It offers some greater advantages compared with HVAC or conventional HVDC transmission systems, and it is well suited for the grid integration of renewable energy sources in existing distribution or transmission systems. For this reason, a superconducting DC transmission system based HVDC transmission technologies is planned to be set up in the Jeju power system, Korea. Before applying this system to a real power system on Jeju Island, system analysis should be performed through a real time test. In this paper, a model-sized superconducting VSC-HVDC system, which consists of a small model-sized VSC-HVDC connected to a 2 m YBCO HTS DC model cable, is implemented. The authors have performed the real-time simulation method that incorporates the model-sized superconducting VSC-HVDC system into the simulated Jeju power system using Real Time Digital Simulator (RTDS). The performance analysis of the superconducting VSC-HVDC systems has been verified by the proposed test platform and the results were discussed in detail.
Wireless electricity (Power) transmission using solar based power satellite technology
International Nuclear Information System (INIS)
Maqsood, M; Nasir, M Nauman
2013-01-01
In the near future due to extensive use of energy, limited supply of resources and the pollution in environment from present resources e.g. (wood, coal, fossil fuel) etc, alternative sources of energy and new ways to generate energy which are efficient, cost effective and produce minimum losses are of great concern. Wireless electricity (Power) transmission (WET) has become a focal point as research point of view and nowadays lies at top 10 future hot burning technologies that are under research these days. In this paper, we present the concept of transmitting power wirelessly to reduce transmission and distribution losses. The wired distribution losses are 70 – 75% efficient. We cannot imagine the world without electric power which is efficient, cost effective and produce minimum losses is of great concern. This paper tells us the benefits of using WET technology specially by using Solar based Power satellites (SBPS) and also focuses that how we make electric system cost effective, optimized and well organized. Moreover, attempts are made to highlight future issues so as to index some emerging solutions.
Online Location of Faults on AC Cables in Underground Transmission Systems
DEFF Research Database (Denmark)
Jensen, Christian Flytkjær
under fault conditions well, but the accuracy of the calculated impedance is low for fault location purposes. The neural networks can therefore not be trained and no impedance-based fault location method can be used for crossbonded cables or hybrid lines. The use of travelling wave-based methods...... connection to verify the proposed method. Faults, at reduced a voltage are artificially applied in the cable system and the transient response is measured at two terminals at the cable’s ends. The measurements are time-synchronised and it is found that a very accurate estimation of the fault location can......A transmission grid is normally laid out as an almost pure overhead line (OHL) network. The introduction of transmission voltage level XLPE cables and the increasing interest in the environmental impact of OHL has resulted in an increasing interest in the use of underground cables on transmission...
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
A Review of LCC-HVDC and VSC-HVDC Technologies and Applications
Directory of Open Access Journals (Sweden)
Oluwafemi Emmanuel Oni
2016-09-01
Full Text Available High Voltage Direct Current (HVDC systems has been an alternative method of transmitting electric power from one location to another with some inherent advantages over AC transmission systems. The efficiency and rated power carrying capacity of direct current transmission lines highly depends on the converter used in transforming the current from one form to another (AC to DC and vice versa. A well configured converter reduces harmonics, increases power transfer capabilities, and reliability in that it offers high tolerance to fault along the line. Different HVDC converter topologies have been proposed, built and utilised all over the world. The two dominant types are the line commutated converter LCC and the voltage source converter VSC. This review paper evaluates these two types of converters, their operational characteristics, power rating capability, control capability and losses. The balance of the paper addresses their applications, advantages, limitations and latest developments with these technologies.
Energy Technology Data Exchange (ETDEWEB)
Radtke, U. [PreussenElektra AG, Hannover (Germany)
1998-12-31
High-voltage DC transmission is a world-wide established technology for low-cost transmission of large amounts of electricity over long distances. Thanks to HVDC transmission, large amounts of electricity can now for the first time also be transmitted over long distances via ocean cable, something that cannot be done with AC power cables. HVDC transmission is independent of grid frequencies and can link grids of different frequency and different quality of frequency. Interconnected grids coupled via DC circuits can exploit additional technical and economic advantages such as mutual supply of power reserves, balancing of peak load, and modulation of active and reactive power. (orig.) [Deutsch] Die Hochspannungs-Gleichstromuebertragung (HGUe) ist eine weltweit etablierte Technik zur kostenguenstigen Uebertragung grosser elektrischer Leistungen ueber grosse Entfernungen. Sie schafft erstmals die Moeglichkeit, auch mittels Seekabel grosse Leistungen ueber Entfernungen zu uebertragen, die mit der Drehstromtechnik nicht moeglich sind. HGUeist unabhaengig von den Netzfrequenzen und kann Netze unterschiedlicher Frequenz und Frequenzguete miteinander verbinden. Ueber Gleichstromkreise gekuppelte Verbundnetze koennen zusaetzliche technische und wirtschaftliche Vorteile wie gegenseitige Bereitstellung von Kraftwerksreserven, Spitzenlastausgleich sowie Wirk- und Blindleistungsmodulation nutzt. (orig.)
Simulation of the AC corona phenomenon with experimental validation
International Nuclear Information System (INIS)
Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R
2017-01-01
The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)
Security analysis of interconnected AC/DC systems
DEFF Research Database (Denmark)
Eriksson, Robert
2015-01-01
This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid...... any line or transformer limits. Simulations were performed in a model of the Nordic power system where a dc grid is placed on top. The simulation supports the method as a tool to consider transfer limits in the grid to avoid violate the same and increase the security after a converter outage........ The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...
2013-01-01
ac ta t ropica Experimental acquisition, development, and transmission of Leishmania tropica by Phlebotomus duboscqi Hanafi A. Hanafi, El...August 2012 Accepted 2 September 2012 Available online 10 September 2012 Keywords: Phlebotomus duboscqi Leishmania tropica Transmission Vector...competency a b s t r a c t We report experimental infection and transmission of Leishmania tropica (Wright), by the blood-feeding sand
Energy Technology Data Exchange (ETDEWEB)
Matsumoto, Hiroshi [Kyoto Univ. (Japan)
1989-03-05
Laying stress on the technological problems and effect on the environment of microwave energy transmission, recent scientific and engineering problems and related subjects are described. Because no fuel is required for the solar power generation, the power generation system can not be considered as an expensive one when the unit cost of energy is taken into consideration. Some of the important technological problems in the microwave energy transmission are accurate microwave beam control technology to receiving stations and improvement in the efficiency of transmission system. Microwave energy beam has effects on living bodies, communication, and plasma atmosphere of the earth. Microwave energy transmission using a space flyer unit is scheduled. Its objective is the development of microwave wireless transmission technology and the study of the correlation between high power microwave and ionosphere plasma. Experiments on such a small scale application as a microwave driven space ship to bring results seem also important. 12 refs., 13 figs.
Evaluation of environmental control technologies for magnetic fields
Energy Technology Data Exchange (ETDEWEB)
1978-08-01
The peripheral magnetic fields of several energy-related technologies are calculated, and shielding options are studied for three field intensities as possible exposure levels: 200 G, 10 G, and 0.3 G. Seven fusion reactor designs are studied. For a 200-G field level, shielding is not required. For the 10- and 0.3-G levels, land is the most economical shielding method, with shield coils an acceptable alternative at 0.3 G. Nonnuclear technologies studied are superconducting magnetic energy storage, magnetohydrodynamic (MHD) electric generators, magnetically levitated vehicles, superconducting ac generators, and underground transmission lines. Superconducting ac generators and underground transmission lines require no shielding. The superconducting magnetic energy storage coil requires no shielding for 200 G. Both a shield coil and land are needed to meet 10 G or 0.3 G. The MHD generator needs no shielding to 200 G and 10 G. Land is the most economical means of meeting the 0.3 G level. Most of the magnetically levitated vehicles require no shielding to 200 G. The field on-board can be reduced from 200 to 25 G, depending upon the vehicle design, with shield coils. The use of iron, or another permeable material, is necessary to reduce the field to 10 G or 0.3 G. However, iron introduces too much added weight to allow efficient operation.
Meso Mechanical Analysis of AC Mixture Response
Woldekidan, M.F.; Huurman, M.; Vaccari, E.; Poot, M.
2012-01-01
Ongoing research into performance modeling of Asphalt Concrete (AC) mixtures using meso mechanics approaches is being undertaken at Delft University of Technology (TUD). The approach has already been successfully employed for evaluating the long term performance of porous asphalt concrete. The work
Directory of Open Access Journals (Sweden)
Arslan Habib
2018-03-01
Full Text Available The time and space distribution characteristics of future high proportion of renewable energy sources will bring unprecedented challenges to the electric power system’s processing and planning, the basic form of electric power system and operating characteristics will have fundamental changes. Based on the research status quo at home and abroad, this paper expounds the four scientific problems of the transmission network planning with high proportion of renewable energy. Respectively, from the network source collaborative planning, transmission network flexible planning. With the distribution network in conjunction with the transmission network planning, transmission planning program comprehensive evaluation and decision-making methods. This paper puts forward the research ideas and framework of transmission network planning considering the high proportion of renewable energy. At the end, the future high proportion of (renewable energy grid-connected transmission network’s opportunities and challenges are presented.
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
The ACS-NUCL Division 50th Anniversary: Introduction
Energy Technology Data Exchange (ETDEWEB)
Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2016-01-10
The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
Bai, Chuanyong; Conwell, Richard; Kindem, Joel; Babla, Hetal; Gurley, Mike; De Los Santos, Romer; Old, Rex; Weatherhead, Randy; Arram, Samia; Maddahi, Jamshid
2010-06-01
We developed a cardiac SPECT system (X-ACT) with low dose volume CT transmission-based attenuation correction (AC). Three solid-state detectors are configured to form a triple-head system for emission scans and reconfigured to form a 69-cm field-of-view detector arc for transmission scans. A near mono-energetic transmission line source is produced from the collimated fluorescence x-ray emitted from a lead target when the target is illuminated by a narrow polychromatic x-ray beam from an x-ray tube. Transmission scans can be completed in 1 min with insignificant patient dose (deep dose equivalent used phantom studies to evaluate (1) the accuracy of the reconstructed attenuation maps, (2) the effect of AC on image uniformity, and (3) the effect of AC on defect contrast (DC). The phantoms we used included an ACR phantom, an anthropomorphic phantom with a uniform cardiac insert, and an anthropomorphic phantom with two defects in the cardiac insert. The reconstructed attenuation coefficient of water at 140 keV was .150 +/- .003/cm in the uniform region of the ACR phantom, .151 +/- .003/cm and .151 +/- .002/cm in the liver and cardiac regions of the anthropomorphic phantom. The ACR phantom images with AC showed correction of the bowing effect due to attenuation in the images without AC (NC). The 17-segment scores of the images of the uniform cardiac insert were 78.3 +/- 6.5 before and 87.9 +/- 3.3 after AC (average +/- standard deviation). The inferior-to-anterior wall ratio and the septal-to-lateral wall ratio were .99 and 1.16 before and 1.02 and 1.00 after AC. The DC of the two defects was .528 and .156 before and .628 and .173 after AC. The X-ACT system generated accurate attenuation maps with 1-minute transmission scans. AC improved image quality and uniformity over NC.
Topologically protected loop flows in high voltage AC power grids
International Nuclear Information System (INIS)
Coletta, T; Delabays, R; Jacquod, Ph; Adagideli, I
2016-01-01
Geographical features such as mountain ranges or big lakes and inland seas often result in large closed loops in high voltage AC power grids. Sizable circulating power flows have been recorded around such loops, which take up transmission line capacity and dissipate but do not deliver electric power. Power flows in high voltage AC transmission grids are dominantly governed by voltage angle differences between connected buses, much in the same way as Josephson currents depend on phase differences between tunnel-coupled superconductors. From this previously overlooked similarity we argue here that circulating power flows in AC power grids are analogous to supercurrents flowing in superconducting rings and in rings of Josephson junctions. We investigate how circulating power flows can be created and how they behave in the presence of ohmic dissipation. We show how changing operating conditions may generate them, how significantly more power is ohmically dissipated in their presence and how they are topologically protected, even in the presence of dissipation, so that they persist when operating conditions are returned to their original values. We identify three mechanisms for creating circulating power flows, (i) by loss of stability of the equilibrium state carrying no circulating loop flow, (ii) by tripping of a line traversing a large loop in the network and (iii) by reclosing a loop that tripped or was open earlier. Because voltages are uniquely defined, circulating power flows can take on only discrete values, much in the same way as circulation around vortices is quantized in superfluids. (paper)
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
Reasonability evaluation was progressed on the fundamental technologies having been proposed in fiscal 1998, and development was made on elementary technologies required for system structuring. The proposals made in fiscal 1998 include the deepening of the evaluations on effectiveness of AC modules, long-term stability evaluation on the system control schemes, trial fabrication and evaluation on AC battery modules, and development and installation of 2-kW demonstration facilities. In the effectiveness evaluation, discussions were given not only on advantages, but also on disadvantages. As the advantageous point, theoretical analyses were progressed on the effect of reducing the output drop due to shading, which was made clear by providing values. Effects of increase in switching units on electric wave interference as a disadvantage were made clear. As a form that can be applied consistently from an independent power source to a system coordination system, a flexible system using the module system comprising of AC modules and AC batteries was proposed as an effective utilization measure. A proposal was also made on an autonomous discrete type system control scheme as a control system that has sufficient expandability, and is durable against disasters. (NEDO)
Mutation Glu82Lys in lamin A/C gene is associated with cardiomyopathy and conduction defect
International Nuclear Information System (INIS)
Wang Hu; Wang Jizheng; Zheng Weiyue; Wang Xiaojian; Wang Shuxia; Song Lei; Zou Yubao; Yao Yan; Hui Rutai
2006-01-01
Dilated cardiomyopathy is a form of heart muscle disease characterized by impaired systolic function and ventricular dilation. The mutations in lamin A/C gene have been linked to dilated cardiomyopathy. We screened genetic mutations in a large Chinese family of 50 members including members with dilated cardiomyopathy and found a Glu82Lys substitution mutation in the rod domain of the lamin A/C protein in eight family members, three of them have been diagnosed as dilated cardiomyopathy, one presented with heart dilation. The pathogenic mechanism of lamin A/C gene defect is poorly understood. Glu82Lys mutated lamin A/C and wild type protein was transfected into HEK293 cells. The mutated protein was not properly localized at the inner nuclear membrane and the emerin protein, which interacts with lamin A/C, was also aberrantly distributed. The nuclear membrane structure was disrupted and heterochromatin was aggregated aberrantly in the nucleus of the HEK293 cells stably transfected with mutated lamin A/C gene as determined by transmission electron microscopy
The automotive transmission book
Fischer, Robert; Jürgens, Gunter; Najork, Rolf; Pollak, Burkhard
2015-01-01
This book presents essential information on systems and interactions in automotive transmission technology and outlines the methodologies used to analyze and develop transmission concepts and designs. Functions of and interactions between components and subassemblies of transmissions are introduced, providing a basis for designing transmission systems and for determining their potentials and properties in vehicle-specific applications: passenger cars, trucks, buses, tractors, and motorcycles. With these fundamentals the presentation provides universal resources for both state-of-the-art and future transmission technologies, including systems for electric and hybrid electric vehicles.
Considering FACTS in Optimal Transmission Expansion Planning
Directory of Open Access Journals (Sweden)
K. Soleimani
2017-10-01
Full Text Available The expansion of power transmission systems is an important part of the expansion of power systems that requires enormous investment costs. Since the construction of new transmission lines is very expensive, it is necessary to choose the most efficient expansion plan that ensures system security with a minimal number of new lines. In this paper, the role of Flexible AC Transmission System (FACTS devices in the effective operation and expansion planning of transmission systems is examined. Effort was taken to implement a method based on sensitivity analysis to select the optimal number and location of FACTS devices, lines and other elements of the transmission system. Using this method, the transmission expansion plan for a 9 and a 39 bus power system was performed with and without the presence of FACTS with the use of DPL environment in Digsilent software 15.1. Results show that the use of these devices reduces the need for new transmission lines and minimizes the investment cost.
Linearization Technologies for Broadband Radio-Over-Fiber Transmission Systems
Directory of Open Access Journals (Sweden)
Xiupu Zhang
2014-11-01
Full Text Available Linearization technologies that can be used for linearizing RoF transmission are reviewed. Three main linearization methods, i.e. electrical analog linearization, optical linearization, and electrical digital linearization are presented and compared. Analog linearization can be achieved using analog predistortion circuits, and can be used for suppression of odd order nonlinear distortion components, such as third and fifth order. Optical linearization includes mixed-polarization, dual-wavelength, optical channelization and the others, implemented in optical domain, to suppress both even and odd order nonlinear distortion components, such as second and third order. Digital predistortion has been a widely used linearization method for RF power amplifiers. However, digital linearization that requires analog to digital converter is severely limited to hundreds of MHz bandwidth. Instead, analog and optical linearization provide broadband linearization with up to tens of GHz. Therefore, for broadband radio over fiber transmission that can be used for future broadband cloud radio access networks, analog and optical linearization are more appropriate than digital linearization. Generally speaking, both analog and optical linearization are able to improve spur-free dynamic range greater than 10 dB over tens of GHz. In order for current digital linearization to be used for broadband radio over fiber transmission, the reduced linearization complexity and increased linearization bandwidth are required. Moreover, some digital linearization methods in which the complexity can be reduced, such as Hammerstein type, may be more promising and require further investigation.
Load Flow Analysis of Hybrid AC-DC Power System with Offshore Wind Power
DEFF Research Database (Denmark)
Dhua, Debasish; Huang, Shaojun; Wu, Qiuwei
2017-01-01
The offshore wind power has received immense attention because of higher wind speed and lower opposition for construction. A wide range of combinations of high-voltage ACDC transmission have been proposed for integrating offshore wind farms and long-distance power transmission. This paper...... is to model such hybrid AC-DC systems including the interfacing converters, which have several control parameters that can change the load flow of the hybrid systems. Then, the paper proposes a Load Flow algorithm based on the Newton-Raphson method, which covers three different section types...
Wang, Yiguang; Huang, Xingxing; Shi, Jianyang; Wang, Yuan-quan; Chi, Nan
2016-05-01
Visible light communication (VLC) has no doubt become a promising candidate for future wireless communications due to the increasing trends in the usage of light-emitting diodes (LEDs). In addition to indoor high-speed wireless access and positioning applications, VLC usage in outdoor scenarios, such as vehicle networks and intelligent transportation systems, are also attracting significant interest. However, the complex outdoor environment and ambient noise are the key challenges for long-range high-speed VLC outdoor applications. To improve system performance and transmission distance, we propose to use receiver diversity technology in an outdoor VLC system. Maximal ratio combining-based receiver diversity technology is utilized in two receivers to achieve the maximal signal-to-noise ratio. A 400-Mb/s VLC transmission using a phosphor-based white LED and a 1-Gb/s wavelength division multiplexing VLC transmission using a red-green-blue LED are both successfully achieved over a 100-m outdoor distance with the bit error rate below the 7% forward error correction limit of 3.8×10-3. To the best of our knowledge, this is the highest data rate at 100-m outdoor VLC transmission ever achieved. The experimental results clearly prove the benefit and feasibility of receiver diversity technology for long-range high-speed outdoor VLC systems.
AC Application of HTS Conductors in Highly Dynamic Electric Motors
International Nuclear Information System (INIS)
Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K
2006-01-01
Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit
Investigation of multimodule buck–boost inverter-based HVDC transmission system
Directory of Open Access Journals (Sweden)
Ahmed A. Elserougi
2015-01-01
Full Text Available In high voltage direct current (HVDC systems, the semiconductor devices have to be connected in series to obtain the required high-voltage ratings. This study proposes a new HVDC configuration, namely, multimodule buck–boost inverter for HVDC transmission applications which avoids series connection of large number of semiconductor switches. In addition, it provides a blocking capability against DC side faults. The proposed configuration consists of several simple buck–boost converters which are assembled together to meet the requirements of high-voltage high-power applications. This paper studies the dynamic performance of the proposed system under different operating conditions, and the results were satisfactory. The main advantages of the proposed configuration are: (i pure sinusoidal output which minimises/eliminates the requirements for supplementary AC filters and offers an inherent suppression to the common mode voltages, (ii very low dv/dt stresses and (iii complete blocking capability of AC side contributions during DC side faults. This study discusses the system architecture, passive components selections, voltage and current ratings of its semiconductor devices and the required controllers. A comparison between the proposed configuration and other existing HVDC technologies is also presented in this study.
Electrodeposition of Au/Ag bimetallic dendrites assisted by Faradaic AC-electroosmosis flow
Energy Technology Data Exchange (ETDEWEB)
Ji, Jianlong; Li, Pengwei; Sang, Shengbo, E-mail: sbsang@tyut.edu.cn; Zhang, Wendong, E-mail: wdzhang@tyut.edu.cn; Li, Gang; Hu, Jie [Micro and Nano-system Research Centre, College of Information Engineering, Taiyuan University of Technology, 030024, Taiyuan (China); Zhou, Zhaoying, E-mail: zhouzy@mail.tsinghua.edu.cn; Yang, Xing; Dong, Hualai [MEMS Laboratory, Department of Precision Instruments, Tsinghua University, 100084, Beijing (China)
2014-03-15
Au/Ag bimetallic dendrites were synthesized successfully from the corresponding aqueous solution via the AC electrodeposition method. Both of the morphologies and compositions could be tuned by the electrolyte concentration and AC frequency. The prepared bimetallic dendrites were characterized by scanning electron microscopy (SEM), energy dispersive X-ray spectrometer (EDS), transmission electron microscopy (TEM) and UV–vis spectroscopy. The underlying dendrite growth mechanism was then proposed in the context of the Directed Electrochemical Nanowires Assembly (DENA) models. Owing to the unscreened voltage dropping in the electrolyte bulk, electromigration dominates the species flux process, and cations tend to accumulate in areas with strong electric field intensity, such as electrode edges. Moreover, Faradaic AC-electro-osmosis (ACEO) flow could increase the effective diffusion layer thickness in these areas during the electrochemical reaction, and leads to dendrite growth. Further Micro-Raman observations illustrated that the Au/Ag bimetallic dendrites exhibited pronounced surface-enhanced Raman scattering (SERS) activity, using 4-mercaptopyridine (4-MP) as model molecules.
Electrodeposition of Au/Ag bimetallic dendrites assisted by Faradaic AC-electroosmosis flow
Directory of Open Access Journals (Sweden)
Jianlong Ji
2014-03-01
Full Text Available Au/Ag bimetallic dendrites were synthesized successfully from the corresponding aqueous solution via the AC electrodeposition method. Both of the morphologies and compositions could be tuned by the electrolyte concentration and AC frequency. The prepared bimetallic dendrites were characterized by scanning electron microscopy (SEM, energy dispersive X-ray spectrometer (EDS, transmission electron microscopy (TEM and UV–vis spectroscopy. The underlying dendrite growth mechanism was then proposed in the context of the Directed Electrochemical Nanowires Assembly (DENA models. Owing to the unscreened voltage dropping in the electrolyte bulk, electromigration dominates the species flux process, and cations tend to accumulate in areas with strong electric field intensity, such as electrode edges. Moreover, Faradaic AC-electro-osmosis (ACEO flow could increase the effective diffusion layer thickness in these areas during the electrochemical reaction, and leads to dendrite growth. Further Micro-Raman observations illustrated that the Au/Ag bimetallic dendrites exhibited pronounced surface-enhanced Raman scattering (SERS activity, using 4-mercaptopyridine (4-MP as model molecules.
Kingsnorth-London dc transmission link
Energy Technology Data Exchange (ETDEWEB)
1966-03-11
The hvdc transmission link between one of the 500 MW generators at Kingsnorth Power Station and two receiving stations in London will use a three-wire dc cable system rated to carry 1200 A at +- 266 kV. This 51-mile system will be the first dc link in the world to be used as an integral part of a complex interconnected ac network.
Technical and economic considerations of extra high voltage power transmission
Energy Technology Data Exchange (ETDEWEB)
Kahnt, R
1966-09-01
The reasons for the employment of higher transmission voltages are listed and the points decisive for the selection of three phase ac or dc systems are reviewed. The technical and economic problems arising in three phase extra high voltage transmission are discussed. These include selection of voltage, economical design of power lines, insulation problems, power supply dependability, equipment rating and reactive power and stability problems.
Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing
Energy Technology Data Exchange (ETDEWEB)
Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory
2009-10-01
The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.
Directory of Open Access Journals (Sweden)
Rui Li
2016-12-01
Full Text Available The AC voltage control of a DC/DC converter based on the modular multilevel converter (MMC is considered under normal operation and during a local DC fault. By actively setting the AC voltage according to the two DC voltages of the DC/DC converter, the modulation index can be near unity, and the DC voltage is effectively utilized to output higher AC voltage. This significantly decreases submodule (SM capacitance and conduction losses of the DC/DC converter, yielding reduced capital cost, volume, and higher efficiency. Additionally, the AC voltage is limited in the controllable range of both the MMCs in the DC/DC converter; thus, over-modulation and uncontrolled currents are actively avoided. The AC voltage control of the DC/DC converter during local DC faults, i.e., standby operation, is also proposed, where only the MMC connected on the faulty cable is blocked, while the other MMC remains operational with zero AC voltage output. Thus, the capacitor voltages can be regulated at the rated value and the decrease of the SM capacitor voltages after the blocking of the DC/DC converter is avoided. Moreover, the fault can still be isolated as quickly as the conventional approach, where both MMCs are blocked and the DC/DC converter is not exposed to the risk of overcurrent. The proposed AC voltage control strategy is assessed in a three-terminal high-voltage direct current (HVDC system incorporating a DC/DC converter, and the simulation results confirm its feasibility.
800 kW transmission line research at Leatherhead
Energy Technology Data Exchange (ETDEWEB)
1964-05-29
The experimental transmission line was installed at Leatherhead to enable the Central Electricity Research Laboratories to study the insulators, fittings, and conductors likely to be needed for ac power transmission at voltages up to the equivalent of 800 kV three-phase. Continuous recording will be made of corona power loss and radio and television interference. For this purpose C.E.R.L. has developed a statistical radio-interference recorder. The instrumentation also includes an automatic corona-loss bridge and data logger.
Power Transmission from Large Offshore Wind Farms
DEFF Research Database (Denmark)
Pedersen, Jørgen Kaas
1999-01-01
The major part of the coming wind farms in Denmark will be placed offshore. If the location is near a grid with a high short circuit level the power can be transmitted as AC.If the wind farm is far away from the grid and the grid perhaps has a low short circuit level, the best solution...... for transmitting the power can be by DC. At the moment it is possible to build self-commutating DC/AC-inverters up to about 150 kV. This paper will show a concept to a solution for a wind farm and a transmission system based on synchronous generators or a powerformer® with a rated voltage of 50 kV. The AC power...... will be rectified and boosted to a fixed DC voltage (e.g. 100 kV). The speed of the generator will be variable, depending of the wind but also controlled with the duty-cycle of the booster. In that way all wind turbines can be connected to the same DC bus and the cable to the inverter station connected to the AC...
Control of grid interactive AC microgrids
DEFF Research Database (Denmark)
Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe
2010-01-01
Over the last decade, distributed energy resources (DER) technology has undergone a fast development. Increased penetration of DER units and wide spread use of renewable energy sources challenge the entire architecture of traditional power system. Microgrid, characterizing higher flexibility......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....
Acquisition of Cry1Ac protein by non-target arthropods in Bt soybean fields.
Directory of Open Access Journals (Sweden)
Huilin Yu
Full Text Available Soybean tissue and arthropods were collected in Bt soybean fields in China at different times during the growing season to investigate the exposure of arthropods to the plant-produced Cry1Ac toxin and the transmission of the toxin within the food web. Samples from 52 arthropod species/taxa belonging to 42 families in 10 orders were analysed for their Cry1Ac content using enzyme-linked immunosorbent assay (ELISA. Among the 22 species/taxa for which three samples were analysed, toxin concentration was highest in the grasshopper Atractomorpha sinensis and represented about 50% of the concentration in soybean leaves. Other species/taxa did not contain detectable toxin or contained a concentration that was between 1 and 10% of that detected in leaves. These Cry1Ac-positive arthropods included a number of mesophyll-feeding Hemiptera, a cicadellid, a curculionid beetle and, among the predators, a thomisid spider and an unidentified predatory bug belonging to the Anthocoridae. Within an arthropod species/taxon, the Cry1Ac content sometimes varied between life stages (nymphs/larvae vs. adults and sampling dates (before, during, and after flowering. Our study is the first to provide information on Cry1Ac-expression levels in soybean plants and Cry1Ac concentrations in non-target arthropods in Chinese soybean fields. The data will be useful for assessing the risk of non-target arthropod exposure to Cry1Ac in soybean.
Acquisition of Cry1Ac Protein by Non-Target Arthropods in Bt Soybean Fields
Yu, Huilin; Romeis, Jörg; Li, Yunhe; Li, Xiangju; Wu, Kongming
2014-01-01
Soybean tissue and arthropods were collected in Bt soybean fields in China at different times during the growing season to investigate the exposure of arthropods to the plant-produced Cry1Ac toxin and the transmission of the toxin within the food web. Samples from 52 arthropod species/taxa belonging to 42 families in 10 orders were analysed for their Cry1Ac content using enzyme-linked immunosorbent assay (ELISA). Among the 22 species/taxa for which three samples were analysed, toxin concentration was highest in the grasshopper Atractomorpha sinensis and represented about 50% of the concentration in soybean leaves. Other species/taxa did not contain detectable toxin or contained a concentration that was between 1 and 10% of that detected in leaves. These Cry1Ac-positive arthropods included a number of mesophyll-feeding Hemiptera, a cicadellid, a curculionid beetle and, among the predators, a thomisid spider and an unidentified predatory bug belonging to the Anthocoridae. Within an arthropod species/taxon, the Cry1Ac content sometimes varied between life stages (nymphs/larvae vs. adults) and sampling dates (before, during, and after flowering). Our study is the first to provide information on Cry1Ac-expression levels in soybean plants and Cry1Ac concentrations in non-target arthropods in Chinese soybean fields. The data will be useful for assessing the risk of non-target arthropod exposure to Cry1Ac in soybean. PMID:25110881
Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2016-06-01
Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.
Low AC-Loss Superconducting Cable Technology for Electric Aircraft Propulsion, Phase I
National Aeronautics and Space Administration — The availability of low AC loss magnesium diboride (MgB2) superconducting wires enables much lighter weight superconducting stator coils than with any other metal or...
Low field critical currents and ac losses of thin film niobium--tin superconductors
International Nuclear Information System (INIS)
Howard, R.E.
1977-01-01
The results of a study of the low field critical current and ac loss properties of niobium-tin thin films and layered composites fabricated by electron-beam coevaporation are presented. Particular emphasis is placed upon determining the suitability of this material for use as a conductor in a superconducting power transmission line. Chapter I contains a summary of this work and its major results together with an introduction to the scientific and engineering concepts associated with a superconducting power transmission line. Chapter II is a discussion of the physics of current transport and the associated loss mechanisms in a type-II superconductor. Chapter III gives the details of the electron-beam coevaporation technique developed to fabricate the samples for this study. Also discussed in this chapter are the effects of the evaporation conditions on the growth morphology of the niobium-tin films. Chapter IV presents the details of the experimental techniques developed to measure the ac loss and critical current in these samples as a function of temperature. Chapter V shows the dependence of the critical current of these films and composites on temperature, magnetic field, and on the number of artificially introduced pinning centers in the layered composites. Experimental results are also presented concerning the stability of these conductors against flux jumps. Chapter VI is a discussion of the ac losses in these samples. Detailed comparisons are made between the measured loss and the predictions of the critical state model
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Technical and economic considerations of extra high voltage power transmission
Energy Technology Data Exchange (ETDEWEB)
Kahnt, R
1966-09-01
The reasons for the employment of higher transmission voltages are listed and the points decisive for the selection of three phase ac or dc systems are reviewed. This is followed by treatment of the technical and economic problems arising in three phase-extra high voltage transmission. These include selection of voltage, economical design of power lines, insulation problems, power supply dependability, equipment rating, and reactive power and stability problems.
A CMOS AC/DC charge pump for a wireless sensor network
International Nuclear Information System (INIS)
Zhang Qiang; Ni Weining; Shi Yin; Yu Yude
2012-01-01
An AC/DC charge pump implemented with MOS FETs has been presented for wireless sensor network applications. The proposed AC/DC charge pump can generate a stable output with low power dissipation and high pumping efficiency, which has been implemented in 0.13 μm CMOS technology. The proposed charge pump employs MOSFET diodes with low thresholds, and improves the conversion efficiency. The analytical model of the voltage multiplier, the simulation results, and the chip testing results are presented.
System and Battery Charge Control for PV-Powered AC Lighting Systems
Energy Technology Data Exchange (ETDEWEB)
Kern, G.
1999-04-01
This report reviews a number of issues specific to stand-alone AC lighting systems. A review of AC lighting technology is presented, which discusses the advantages and disadvantages of various lamps. The best lamps for small lighting systems are compact fluorescent. The best lamps for intermediate-size systems are high- or low-pressure sodium. Specifications for battery charging and load control are provided with the goal of achieving lamp lifetimes on the order of 16,000 to 24,000 hours and battery lifetimes of 4 to 5 years. A rough estimate of the potential domestic and global markets for stand-alone AC lighting systems is presented. DC current injection tests were performed on high-pressure sodium lamps and the test results are presented. Finally, a prototype system was designed and a prototype system controller (with battery charger and DC/AC inverter) was developed and built.
AC characterization of bulk organic solar cell in the dark and under illumination
International Nuclear Information System (INIS)
Váry, Michal; Perný, Milan; Šály, Vladimír; Packa, Juraj
2014-01-01
Highlights: • A study of organic bulk photovoltaic (PV) solar cell. • Current–voltage characteristics in the dark and under illumination. • AC measurements, both under illumination and in the dark conditions. • Equivalent AC circuit. • Effective lifetime assigned with electron–hole recombination and diffusion time of the electron was estimated. - Abstract: Impedance spectroscopy has been used widely to evaluate the transport processes in photovoltaic, mainly based on inorganic semiconductors, structures – solar cells. The aim of this research was to characterize improved organic bulk photovoltaic (PV) solar cells exploiting this method. Progress in technology of investigated organic solar cell involves the use of an active layer based on low band gap type of polymer. The organic PV cell with front transparent electrode and rear metal electrode and active layer produced by Konarka Technologies was analyzed by electrical DC and AC measurements. Current–voltage (I–V) characteristics in the dark and under illumination were measured and basic PV parameters were calculated. AC measurements, both under illumination and in the dark conditions, were processed in order to identify electronic behavior using equivalent AC circuit which was suggested by fitting of measured impedance data. Circuit with the best correlation to measured data is analyzed in details. Voltage and frequency dependences of fitted equivalent circuit components and calculated parameters are explained and presented in the paper
Study of Power Flow Algorithm of AC/DC Distribution System including VSC-MTDC
Directory of Open Access Journals (Sweden)
Haifeng Liang
2015-08-01
Full Text Available In recent years, distributed generation and a large number of sensitive AC and DC loads have been connected to distribution networks, which introduce a series of challenges to distribution network operators (DNOs. In addition, the advantages of DC distribution networks, such as the energy conservation and emission reduction, mean that the voltage source converter based multi-terminal direct current (VSC-MTDC for AC/DC distribution systems demonstrates a great potential, hence drawing growing research interest. In this paper, considering losses of the reactor, the filter and the converter, a mathematical model of VSC-HVDC for the load flow analysis is derived. An AC/DC distribution network architecture has been built, based on which the differences in modified equations of the VSC-MTDC-based network under different control modes are analyzed. In addition, corresponding interface functions under five control modes are provided, and a back/forward iterative algorithm which is applied to power flow calculation of the AC/DC distribution system including VSC-MTDC is proposed. Finally, by calculating the power flow of the modified IEEE14 AC/DC distribution network, the efficiency and validity of the model and algorithm are evaluated. With various distributed generations connected to the network at appropriate locations, power flow results show that network losses and utilization of transmission networks are effectively reduced.
Implementation and Evaluation of WLAN 802.11ac for Residential Networks in NS-3
Directory of Open Access Journals (Sweden)
Andy Bubune Amewuda
2018-01-01
Full Text Available Wi-Fi has been an amazingly successful technology. Its success may be attributed to the fact that, despite the significant advances made in technology over the last decade, it has remained backward compatible. 802.11ac is the latest version of the wireless LAN (WLAN standard that is currently being adopted, and it promises to deliver very high throughput (VHT, operating at the 5 GHz band. In this paper, we report on an implementation of 802.11ac wireless LAN for residential scenario based on the 802.11ax task group scenario document. We evaluate the 802.11ac protocol performance under different operating conditions. Key features such as modulation coding set (MCS, frame aggregation, and multiple-input multiple-output (MIMO were investigated. We also evaluate the average throughput, delay, jitter, optimum range for goodput, and effect of station (STA density per access point (AP in a network. ns-3, an open source network simulator with features supporting 802.11ac, was used to perform the simulation. Results obtained indicate that very high data rates are achievable. The highest data rate, the best mean delay, and mean jitter are possible under combined features of 802.11ac (MIMO and A-MPDU.
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
Henley, M. W.; Fikes, J. C.; Howell, J.; Mankins, J. C.; Howell, Joe T. (Technical Monitor)
2002-01-01
Space Solar Power technology offers unique benefits for near-term NASA space science missions, which can mature this technology for other future applications. "Laser-Photo-Voltaic Wireless Power Transmission" (Laser-PV WPT) is a technology that uses a laser to beam power to a photovoltaic receiver, which converts the laser's light into electricity. Future Laser-PV WPT systems may beam power from Earth to satellites or large Space Solar Power satellites may beam power to Earth, perhaps supplementing terrestrial solar photo-voltaic receivers. In a near-term scientific mission to the moon, Laser-PV WPT can enable robotic operations in permanently shadowed lunar polar craters, which may contain ice. Ground-based technology demonstrations are proceeding, to mature the technology for this initial application, in the moon's polar regions.
FCA Group LLC request to the EPA regarding greenhouse gas, off-cycle CO2 credits for Active Engine Warm Up used in 2011-2013 model year vehicles and Active Transmission Warm Up Technologies used in 2013 model year vehicles.
This White Paper was developed to serve as the basis for discussion at a Technology Forum on Condition Assessment of Water Transmission and Distribution Systems that was held on September 9 and 10, 2008, at Edison, NJ. It was distributed to the Forum participants for review in a...
Enhancing the reliability of AC transmission networks by using a long distance HVDC-link
Energy Technology Data Exchange (ETDEWEB)
Fleckenstein, Marco; Balzer, Gerd; Wasserrab, Andreas; Neumann, Claus [Technische Univ. Darmstadt (Germany). Inst. of Electrical Power and Energy
2012-07-01
The absorption of energy from offshore wind farms is a difficult task for Transmission system operators (TSO) in Germany, even if no offshore wind farm is connected directly. The role of the TSOs in the north it is to transport this energy to the south of Germany. The transmission capacities of overhead lines are limited. With the expected rapid expansion of wind farms, this is no longer enough. Thus, the transmission system must be enhanced. One possibility is the installation of an HVDC link from north to south between two main substations in the 380 kV network. Based on a realistic case study, the impact of such a link on the reliability of the entire extra high voltage network is shown. (orig.)
Improved SCR ac Motor Controller for Battery Powered Urban Electric Vehicles
Latos, T. S.
1982-01-01
An improved ac motor controller, which when coupled to a standard ac induction motor and a dc propulsion battery would provide a complete electric vehicle power train with the exception of the mechanical transmission and drive wheels was designed. In such a system, the motor controller converts the dc electrical power available at the battery terminals to ac electrical power for the induction motor in response to the drivers commands. The performance requirements of a hypothetical electric vehicle with an upper weight bound of 1590 kg (3500 lb) were used to determine the power rating of the controller. Vehicle acceleration capability, top speed, and gradeability requisites were contained in the Society of Automotive Engineers (SAE) Schedule 227a(d) driving cycle. The important capabilities contained in this driving cycle are a vehicle acceleration requirement of 0 to 72.4 kmph (0 to 45 mph) in 28 seconds a top speed of 88.5 kmph (55 mph), and the ability to negotiate a 10% grade at 48 kmph (30 mph). A 10% grade is defined as one foot of vertical rise per 10 feet of horizontal distance.
Energy Technology Data Exchange (ETDEWEB)
Anon.
2010-12-15
Meanwhile, the EC motor technology is the state of the art in fans. In the consciousness of a possible energy conservation, the EC motor technology is demanded to a large extent with the new installations of the customers. But how high are the possible savings actually? A comparative measurement at a condenser of Guentner AG (Fuerstenfeldbruck, Federal Republic of Germany) supports information.
International Nuclear Information System (INIS)
Mueller Steffen; Wibbing Sascha; Weigel Robert; Koelpin Alexander; Dennerlein, Juergen; Janke, Iryna; Weber, Johannes
2015-01-01
Signal acquisition and data transmission for innovative sensor systems and networks inside the containment of nuclear power plants (NPPs) is still a challenge with respect to safety, performance, reliability, availability, and costs. This especially applies to equipment upgrades for existing plants, special measurements, but also for new builds. This paper presents a novel method for efficient and cost-effective sensor signal acquisition and data transmission via power lines, in order to cope with the disadvantages of common system architectures that often suffer from poor signal integrity due to raw data transmissions via long cables, huge efforts and costs for installation, and low flexibility with respect to maintenance and upgrades. A transmitter-receiver architecture is proposed that allows multiplexing of multiple sensor inputs for unidirectional point-to-point transmission by superimposing information signals on existing AC or DC supply lines, but also on active and inactive sensor wires, or spare cables, using power line communication (PLC) technology. Based on commercial off-the-shelf (COTS) electronic parts, a radiation hard transmitter hardware is designed to operate in harsh environment within the containment during full plant operation. The system's modular approach allows application specific trade-offs between redundancy and throughput regarding data transmission, as well as various sensor input front-ends which are compatible with state of the art systems. PLC technology eliminates the need for costly installation of additional cables and wall penetrations, while providing a complementary and diverse communication technology for upgrades of existing systems. At the receiver side in low dose areas, signals are extracted from the power line, demodulated, and de-multiplexed, in order to regain the original sensor signal information and provide it either in analog or digital output format. Successful laboratory qualification tests, field trails
Energy Technology Data Exchange (ETDEWEB)
Mueller Steffen; Wibbing Sascha; Weigel Robert; Koelpin Alexander [Institute for Electronics Engineering, University of Erlangen-Nuremberg (Germany); Dennerlein, Juergen; Janke, Iryna; Weber, Johannes [AREVA GmbH, Paul-Gossen-Str. 100, 91052 Erlangen (Germany)
2015-07-01
Signal acquisition and data transmission for innovative sensor systems and networks inside the containment of nuclear power plants (NPPs) is still a challenge with respect to safety, performance, reliability, availability, and costs. This especially applies to equipment upgrades for existing plants, special measurements, but also for new builds. This paper presents a novel method for efficient and cost-effective sensor signal acquisition and data transmission via power lines, in order to cope with the disadvantages of common system architectures that often suffer from poor signal integrity due to raw data transmissions via long cables, huge efforts and costs for installation, and low flexibility with respect to maintenance and upgrades. A transmitter-receiver architecture is proposed that allows multiplexing of multiple sensor inputs for unidirectional point-to-point transmission by superimposing information signals on existing AC or DC supply lines, but also on active and inactive sensor wires, or spare cables, using power line communication (PLC) technology. Based on commercial off-the-shelf (COTS) electronic parts, a radiation hard transmitter hardware is designed to operate in harsh environment within the containment during full plant operation. The system's modular approach allows application specific trade-offs between redundancy and throughput regarding data transmission, as well as various sensor input front-ends which are compatible with state of the art systems. PLC technology eliminates the need for costly installation of additional cables and wall penetrations, while providing a complementary and diverse communication technology for upgrades of existing systems. At the receiver side in low dose areas, signals are extracted from the power line, demodulated, and de-multiplexed, in order to regain the original sensor signal information and provide it either in analog or digital output format. Successful laboratory qualification tests, field trails
Impact of Cyber Attacks on High Voltage DC Transmission Damping Control
Directory of Open Access Journals (Sweden)
Rui Fan
2018-04-01
Full Text Available Hybrid AC/HVDC (AC-HVDC grids have evolved to become huge cyber-physical systems that are vulnerable to cyber attacks because of the wide attack surface and increasing dependence on intelligent electronic devices, computing resources and communication networks. This paper, for the first time, studies the impact of cyber attacks on HVDC transmission oscillation damping control.Three kinds of cyber attack models are considered: timing attack, replay attack and false data injection attack. Followed by a brief introduction of the HVDC model and conventional oscillation damping control method, the design of three attack models is described in the paper. These attacks are tested on a modified IEEE New England 39-Bus AC-HVDC system. Simulation results have shown that all three kinds of attacks are capable of driving the AC-HVDC system into large oscillations or even unstable conditions.
Bearingless AC Homopolar Machine Design and Control for Distributed Flywheel Energy Storage
Severson, Eric Loren
The increasing ownership of electric vehicles, in-home solar and wind generation, and wider penetration of renewable energies onto the power grid has created a need for grid-based energy storage to provide energy-neutral services. These services include frequency regulation, which requires short response-times, high power ramping capabilities, and several charge cycles over the course of one day; and diurnal load-/generation-following services to offset the inherent mismatch between renewable generation and the power grid's load profile, which requires low self-discharge so that a reasonable efficiency is obtained over a 24 hour storage interval. To realize the maximum benefits of energy storage, the technology should be modular and have minimum geographic constraints, so that it is easily scalable according to local demands. Furthermore, the technology must be economically viable to participate in the energy markets. There is currently no storage technology that is able to simultaneously meet all of these needs. This dissertation focuses on developing a new energy storage device based on flywheel technology to meet these needs. It is shown that the bearingless ac homopolar machine can be used to overcome key obstacles in flywheel technology, namely: unacceptable self-discharge and overall system cost and complexity. Bearingless machines combine the functionality of a magnetic bearing and a motor/generator into a single electromechanical device. Design of these machines is particularly challenging due to cross-coupling effects and trade-offs between motor and magnetic bearing capabilities. The bearingless ac homopolar machine adds to these design challenges due to its 3D flux paths requiring computationally expensive 3D finite element analysis. At the time this dissertation was started, bearingless ac homopolar machines were a highly immature technology. This dissertation advances the state-of-the-art of these machines through research contributions in the areas of
Transmission Control of Transport and Technological Cars in Acceleration Mode
Directory of Open Access Journals (Sweden)
B. I. Plujnikov
2015-01-01
Full Text Available In most structures a transmission of the transport-technological machine (TTM is controlled by automatic systems. In their creating it is necessary to specify the appropriate parameters and algorithms. In the total balance of the machine run time the acceleration mode is the most important. Therefore, an algorithm of the transmission gear ratio change during acceleration largely provides desirable rating of machines.It is known that the process of acceleration is estimated by its dynamic quality and fuel economy. To reach the best rating of both simultaneously is impossible. Therefore, as the criteria of estimate, were chosen the time and fuel consumption during acceleration to a fixed speed value.From a mathematical point of view, these criteria represent the sum of integrals, each of which defines the time or the fuel consumption during acceleration with a certain transmission gear ratio. The problem is formulated as follows: to determine the speed values of the TTM at the moments when the transmission gear ratio is changed providing the minimum values during fixed fuel supply for the estimate criteria. The latter condition in a certain way limits the task, but in explicit form there is no this control action in the dependence data.Given the variety of possible design options for the TTM, the solution is given by a specific example that simplifies the mathematics and makes it easier to understand the results obtained. As a TTM, is considered a passenger car with petrol engine and automatic transmission, which includes a hydrodynamic transformer and three-speed gearbox.A chosen way of solving the problem involves using the theory of ordinary maxima and minima, which allows finding the unknown values of independent variables. The expressions of sub-integral functions are in explicit form obtained and studied for meeting the necessary and sufficient conditions for existence of the extreme point. The result was a proof that in the case of
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Investigation of Hybrid Pseudo Bipolar HVDC Performances Supply Power to Passive AC Network
Directory of Open Access Journals (Sweden)
Kuan Li
2014-07-01
Full Text Available The traditional HVDC plays an important role in the development of power grid. But the traditional HVDC cannot supply power either to entirely passive AC network or to weak AC system. In fact, an entirely passive AC network can be effectively powered through VSC-HVDC. However, the cost of investment in VSC-HVDC is amazingly high due to the limitation of power electronics technology. Based on CSC and VSC, this paper proposes a method to build Hybrid HVDC, which makes the power supply to the passive AC network come true and, at the same time, lowers the investment cost. The effect of topology, steady mathematical model, startup characteristic, steady and transient characteristics in Hybrid HVDC system are systematically studied in this paper. The simulation result shows that Hybrid HVDC can supply power to the passive AC network with high stability. This study provides a theoretical basis for the further development of HVDC.
Directory of Open Access Journals (Sweden)
Armando L. Figueroa-Acevedo
2015-02-01
Full Text Available The design of an interregional high-voltage transmission system in the US is a revolutionary technological concept that will likely play a significant role in the planning and operation of future electric power systems. Historically, the primary justification for building interregional high-voltage transmission lines in the US and around the world has been based on economic and reliability criteria. Today, the implementation renewable portfolio standards, carbon emission regulations, the improvements in the performance of power electronic systems, and unused benefits associated with capacity exchange during times of non-coincident peak demand, are driving the idea of designing an interregional high-voltage transmission system in the US. However, there exist challenges related to technical, economic, public policy, and environmental factors that hinder the implementation of such a complex infrastructure. The natural skepticism from many sectors of the society, in regards to how will the system be operated, how much will it cost, and the environmental impact that it could potentially create are among the most significant challenges to its rapid implementation. This publication aims at illustrating the technological, environmental, economic, and policy challenges that interregional HV transmission systems face today in the US, looking specifically at the Clean Line Rock Island project in Iowa.
She, Xu; Chokhawala, Rahul Shantilal; Bray, James William; Sommerer, Timothy John; Zhou, Rui; Zhang, Di
2017-08-29
A high-voltage direct-current (HVDC) transmission system includes an alternating current (AC) electrical source and a power converter channel that includes an AC-DC converter electrically coupled to the electrical source and a DC-AC inverter electrically coupled to the AC-DC converter. The AC-DC converter and the DC-AC inverter each include a plurality of legs that includes at least one switching device. The power converter channel further includes a commutating circuit communicatively coupled to one or more switching devices. The commutating circuit is configured to "switch on" one of the switching devices during a first portion of a cycle of the H-bridge switching circuits and "switch off" the switching device during a second portion of the cycle of the first and second H-bridge switching circuits.
Study on AC loss measurements of HTS power cable for standardizing
Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi
2017-09-01
High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..
Australian Educational Computing, 2012
2012-01-01
This article presents the ACCE/ACS National Educator and Leader of the Year winners. Anne Mirtschin is the recipient of the ACCE/ACS 2012 Educator of the Year Award. Mirtschin is an innovative teacher at Hawkesdale P-12 College a small rural school that is isolated culturally and geographically. She uses online tools and technology to create…
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
New trends in the development of high voltage technology
Energy Technology Data Exchange (ETDEWEB)
Aleksandrov, G N
1964-07-01
The question is raised as to what type of transmission should be developed to transfer power over long distances from the eastern to the western part of Russia, and what principles should be utilized to combine power transmission into single power system in the USSR. Aleksandrov indicates the need for higher voltage power transmission, and stresses that ac is more economical than dc. The author compares +-750 kV dc with 1000 kV ac. The economic comparison is conducted for the same level of insulation, and it is stated that it will result in the same amount of power transmitted. New insulation materials are mentioned, and wider use of fiberglass and other plastics is predicted.
Energy Technology Data Exchange (ETDEWEB)
Althouse, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McKannay, R. H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-08-15
This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and ISOFLEX USA (ISOFLEX), to 1) develop and test a prototype waste destruction system ("System") using AC plasma torch technology to break down and drastically reduce the volume of Carbon-14 (C-14) contaminated medical laboratory wastes while satisfying all environmental regulations, and 2) develop and demonstrate methods for recovering 99%+ of the carbon including the C-14 allowing for possible re-use as a tagging and labeling tool in the biomedical industry.
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
Magnesium Aminoclay-Fe3O4 (MgAC-Fe3O4 Hybrid Composites for Harvesting of Mixed Microalgae
Directory of Open Access Journals (Sweden)
Bohwa Kim
2018-05-01
Full Text Available In this paper, we describe the synthesis of magnesium aminoclay-iron oxide (MgAC-Fe3O4 hybrid composites for microalgae-harvesting application. MgAC-templated Fe3O4 nanoparticles (NPs were synthesized in different ratios of MgAC and Fe3O4 NPs. The uniform distribution of Fe3O4 NPs in the MgAC matrix was confirmed by transmission electron microscopy (TEM. According to obtained X-ray diffraction (XRD patterns, increased MgAC loading leads to decreased intensity of the composites’ (311 plane of Fe3O4 NPs. For harvesting of Chlorella sp. KR-1, Scenedesmus obliquus and mixed microalgae (Chlorella sp. KR-1/ Scenedesmus obliquus, the optimal pH was 4.0. At higher pHs, the microalgae-harvesting efficiencies fell. Sample #1, which had the highest MgAC concentration, showed the most stability: the harvesting efficiencies for Chlorella sp. KR-1, Scenedesmus obliquus, and mixed microalgae were reduced only to ~50% at pH = 10.0. The electrostatic interaction between MgAC and the Fe3O4 NPs in the hybrid samples by microalgae, as confirmed by zeta potential measurements, were attributed to the harvesting mechanisms. Moreover, the zeta potentials of the MgAC-Fe3O4 hybrid composites were reduced as pH was increased, thus diminishing the microalgae-harvesting efficiencies.
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Greenan , Nathalie; Messe , Pierre-Jean
2014-01-01
The main contribution of this paper is to study empirically how the horizon effect and the technological or organisational changes interact to explain the probability of being an internal trainer at the end of career. We use data from a French matched employer-employee survey on Organisational Changes and Computerisation (COI) conducted in 2006. It contains information both on employees’ knowledge transmission practices and employers’ technological or organisational changes. We find that the ...
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Directory of Open Access Journals (Sweden)
Bryan Hubbard
2013-09-01
Full Text Available Power transmission facilities in the U.S. are undergoing a transformation due to the increased use of distributed generation sources such as wind and solar power. The current power grid system is also antiquated and in need of substantial retrofits to make it more efficient and reliable. The new energy transmission system being designed and built to optimize power delivery is known as “Smart Grid”. The increased activity in the construction of power transmission facilities and installation of new technologies into the current power system raises potential safety concerns. Existing construction management curriculum may include general information about safety training, but does not typically include information about this specialized sector. The objective of this study was to work with industry to identify key safety topics appropriate for inclusion in an introductory industrial construction course. Results of interviews with industry identified numerous hazards that are not typically covered in typical construction curricula. A joint undergraduate and graduate course in industrial construction was created to address these and additional concepts. A survey of the students was performed to determine the effectiveness of the course and also to determine their thoughts about the smart grid technologies and safety training. Information on electrical system hazards is presented along with results of the student surveys.
International Nuclear Information System (INIS)
Henson, D.A.
1987-01-01
It is proposed that monocyte-derived foam cells in atherosclerotic lesions of White Carneau pigeons become lipid-filled through the uptake of lipoproteins including β-migrating very low density lipoproteins (β-VLDL) and acetylated low density lipoproteins (Ac-LDL). Using iodinated forms of the above lipoproteins, specific and saturable receptors for both β-VLDL and Ac-LDL were detected on the surface of White Carneau pigeon monocyte-derived macrophages in culture. Competition studies demonstrated the high degree of binding specificity for 125 I-Ac-LDL. Likewise, binding of 125 I-β-VLDL to its receptor was significantly inhibited by excess β-VLDL, however LDL from both hyper- and normocholesterolemic pigeons were also recognized by the receptor. Upon binding of β-VLDL and Ac-LDL to their respective receptors, the lipoproteins were rapidly internalized and delivered to intracellular sites of degradation. As measured by the amount of 14 C-oleate incorporated into cholesteryl 14 C-oleate, the cholesterole liberated from the degradation of both β-VLDL and Ac-LDL stimulated cholesteryl ester synthesis in the pigeon cells. Using lipoproteins conjugated to colloidal gold of visualization with transmission electron microscopy, a major difference in the binding and uptake properties of β-VLDL-Gold and Ac-LDL-Gold was documented
Energy Technology Data Exchange (ETDEWEB)
Garcia G, B M
1997-07-01
A study on hepatitis B tracers, (HBsAg and HBsAc), was conducted in women with different months of pregnancy at the Perinatal Maternal Institute in Lima, Peru. A total of 1010 mothers were studied during the period of January to October 1996, establishing by radioimmunoassay (RIA) whether they were positive or not. The results showed a prevalence rate of 1,6 for HBsAc and 1,3 for HBsAg for every 100,000 inhabitants. The incidence rate was 0,332 for HBsAc and 0,07 for HBsAg for every 100,000 inhabitants. This means that 21 expectant mothers are HBsAc positive and 5 are HBsAg positive. According to the investigations, there were different ways of transmission; promiscuity must be highlighted, as well as age -most of the mothers who were positive were between 20 and 25 years old- and origin. Most of them were immigrants from different places and live in shantytowns, which indicates that most of them have limited economic resources and have not received any orientation on family planning.
Technical and economic aspects of the transmission of energy at extra high voltages
Energy Technology Data Exchange (ETDEWEB)
Kahnt, R
1967-01-01
The reasons for the employment of higher transmission voltages are listed and the points decisive for the selection of three phase ac or dc systems are reviewed. A treatment of the technical and economic problems arising in three phase extra high voltage transmission is presented. These include selection of voltage, economical design of power lines, insulation problems, power supply dependability, equipment rating and reactive power and stability problems.
Frequency Dependent Losses in Transmission Cable Conductors
DEFF Research Database (Denmark)
Olsen, Rasmus Schmidt; Holbøll, Joachim; Guðmundsdóttir, Unnur Stella
2011-01-01
, such as thermal conditions in and around the cable, as well as the heat generated in conductors, screens, armours etc., taking into account proximity and skin effects. The work performed and presented in this paper is concerned with an improved determination of the losses generated in the conductor, by means...... of better calculation of the AC resistance of transmission cable conductors, in particular regarding higher frequencies. In this way, also losses under harmonics can be covered. Furthermore, the model is suitable for modelling of transient attenuation in high voltage cables. The AC resistance is calculated...... based on the current density distribution in different conductor designs by means of the Finite Element Method (FEM). The obtained results and methods are compared to available standards (IEC publication 60287-1-1)....
Transmission Line Security Monitor: Final Report
Energy Technology Data Exchange (ETDEWEB)
John Svoboda
2011-04-01
The Electric Power Transmission Line Security Monitor System Operational Test is a project funded by the Technical Support Working Group (TSWG). TSWG operates under the Combating Terrorism Technical Support Office that functions under the Department of Defense. The Transmission Line Security Monitor System is based on technology developed by Idaho National Laboratory. The technology provides a means for real-time monitoring of physical threats and/or damage to electrical transmission line towers and conductors as well as providing operational parameters to transmission line operators to optimize transmission line operation. The end use is for monitoring long stretches of transmission lines that deliver electrical power from remote generating stations to cities and industry. These transmission lines are generally located in remote transmission line corridors where security infrastructure may not exist. Security and operational sensors in the sensor platform on the conductors take power from the transmission line and relay security and operational information to operations personnel hundreds of miles away without relying on existing infrastructure. Initiated on May 25, 2007, this project resulted in pre-production units tested in realistic operational environments during 2010. A technology licensee, Lindsey Manufacturing of Azusa California, is assisting in design, testing, and ultimately production. The platform was originally designed for a security monitoring mission, but it has been enhanced to include important operational features desired by electrical utilities.
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Wind Energy Conversion Systems Technology and Trends
2012-01-01
Wind Energy Conversion System covers the technological progress of wind energy conversion systems, along with potential future trends. It includes recently developed wind energy conversion systems such as multi-converter operation of variable-speed wind generators, lightning protection schemes, voltage flicker mitigation and prediction schemes for advanced control of wind generators. Modeling and control strategies of variable speed wind generators are discussed, together with the frequency converter topologies suitable for grid integration. Wind Energy Conversion System also describes offshore farm technologies including multi-terminal topology and space-based wind observation schemes, as well as both AC and DC based wind farm topologies. The stability and reliability of wind farms are discussed, and grid integration issues are examined in the context of the most recent industry guidelines. Wind power smoothing, one of the big challenges for transmission system operators, is a particular focus. Fault ride th...
Energy Technology Data Exchange (ETDEWEB)
Frank Hoffmann, PhD; Aspinall, Rik
2012-12-10
Design, Development, and test of the three-port power converter for marine hydrokinetic power transmission. Converter provides ports for AC/DC conversion of hydrokinetic power, battery storage, and a low voltage to high voltage DC port for HVDC transmission to shore. The report covers the design, development, implementation, and testing of a prototype built by PPS.
First thin AC-coupled silicon strip sensors on 8-inch wafers
Energy Technology Data Exchange (ETDEWEB)
Bergauer, T., E-mail: thomas.bergauer@oeaw.ac.at [Institute of High Energy Physics of the Austrian Academy of Sciences, Nikolsdorfer Gasse 18, 1050 Wien (Vienna) (Austria); Dragicevic, M.; König, A. [Institute of High Energy Physics of the Austrian Academy of Sciences, Nikolsdorfer Gasse 18, 1050 Wien (Vienna) (Austria); Hacker, J.; Bartl, U. [Infineon Technologies Austria AG, Siemensstrasse 2, 9500 Villach (Austria)
2016-09-11
The Institute of High Energy Physics (HEPHY) in Vienna and the semiconductor manufacturer Infineon Technologies Austria AG developed a production process for planar AC-coupled silicon strip sensors manufactured on 200 μm thick 8-inch p-type wafers. In late 2015, the first wafers were delivered featuring the world's largest AC-coupled silicon strip sensors. Detailed electrical measurements were carried out at HEPHY, where single strip and global parameters were measured. Mechanical studies were conducted and the long-term behavior was investigated using a climate chamber. Furthermore, the electrical properties of various test structures were investigated to validate the quality of the manufacturing process.
International Nuclear Information System (INIS)
Fathabadi, Hassan
2014-01-01
Highlights: • Novel hybrid power source including AC feature for using in electric/hybrid vehicles. • Minimizing the energy loss in electric/hybrid vehicles by using the proposed system. • Suitable AC wave form for braking/accelerating purposes in electric/hybrid vehicles. • A novelty is that the harmonic generated by the added AC feature is really zero. • Another novelty is the capability of choosing arbitrary frequency for AC feature. - Abstract: This paper presents a novel hybrid power source, including a Li-ion battery together with an interface, which generates simultaneously electrical energy with the forms of both DC and AC for electric vehicles. A novel and high benefits approach is applied to convert the electrical energy of the Li-ion battery from DC form to single-phase symmetric pulse-width modulation (PWM)-AC form. Harmonic generation is one of the important problems when electrical energy is converted from DC to AC but there are not any generated harmonic during the DC/AC conversion using the proposed technique. The proposed system will be widely used in electric/hybrid vehicles because it has many benefits. Minimizing the energy loss (saving energy), no generated harmonic (it is really zero), the capability of arbitrary/necessary frequency selection for output AC voltage and the ability of long distance energy transmission are some novelties and advantages of the proposed system. The proposed hybrid power source including DC/AC PWM inverter is simulated in Proteus 6 software environment and a laboratory-based prototype of the hybrid power source is constructed to validate the theoretical and simulation results. Simulation and experimental results are presented to prove the superiority of the proposed hybrid power supply
Transmission of power at high voltages
Energy Technology Data Exchange (ETDEWEB)
Lane, F J
1963-01-01
High voltage transmission is considered to be concerned with circuits and systems operating at or above 132 kV. While the general examination is concerned with ac transmission, dc systems are also included. The choice of voltage for a system will usually involve hazardous assessments of the future requirements of industry, commerce and a changing population. Experience suggests that, if the estimated economic difference between two voltages is not significant, there is good reason to choose the higher voltage, as this will make the better provision for unexpected future expansion. Two principal functions served by transmission circuits in a supply system are: (a) the transportation of energy in bulk from the generator to the reception point in the distribution system; and (b) the interconnection and integration of the generating plant and associated loads. These functions are considered and various types of system are discussed in terms of practicability, viability, quality and continuity of supply. Future developments requiring transmission voltages up to 750 kV will raise many problems which are in the main empirical. Examples are given of the type of problem envisaged and it is suggested that these can only be partially solved by theory and model operation.
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Lowest of AC-DC power output for electrostrictive polymers energy harvesting systems
Meddad, Mounir; Eddiai, Adil; Hajjaji, Abdelowahed; Guyomar, Daniel; Belkhiat, Saad; Boughaleb, Yahia; Chérif, Aida
2013-11-01
Advances in technology led to the development of electronic circuits and sensors with extremely low electricity consumption. At the same time, structural health monitoring, technology and intelligent integrated systems created a need for wireless sensors in hard to reach places in aerospace vehicles and large civil engineering structures. Powering sensors with energy harvesters eliminates the need to replace batteries on a regular basis. Scientists have been forced to search for new power source that are able to harvested energy from their surrounding environment (sunlight, temperature gradients etc.). Electrostrictive polymer belonging to the family of electro-active polymers, offer unique properties for the electromechanical transducer technology has been of particular interest over the last few years in order to replace conventional techniques such as those based on piezoelectric or electromagnetic, these materials are highly attractive for their low-density, with large strain capability that can be as high as two orders of magnitude greater than the striction-limited, rigid and fragile electroactive ceramics. Electrostrictive polymers sensors respond to vibration with an ac output signal, one of the most important objectives of the electronic interface is to realize the required AC-DC conversion. The goal of this paper is to design an active, high efficiency power doubler converter for electrostrictive polymers exclusively uses a fraction of the harvested energy to supply its active devices. The simulation results show that it is possible to obtain a maximum efficiency of the AC-DC converter equal to 80%. Premiliminary experimental measurements were performed and the results obtained are in good agreement with simulations.
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
DEFF Research Database (Denmark)
Liu, Hongzhi; Chen, Zhe
2012-01-01
This paper describes fault ride-through and grid support of offshore wind farms based on permanent magnet synchronous generator (PMSG) wind turbines connected to the onshore AC network through two alternative transmission systems: high voltage AC (HVAC) or high voltage DC (HVDC) based on voltage...... source converters (VSC). The proposed configurations of the PMSG-based offshore wind farm and VSC-based HVDC are given as well as their control strategies under both steady state and fault state. The PMSG-based offshore wind farm is integrated into a test power transmission system via either HVAC or VSC...
Temperature dependence of ac response in diluted half-metallic CrO{sub 2} powder compact
Energy Technology Data Exchange (ETDEWEB)
Chen Yajie; Zhang Xiaoyu; Cai Tianyi; Li Zhenya
2004-10-06
We present a study on temperature dependence of impedance spectra of the cold-pressed chromium dioxide (CrO{sub 2})-titanic dioxide (TiO{sub 2}) composite over the temperature range of 77-300 K, and over the frequency range of 40 Hz-500 kHz. The microstructure of the sample is analyzed using transmission electron microscopy (TEM), SEM and X-ray diffraction (XRD). The impedance spectra exhibit a strong dependence upon temperature. By evaluating the ac electricity behavior of the composite, we find the experimental data are successfully described by a power-law behavior {sigma}{sub ac}=A(T){omega}{sup s}, in which the frequency exponent s shows slightly greater than a universal value (0{<=}s{<=}1), and rises approximately linearly with temperature over a broad range of low temperature.
Cost effective second generation AC-modules: Development and testing aspects
International Nuclear Information System (INIS)
Islam, Saiful; Woyte, Achim; Belmans, Ronnie; Heskes, Peter; Rooij, P.M.; Hogedoorn, Ron
2006-01-01
In the framework of the European research project PV2GO, a new AC-module inverter was developed, taking into account all relevant aspects from a European market's point of view (standards, market, application, and research and development goals). The project goal was to achieve the overall system costs of 3 Euro per Wp for a modular plug-and-play photovoltaic system. For the photovoltaic-module, a standard 130-Wp Eurosolare module was chosen. The research and development (R and D) goal was to develop an advanced DC-control system consisting of a state-of-the-art programmable digital device and an Application Specific Integrated Circuit (ASIC) for the AC-control of the inverter. According to the topology concept, thermal and magnetic designs were optimized with regard to production technology and packaging for large-scale production. The new AC-modules were tested in a number of field-test sites in various parts of Europe and their reliability was assessed through Highly Accelerated Stress Tests. Efficiency and power quality have been tested in the laboratory. Further in the PV2GO project an optimization study of the manufacturing process of the new generation of AC-modules for high volume output was done. Another task was the pre-certification procedure to assure compliance with the European guidelines and standards
Power transmission cable development for the Space Station Freedom electrical power system
Schmitz, Gregory V.; Biess, John J.
1989-01-01
Power transmission cable is presently being evaluated under a NASA Lewis Research Center advanced development contract for application in the Space Station Freedom (SSF) electrical power system (EPS). Evaluation testing has been performed by TRW and NASA Lewis Research Center. The results of this development contract are presented. The primary cable design goals are to provide (1) a low characteristic inductance to minimize line voltage drop at 20 kHz, (2) electromagnetic compatibility control of the 20-kHz ac power current, (3) a physical configuration that minimizes ac resistance and (4) release of trapped air for corona-free operation.
A dissociation mechanism for the [a+c] dislocation in GaN
International Nuclear Information System (INIS)
Nellist, P D; Hirsch, P B; Lozano, J G; Rhode, S; Zhang, S; Kappers, M J; Humphreys, C J; Horton, M K; Moram, M A; Yasuhara, A; Okunishi, E; Sahonta, S-L
2014-01-01
Mixed-type [a+c] dislocations can be identified in atomic-resolution high-angle annular dark-field scanning transmission electron microscope images of GaN viewed along [0001] by use of a Burgers loop analysis and by observation of the depth-dependent displacements associated with the Eshelby twist. These dislocations are found to be able to dissociate resulting in a fault that lies perpendicular to the dislocation glide plane. Consideration of the bonding that occurs in such a fault allows the dissociation reaction to be proposed, and the proposed fault agrees with the experimental images when kinks are incorporated into the model
Jaime A. López-López; Diego A. Tejada-Arango; Jesús M. López-Lezama
2016-01-01
This paper deals with the Transmission Network Expansion Planning (TNEP) problem. The TNEP consists of finding a set of new circuits on a power system, which is needed to attend a future demand. In its classical version, the TNEP only considers as solution candidates the addition of new lines and transformers. The main contribution of this paper consists in the inclusion of nonconventional solution candidates, namely the repowering of existing circuits and the location of capacitor banks. To ...
78 FR 50405 - Amended Application for Presidential Permit; Northern Pass Transmission LLC
2013-08-19
... Pass proposes to construct and operate a primarily overhead high-voltage direct current (HVDC) electric transmission line that would originate at an HVDC converter station to be constructed at the Des Cantons Substation in Qu[eacute]bec, Canada, then would be converted from HVDC to alternating current (AC) in...
International Nuclear Information System (INIS)
Garcia G, B.M.
1997-01-01
A study on hepatitis B tracers, (HBsAg and HBsAc), was conducted in women with different months of pregnancy at the Perinatal Maternal Institute in Lima, Peru. A total of 1010 mothers were studied during the period of January to October 1996, establishing by radioimmunoassay (RIA) whether they were positive or not. The results showed a prevalence rate of 1,6 for HBsAc and 1,3 for HBsAg for every 100,000 inhabitants. The incidence rate was 0,332 for HBsAc and 0,07 for HBsAg for every 100,000 inhabitants. This means that 21 expectant mothers are HBsAc positive and 5 are HBsAg positive. According to the investigations, there were different ways of transmission; promiscuity must be highlighted, as well as age -most of the mothers who were positive were between 20 and 25 years old- and origin. Most of them were immigrants from different places and live in shantytowns, which indicates that most of them have limited economic resources and have not received any orientation on family planning
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
California-Oregon 500-kV transmission line development of design criteria
International Nuclear Information System (INIS)
Simpson, K.D.
1990-01-01
The California-Oregon Transmission Project (COTP) encompassed the design and construction of a third 500-kV ac intertie between California and the Pacific Northwest Transmission system. Sargent ampersand Lundy's (S ampersand L) scope of work in the COTP includes the design of approximately 150 miles of new single-circuit, 500-kV transmission line from southern Oregon to the vicinity of Redding, California. This paper presents the development of the design criteria for this segment of the project, which crosses diverse topographic and climatic regions. This project is an example of the increasing utilization of computers in transmission line engineering. Almost all aspects of design involved the use of the computer. Also, the development of the design criteria for this project coincided with an early release of the TLWorkstation software package by EPRI. TLWorkstation is an engineering workstation containing a family of programs for various aspects of transmission line design. This engineering software allows for increasing refinement in the design and economic optimization of transmission lines and is becoming an important design tool for transmission engineers
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Face Gear Technology for Aerospace Power Transmission Progresses
2005-01-01
The use of face gears in an advanced rotorcraft transmission design was first proposed by the McDonnell Douglas Helicopter Company during their contracted effort with the U.S. Army under the Advanced Rotorcraft Transmission (ART) program. Face gears would be used to turn the corner between the horizontal gas turbine engine and the vertical output rotor shaft--a function currently done by spiral bevel gears. This novel gearing arrangement would substantially lower the drive system weight partly because a face gear mesh would be used to split the input power between two output gears. However, the use of face gears and their ability to operate successfully at the speeds and loads required for an aerospace environment was unknown. Therefore a proof-of-concept phase with an existing test stand at the NASA Lewis Research Center was pursued. Hardware was designed that could be tested in Lewis' Spiral Bevel Gear Test Rig. The initial testing indicated that the face gear mesh was a feasible design that could be used at high speeds and load. Surface pitting fatigue was the typical failure mode, and that could lead to tooth fracture. An interim project was conducted to see if slight modifications to the gear tooth geometry or an alternative heat treating process could overcome the surface fatigue problems. From the initial and interim tests, it was apparent that for the surface fatigue problems to be overcome the manufacturing process used for this component would have to be developed to the level used for spiral bevel gears. The current state of the art for face gear manufacturing required using less than optimal gear materials and manufacturing techniques because the surface of the tooth form does not receive final finishing after heat treatment as it does for spiral bevel gears. This resulted in less than desirable surface hardness and manufacturing tolerances. An Advanced Research and Projects Agency (ARPA) Technology Reinvestment Project has been funded to investigate
Al Attar, Talal; Alshehri, Abdullah; Almansouri, Abdullah Saud Mohammed; Al-Turki, Abdullah Turki
2017-01-01
Different structures of transmission lines were designed and fabricated in standard CMOS technology to estimate some critical parameters including the RMS value of the surface roughness and the loss tangent. The input impedances for frequencies up to 50 GHz were modeled and compared with measurements. The results demonstrated a strong correlation between the used model with the proposed coefficients and the measured results, attesting the robustness of the model and the reliability of the incorporated coefficients values.
Al Attar, Talal
2017-05-13
Different structures of transmission lines were designed and fabricated in standard CMOS technology to estimate some critical parameters including the RMS value of the surface roughness and the loss tangent. The input impedances for frequencies up to 50 GHz were modeled and compared with measurements. The results demonstrated a strong correlation between the used model with the proposed coefficients and the measured results, attesting the robustness of the model and the reliability of the incorporated coefficients values.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Thyristor-controlled reactor improves series capacitor applications
Energy Technology Data Exchange (ETDEWEB)
Renz, K.W.; Thumm, G.; Weiss, S. [Siemens AG, Erlangen (Germany)
1995-12-31
Environmental considerations make it more and more difficult to plan and erect new transmission lines. FACTS (Flexible AC Transmission Systems) technology can provide devices to improve the utility of AC transmission lines. The innovative combination of conventional fixed series capacitors and thyristor controlled reactors as a new FACTS device was introduced into a transmission system in 1992. This Advanced Series Compensation (ASC) system provides many advantages not available with conventional fixed series capacitor installations such as flexible direct and continuous control of the compensation level, direct and smooth power flow control and improved capacitor bank protection. This new technology offers enhanced system flexibility by control of transmission line overload conditions, reduction in fault currents, sub-synchronous resonance (SSR) mitigation and network power oscillation damping. The world-first three-phase installation at Kayenta Substation, USA, demonstrates that modern FACTS devices using SVC thyristor valve technology can be designed and operated successfully. 6 refs, 7 figs
CO2 capture from IGCC gas streams using the AC-ABC process
Energy Technology Data Exchange (ETDEWEB)
Nagar, Anoop [SRI International, Menlo Park, CA (United States); McLaughlin, Elisabeth [SRI International, Menlo Park, CA (United States); Hornbostel, Marc [SRI International, Menlo Park, CA (United States); Krishnan, Gopala [SRI International, Menlo Park, CA (United States); Jayaweera, Indira [SRI International, Menlo Park, CA (United States)
2017-02-16
The objective of this project was to develop a novel, low-cost CO2 capture process from pre-combustion gas streams. The bench-scale work was conducted at the SRI International. A 0.15-MWe integrated pilot plant was constructed and operated for over 700 hours at the National Carbon Capture Center, Wilsonville, AL. The AC-ABC (ammonium carbonate-ammonium bicarbonate) process for capture of CO2 and H2S from the pre-combustion gas stream offers many advantages over Selexol-based technology. The process relies on the simple chemistry of the NH3-CO2-H2O-H2S system and on the ability of the aqueous ammoniated solution to absorb CO2 at near ambient temperatures and to release it as a high-purity, high-pressure gas at a moderately elevated regeneration temperature. It is estimated the increase in cost of electricity (COE) with the AC-ABC process will be ~ 30%, and the cost of CO2 captured is projected to be less than $27/metric ton of CO2 while meeting 90% CO2 capture goal. The Bechtel Pressure Swing Claus (BPSC) is a complementary technology offered by Bechtel Hydrocarbon Technology Solutions, Inc. BPSC is a high-pressure, sub-dew-point Claus process that allows for nearly complete removal of H2S from a gas stream. It operates at gasifier pressures and moderate temperatures and does not affect CO2 content. When coupled with AC-ABC, the combined technologies allow a nearly pure CO2 stream to be captured at high pressure, something which Selexol and other solvent-based technologies cannot achieve.
The Research and Development of Access Control Technology%访问控制技术的研究和进展
Institute of Scientific and Technical Information of China (English)
訾小超; 张绍莲; 茅兵; 谢立
2001-01-01
Access Control(AC)is one of the important technologies of System Security and has been widely studied recently because the traditionary AC technologies can' t meet with the security commands of contemporary imformation system. As a result,the traditionary AC technologies have been developed and some new technologies have been put forward. This paper makes the necessary classification for the more-than-ten-year research results of the AC technology,together with the analysis and predication for the development trend of the AC technology in the future.
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
Tecnologia de áudio na etnomusicologia Audio Technology in Ethnomusicology
Directory of Open Access Journals (Sweden)
André Vieira Sonoda
2010-01-01
Full Text Available Estudo sobre a relação da etnomusicologia com a tecnologia de áudio adentrando nos principais desenvolvimentos tecnológicos e conceituais dessas duas áreas desde o final do século XIX. Objetiva resumir a história da primeira área, desde a musicologia sistemática até hoje com base na tecnologia que permeou seu percurso, chamando atenção para questões pouco contempladas. Foram subsídios metodológicos: a pesquisa bibliográfica e de campo, análises de documentos e comportamentos em estúdio de gravação e análises acústicas. Verificou-se a existência de marcos delineadores do processo histórico ocorrido. Sugere que qualquer fator relacionado com um processo de produção fonográfica pode influenciar o resultado acústico de uma manifestação musical gravada. Sugere também uma maior atenção em pesquisas frente à influência de elementos técnicos e conceituais de produção fonográfica em manifestações de transmissão oral.Study about the relation of the ethnomusicology with the audio technology covering the main technological and conceptual developments of these two areas since the late nineteenth century. It aims at covering the history of the former since the systematic musicology until the present centering on the technology that characterized the way, calling attention to less covered questions. The methodological procedures were: bibliographic and field research, document and behavior analysis in recording studio and acoustic analysis. It suggests the existence of some landmarks in the historical process and that any factor related with the phonographic production process may exert influence on the acoustic result of a recorded musical manifestation. It also calls attention to the need of more research on the influence of technical and conceptual elements of phonographic production on oral transmission manifestations.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
She, Xu; Chokhawala, Rahul Shantilal; Zhou, Rui; Zhang, Di; Sommerer, Timothy John; Bray, James William
2016-12-13
A voltage source converter based high-voltage direct-current (HVDC) transmission system includes a voltage source converter (VSC)-based power converter channel. The VSC-based power converter channel includes an AC-DC converter and a DC-AC inverter electrically coupled to the AC-DC converter. The AC-DC converter and a DC-AC inverter include at least one gas tube switching device coupled in electrical anti-parallel with a respective gas tube diode. The VSC-based power converter channel includes a commutating circuit communicatively coupled to one or more of the at least one gas tube switching devices. The commutating circuit is configured to "switch on" a respective one of the one or more gas tube switching devices during a first portion of an operational cycle and "switch off" the respective one of the one or more gas tube switching devices during a second portion of the operational cycle.
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
On-Site Measurements for Voltage Unbalance Studies Associated with the AC Railway Operation
DEFF Research Database (Denmark)
Stamatopoulos, Athanasios; Silva, Filipe Miguel Faria da; Bak, Claus Leth
2017-01-01
unbalance with regards to traction loads has been augmented since the decision to expand the electric railway. Towards this direction, and on the occasion of a newly built electrified line, voltage unbalance measurements were carried out and are presented in this paper. The information from the extracted......On-site measurements in Electrical Power Systems can provide valuable information about the performance of the network and also, can be of great assistance to the validation and assessment of simulation models developed for power system studies. Lately, the noticeable increase of non......-conventional types of loads, such as the AC railway, has raised concerns regarding the secure operation of power transmission networks. This renders the monitoring and reporting of various aspects of system’s power quality even more necessary. For the Danish transmission grid, in particular, the relevance of voltage...
DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS
Directory of Open Access Journals (Sweden)
S. YU. Buryak
2014-05-01
Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.
Design and implementation of VUV-CD and LD measurements using an ac modulated polarizing undulator
International Nuclear Information System (INIS)
Yagi-Watanabe, K.; Yamada, T.; Tanaka, M.; Kaneko, F.; Kitada, T.; Ohta, Y.; Nakagawa, K.
2005-01-01
VUV circular dichroism (CD) and linear dichroism (LD) have been successfully measured at wavelengths beyond the conventional limit by using an ac modulated polarizing undulator. We have developed CD and LD measuring technique by polarization modulation at the source, without using transmission type polarizing modulator, to extend to the coverage to wavelengths shorter than 140-bar nm. AIST developed in 1986 ac polarizing undulator by using a electron storage ring 'TERAS' based on an original concept. The undulator which can produce any desired polarization of vertical- and horizontal-linear polarization (VLP and HLP) and right- and left-handed circular polarization (RCP and LCP) is specially well suited to both measurements of CD and LD. With this undulator, the polarization alternate in the order of VLP-RCP-HLP-RCP-VLP-LCP-HLP-LCP-VLP-, i.e. when circular polarization is modulated in f Hz, linear polarization alters in 2f Hz. This allows us simultaneous measurements of CD and LD. Since the TERAS can produce ac-modulated polarized radiation of wavelength as short as 40-bar nm, it is expected to have CD and LD measurement extended to 40-bar nm
Quantitative analysis of the a.c. susceptibility of core–shell nanoparticles
International Nuclear Information System (INIS)
Lucchini, M. A.; Riani, P.; Canepa, F.
2013-01-01
Magnetite (Fe 3 O 4 ) and silica-coated magnetite (Fe 3 O 4 -SiO 2 ) nanoparticles (NPs) were synthesized and characterized by scanning and transmission electron microscopy and by a.c. susceptibility measurements as a function of the frequency both at room temperature and 80 K. A new mathematical approach based on the explicit coexistence (at room temperature) of Brownian and Néel contributions is proposed: the magnetic data were quantitatively analyzed following this approach and the results well agree with microscopic data. This mathematical procedure allows the achievement of the complete size distribution of coated magnetic NPs in solution as well as the real dimension of the magnetic nuclei.
Directory of Open Access Journals (Sweden)
Peng Xu
2016-10-01
Full Text Available In this paper, we demonstrate the viability of an energy receiving adapter in a 8×8 array form with high power reception efficiency with the resonator of artificial electromagnetic absorber being used as the element. Unlike the conventional reported rectifying antenna resonators, both the size of the element and the separations between the elements are electrically small in our design. The energy collecting process is explained with an equivalent circuit model, and a RF combining network is designed to combine the captured AC power from each element to one main terminal for AC-to-DC conversion. The energy receiving adapter yields a total reception efficiency of 67% (including the wave capture efficiency of 86% and the AC-to-DC conversion efficiency of 78%, which is quite promising for microwave wireless power transmission.
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Transport Schemes for Fiber-Wireless Technology: Transmission Performance and Energy Efficiency
Directory of Open Access Journals (Sweden)
Christina Lim
2014-04-01
Full Text Available Fiber-wireless technology has been actively researched as a potential candidate for next generation broadband wireless signal distribution. Despite the popularity, this hybrid scheme has many technical challenges that impede the uptake and commercial deployment. One of the inherent issues is the transport of the wireless signals over a predominantly digital optical network in today’s telecommunication infrastructure. Many different approaches have been introduced and demonstrated with digitized RF transport of the wireless signals being the most compatible with the existing optical fiber networks. In this paper, we review our work in the area of digitized RF transport to address the inherent issues related to analog transport in the fiber-wireless links and compare the transmission performance and energy efficiency with the other transport strategies.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
Ndreko, M.
2017-01-01
The development of large offshore wind power generation in the North Sea has been significantly accelerated in the last years. The large distance from shore in combination with the need for large transmission capacity has raised the interest for the voltage source converter high voltage direct
A new method of converter transformer protection without commutation failure
Zhang, Jiayu; Kong, Bo; Liu, Mingchang; Zhang, Jun; Guo, Jianhong; Jing, Xu
2018-01-01
With the development of AC / DC hybrid transmission technology, converter transformer as nodes of AC and DC conversion of HVDC transmission technology, its reliable safe and stable operation plays an important role in the DC transmission. As a common problem of DC transmission, commutation failure poses a serious threat to the safe and stable operation of power grid. According to the commutation relation between the AC bus voltage of converter station and the output DC voltage of converter, the generalized transformation ratio is defined, and a new method of converter transformer protection based on generalized transformation ratio is put forward. The method uses generalized ratio to realize the on-line monitoring of the fault or abnormal commutation components, and the use of valve side of converter transformer bushing CT current characteristics of converter transformer fault accurately, and is not influenced by the presence of commutation failure. Through the fault analysis and EMTDC/PSCAD simulation, the protection can be operated correctly under the condition of various faults of the converter.
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
Directory of Open Access Journals (Sweden)
Tobío, J. M.
1970-07-01
Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Environmental pollution by magnetic field associated with power transmission lines
Energy Technology Data Exchange (ETDEWEB)
Hamza, Abdel-Salam H. A.; Ghania, Samy M. [Faculty of Engineering, Zagazig University (Banha Branch), 9-EI-Hakim Be-Amr EI-Ahh Str, EI- Khalafawy, Shoubra, Cairo (Egypt); Mohmoudh, Shaher A. [Ministry of Electricity and Energy (Egypt)
2002-11-01
Environmental pollution has a major effect on human health and other life types. A source of environmental pollution is the magnetic field produced near high and extra high voltage (EHV) transmission lines. Magnetic fields from AC EHV lines have been discussed in this paper. The field profiles and their contribution to environmental pollution are studied, these being under transmission lines with different line system configurations, using the three dimensional approaches. These line system configurations are more commonly used in Egypt and other countries. The obtained results are found to be useful for discussing the comparison of the field densities on the human body and other life types at the ground level under or near the lines. (Author)
MATL : Canada's first merchant power transmission interconnection : experiences and future outlook
International Nuclear Information System (INIS)
Wilson, L.
2006-01-01
The current status of the Montana Alberta Tie Ltd. (MATL) merchant transmission project was outlined with reference to the business concept, the advantages of the project and market opportunities. Some of the challenges facing the project were discussed along with lessons learned and accomplishments thus far. MATL is preparing to construct a privately funded transmission line between Lethbridge, Alberta and Great Falls, Montana. The project represents the first direct power transmission inter-connection between Montana and Alberta. The 346 km, 230 kV AC transmission line with phase shifting transformer and 300 MW transfer capacity will be a synchronous interconnection and will improve the reliability of the entire electric systems in both Montana and Alberta. The benefits of the interconnected power system include increased reliability and stability of the existing power grids; better import/export capabilities; more competition and options in the marketplace; greater flexibility in scheduling generator maintenance; and, optimal allocation of generation resources. tabs., figs
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Application for Single Price Auction Model (SPA) in AC Network
Wachi, Tsunehisa; Fukutome, Suguru; Chen, Luonan; Makino, Yoshinori; Koshimizu, Gentarou
This paper aims to develop a single price auction model with AC transmission network, based on the principle of maximizing social surplus of electricity market. Specifically, we first formulate the auction market as a nonlinear optimization problem, which has almost the same form as the conventional optimal power flow problem, and then propose an algorithm to derive both market clearing price and trade volume of each player even for the case of market-splitting. As indicated in the paper, the proposed approach can be used not only for the price evaluation of auction or bidding market but also for analysis of bidding strategy, congestion effect and other constraints or factors. Several numerical examples are used to demonstrate effectiveness of our method.
Energy Technology Data Exchange (ETDEWEB)
CHARLES M. WEBER
2008-06-24
As an outgrowth of the Technology Reinvestment Program of the 1990’s, an Agreement was formed between BWXT and the DOE to promote the commercialization of Superconducting Magnetic Energy Storage (SMES) technology. Business and marketing studies showed that the performance of electric transmission lines could be improved with this SMES technology by stabilizing the line thereby allowing the reserved stability margin to be used. One main benefit sought was to double the capacity and the amount of energy flow on an existing transmission line by enabling the use of the reserved stability margin, thereby doubling revenue. Also, electrical disturbances, power swings, oscillations, cascading disturbances and brown/black-outs could be mitigated and rendered innocuous; thereby improving power quality and reliability. Additionally, construction of new transmission lines needed for increased capacity could be delayed or perhaps avoided (with significant savings) by enabling the use of the reserved stability margin of the existing lines. Two crucial technical aspects were required; first, a large, powerful, dynamic, economic and reliable superconducting magnet, capable of oscillating power flow was needed; and second, an electrical power interface and control to a transmission line for testing, demonstrating and verifying the benefits and features of the SMES system was needed. A project was formed with the goals of commercializing the technology by demonstrating SMES technology for utility applications and to establish a domestic capability for manufacturing large superconducting magnets for both commercial and defense applications. The magnet had very low AC losses to support the dynamic and oscillating nature of the stabilizing power flow. Moreover, to economically interface to the transmission line, the magnet had the largest operating voltage ever made. The manufacturing of that design was achieved by establishing a factory with newly designed and acquired equipment
An improved droop control method for multi-terminal VSC-HVDC converter stations
DEFF Research Database (Denmark)
Wang, Hao; Wang, Yue; Duan, Guozhao
2017-01-01
Multi-terminal high voltage direct current transmission based on voltage source converter (VSC-HVDC) grids can connect non-synchronous alternating current (AC) grids to a hybrid alternating current and direct current (AC/DC) power system, which is one of the key technologies in the construction...
BC Transmission Corporation : working towards a smarter grid
Energy Technology Data Exchange (ETDEWEB)
Morison, K. [British Columbia Transmission Corp., Vancouver, BC (Canada)
2009-07-01
This presentation discussed smart grid initiatives implemented as part of the British Columbia Transmission Corporation's (BCTC) transmission technology roadmap. The BCTC system is comprised of 18,000 km of transmission lines with 292 stations and 2 system control centers. BCTC is now aiming to maximize transfer capability and plan transmission system expansions for electricity security and increased capacity. BCTC's smart grid program was also designed to address emerging concerns over sustainability and the environmental impacts of electricity generation. The smart grid program will reduce system congestion, enable the integration of renewable energy, and be used as part of a broader risk assessment strategy. The program includes the use of power electronics, advanced composites and nano-materials, and field work robotics. Advance control centre technologies and synchrophasors will be used to enable wide area control and security assessment. BCTC's other smart grid initiatives include the use of smart equipment monitoring and remote sensing technologies. It was concluded that information and grid-based technologies will increase the efficiency, reliability, and flexibility of the electricity delivery infrastructure. tabs., figs.
Akbar, P. A.; Hakim, D. L.; Sucita, T.
2018-02-01
In this research, testing improvements to the distribution voltage electricity at 150 kV transmission subsystem Bandung Selatan and New Ujungberung using Flexible AC Transmission System (FACTS) technology. One of them is by doing the control of active and reactive power through the power electronics equipment Static Synchronous Compensator (STATCOM). The subsystem is tested because it has a voltage profile are relatively less well when based on the IEEE / ANSI C.84.1 (142.5 - 157.5 kV). This study was conducted by analyzing the Newton-Raphson power flow on the simulator DigSilent Power Factory 15 to determine the profile of the voltage (V) on the system. Bus which has the lowest voltage to be a reference in the installation of STATCOM. From this research is known that the voltage on the conditions of the existing bus 28, as many as 21-23 still below standard buses (142.5 kV), after the installation is done using STATCOM, voltage on the buses improved by increasing the number of tracks that follow the standard / is in the range 142.5 kV -157.5 kV as many as 23-27 buses or 78.6% - 96%, with the optimum mounting on a bus Rancaekek STATCOM II with a capacity of 300 MVA.
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Zhaohong, E-mail: lnuhjhx@163.com [School of Environmental Science, Liaoning University, Shenyang 110036 (China); Yu, Fengyang; Huang, Lirong; Jiatieli, Jianaerguli; Li, Yuanyuan; Song, Lijun [School of Environmental Science, Liaoning University, Shenyang 110036 (China); Yu, Ning [Experiment Center of Environmental Monitoring of Liaoning Province, Shenyang 110161 (China); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)
2014-08-15
Graphical abstract: - Highlights: • Generation of {sup •} OH in MW integrated with loaded TiO{sub 2}/AC system was confirmed. • Confirmation of {sup •} OH was conducted using radical scavenger such as BHT, MT and VC. • More {sup •} OH was formed using anatase TiO{sub 2}/AC than rutile TiO{sub 2}/AC under MW irradiation. • Effect of mass ratio, irradiation time, catalyst dose and DPCI on {sup •} OH was studied. - Abstract: In order to study the degradation mechanism of technology of microwave (MW) combined with TiO{sub 2} supported on activated carbon (TiO{sub 2}/AC), the reactive oxygen species (ROS) was explored through oxidation of 1,5-diphenyl carbazide (DPCI) to 1,5-diphenyl carbazone (DPCO). Furthermore, 2,6-di-tert-butyl-4-methylphenol (BHT), Mannitol (MT) and Vitamin C (VC) were used as radical scavengers to confirm the generation of the hydroxyl radicals ({sup •} OH). In addition, the influence of some parameters such as TiO{sub 2} mass ratio content, irradiation time, material dose, DPCI concentration and MW power on the determination of {sup •} OH were examined. The results showed that the {sup •} OH could be generated under MW combined with loaded TiO{sub 2}/AC. Also, anatase TiO{sub 2}/AC can generate more {sup •} OH radicals than rutile TiO{sub 2}/AC under MW irradiation. This work would provide new mechanistic insights on the enhanced degradation effect of organic pollutants in water using the supported TiO{sub 2}/AC coupled with MW technology.
Electricity transmission pricing and technology
International Nuclear Information System (INIS)
Einhorn, M.; Siddiqi, R.
1996-01-01
The electric utility industry and its stake holders in the United States appear to be at a critical juncture in time. Powerful forces of global proportions are propelling the industry instinctively and in a secular fashion towards restructuring. That the industry will change is a fait accomplii. The nature and timing of the change is still a matter of intense debate, however. Because of the evolution of the industry into its present-day form, i.e. regulated local monopolies in their designated franchise service territories, the relative roles and expectations of various institutions would have to change to conform to the new state in the future. In either encouraging, or allowing this change to happen, society is essentially saying that future societal welfare would be better served by the changed structure contemplated. What that assumption translates into in more direct terms is that creation of future wealth would be better accomplished through redistribution of wealth today. Thoughtful individuals recognize the enormous responsibility placed upon the various entities empowered with jurisdiction over the timing and nature of the structural change. They are trying hard to bring analytical rigor to bear on the debate. One very critical element of this debate on restructuring is the issue of the treatment of transmission. The issue has been variously labeled transmission access, or pricing. Volumes have been written and spoken on this topic. We felt that there was a pressing need to assemble a volume which would serve as a one-stop source for varied viewpoints and comprehensive coverage of the subject, both technical and economic. 58 figs., 23 tabs., 103 refs
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
As part of the New Sunshine Program of the Agency of Industrial Science and Technology, a 2-year survey and research is conducted beginning in 1998 on the effect of the introduction of superconductive power equipment for the facilitation of the progress of research and development of basic power equipment which utilizes AC (alternating current) superconductivity. Frontier research and development has been started of basic AC superconductive power equipment for clarifying the tasks to solve in the development effort and for preparing an efficient research and development plan. This fiscal year's endeavor covers the survey of the effect of the introduction of superconductive power equipment in addition to the preparation of a basic plan for the research and development of basic AC superconductive power equipment for fiscal 2000 and afterward, continued survey of research and development trends in and outside Japan for the review of the result achieved in the preceding fiscal year, development of AC equipment element technologies utilizing conduit type semiconductors as a basic study for the embodiment of AC superconductive equipment, and a study for elucidating the mechanism of resistance generated in a superconductive current limiter. Furthermore, papers on the superconduction technology released so far are investigated, and technology development trends and efficient research techniques are put together into a technological information database. (NEDO)
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
As part of the New Sunshine Program of the Agency of Industrial Science and Technology, a 2-year survey and research is conducted beginning in 1998 on the effect of the introduction of superconductive power equipment for the facilitation of the progress of research and development of basic power equipment which utilizes AC (alternating current) superconductivity. Frontier research and development has been started of basic AC superconductive power equipment for clarifying the tasks to solve in the development effort and for preparing an efficient research and development plan. This fiscal year's endeavor covers the survey of the effect of the introduction of superconductive power equipment in addition to the preparation of a basic plan for the research and development of basic AC superconductive power equipment for fiscal 2000 and afterward, continued survey of research and development trends in and outside Japan for the review of the result achieved in the preceding fiscal year, development of AC equipment element technologies utilizing conduit type semiconductors as a basic study for the embodiment of AC superconductive equipment, and a study for elucidating the mechanism of resistance generated in a superconductive current limiter. Furthermore, papers on the superconduction technology released so far are investigated, and technology development trends and efficient research techniques are put together into a technological information database. (NEDO)
Water-hydraulic power transmission for offshore wind farms
Diepeveen, N.F.B.; Jarquin Laguna, A.; Kempenaar, A.S.
2012-01-01
The current state of the art of offshore wind turbine power transmission technology is expensive, heavy and maintenance intensive. The Delft Offshore Turbine project considers a radically new concept for power transmission in an offshore wind farm: using seawater as power transmission medium. For
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Wireless transmission: state of research, applications, trends
International Nuclear Information System (INIS)
Berger, A.
2016-01-01
At the end of the 19th century Nikola Tesla started his work in the field of wireless energy transmission. More than 100 years after Tesla, the progress in modern semiconductor technology offer developers the possibility to realize highly efficient systems and have led to a revival of wireless energy transmission. The application ranges from the transmission of a few milliwatts in biomedical applications, over a few watts for the charging of mobile phones, to hundreds of kilowatts in the automotive sector. Depending on the used method, the possible transmission distances vary between a few centimeters up to thousands of kilometers. The physical basis of these technologies is the transmission of energy by electromagnetic waves. State-of-the-art systems use wavelengths ranging from radio waves to microwaves, to ultraviolet light. Current research focuses on optimizing transmission efficiency, increasing the possible transmission distance between transmitter and receiver, and improving spatial freedom of movement. This lecture gives an overview of the different approaches of wireless energy transmission and their physical background, the established industrial standards and the current state of research. In addition, the advantages and disadvantages of the individual methods are illustrated by selected commercial and scientific applications. (rössner) [de
Transmission Grating and Optics Technology Development for the Arcus Explorer Mission
Heilmann, Ralf; Arcus Team
2018-01-01
Arcus is a high-resolution x-ray spectroscopy MIDEX mission selected for a Phase A concept study. It is designed to explore structure formation through measurements of hot baryon distributions, feedback from black holes, and the formation and evolution of stars, disks, and exoplanet atmospheres. The design provides unprecedented sensitivity in the 1.2-5 nm wavelength band with effective area above 450 sqcm and spectral resolution R > 2500. The Arcus technology is based on 12 m-focal length silicon pore optics (SPO) developed for the European Athena mission, and critical-angle transmission (CAT) x-ray diffraction gratings and x-ray CCDs developed at MIT. The modular design consists of four parallel channels, each channel holding an optics petal, followed by a grating petal. CAT gratings are lightweight, alignment insensitive, high-efficiency x-ray transmission gratings that blaze into high diffraction orders, leading to high spectral resolution. Each optics petal represents an azimuthal sub-aperture of a full Wolter optic. The sub-aperturing effect increases spectral resolving power further. Two CCD readout strips receive photons from each channel, including higher-energy photons in 0th order. Each optics petal holds 34 SPO modules. Each grating petal holds 34 grating windows, and each window holds 4-6 grating facets. A grating facet consists of a silicon grating membrane, bonded to a flexure frame that interfaces with the grating window. We report on a sequence of tests with increasing complexity that systematically increase the Technology Readiness Level (TRL) for the combination of CAT gratings and SPOs towards TLR 6. CAT gratings have been evaluated in x rays for diffraction efficiency (> 30% at 2.5 nm) and for resolving power (R> 10,000). A CAT grating/SPO combination was measured at R ~ 3100 at blaze angles smaller than design values, exceeding Arcus requirements. Efficiency and resolving power were not impacted by vibration and thermal testing of gratings. A
Directory of Open Access Journals (Sweden)
Liwen Pan
2016-06-01
Full Text Available This paper presents an on-board vehicular battery charger that integrates bidirectional AC/DC converter and DC/DC converter to achieve high power density for application in electric vehicles (EVs. The integrated charger is able to transfer electrical energy between the battery pack and the electric traction system and to function as an AC/DC battery charger. The integrated charger topology is presented and the design of passive components is discussed. The control schemes are developed for motor drive system and battery-charging system with a power pulsation reduction circuit. Simulation results in MATLAB/Simulink and experiments on a 30-kW motor drive and 3.3-kW AC/DC charging prototype validate the performance of the proposed technology. In addition, power losses, efficiency comparison and thermal stress for the integrated charger are illustrated. The results of the analyses show the validity of the advanced integrated charger for electric vehicles.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Energy Technology Data Exchange (ETDEWEB)
Figueiredo, Erli Ferreira [Universidade do Estado, Rio de Janeiro, RJ (Brazil)]. E-mail: erli@openlink.com.br
2001-07-01
The deregulation and the Brazilian electric sector new formulation associated to the growth of the electric energy market, has been contributing to increase the power flows through located transmission lines in one same region, as well as in different regions. This increase of flow will require the construction of new transmission lines, in general associated to eventual efforts in the system. However, due to environmental restrictions and to difficulties for acquisition of free soil bands for transmission lines, in this article new technologies of transmission in order to increase the capacity of the existing and future power systems are presented, with the purpose of preventing or postponing the construction of new transmission lines.
Towards quantitative PET/MRI: a review of MR-based attenuation correction techniques.
Hofmann, Matthias; Pichler, Bernd; Schölkopf, Bernhard; Beyer, Thomas
2009-03-01
Positron emission tomography (PET) is a fully quantitative technology for imaging metabolic pathways and dynamic processes in vivo. Attenuation correction of raw PET data is a prerequisite for quantification and is typically based on separate transmission measurements. In PET/CT attenuation correction, however, is performed routinely based on the available CT transmission data. Recently, combined PET/magnetic resonance (MR) has been proposed as a viable alternative to PET/CT. Current concepts of PET/MRI do not include CT-like transmission sources and, therefore, alternative methods of PET attenuation correction must be found. This article reviews existing approaches to MR-based attenuation correction (MR-AC). Most groups have proposed MR-AC algorithms for brain PET studies and more recently also for torso PET/MR imaging. Most MR-AC strategies require the use of complementary MR and transmission images, or morphology templates generated from transmission images. We review and discuss these algorithms and point out challenges for using MR-AC in clinical routine. MR-AC is work-in-progress with potentially promising results from a template-based approach applicable to both brain and torso imaging. While efforts are ongoing in making clinically viable MR-AC fully automatic, further studies are required to realize the potential benefits of MR-based motion compensation and partial volume correction of the PET data.
Towards quantitative PET/MRI: a review of MR-based attenuation correction techniques
International Nuclear Information System (INIS)
Hofmann, Matthias; Pichler, Bernd; Schoelkopf, Bernhard; Beyer, Thomas
2009-01-01
Positron emission tomography (PET) is a fully quantitative technology for imaging metabolic pathways and dynamic processes in vivo. Attenuation correction of raw PET data is a prerequisite for quantification and is typically based on separate transmission measurements. In PET/CT attenuation correction, however, is performed routinely based on the available CT transmission data. Recently, combined PET/magnetic resonance (MR) has been proposed as a viable alternative to PET/CT. Current concepts of PET/MRI do not include CT-like transmission sources and, therefore, alternative methods of PET attenuation correction must be found. This article reviews existing approaches to MR-based attenuation correction (MR-AC). Most groups have proposed MR-AC algorithms for brain PET studies and more recently also for torso PET/MR imaging. Most MR-AC strategies require the use of complementary MR and transmission images, or morphology templates generated from transmission images. We review and discuss these algorithms and point out challenges for using MR-AC in clinical routine. MR-AC is work-in-progress with potentially promising results from a template-based approach applicable to both brain and torso imaging. While efforts are ongoing in making clinically viable MR-AC fully automatic, further studies are required to realize the potential benefits of MR-based motion compensation and partial volume correction of the PET data. (orig.)
Towards quantitative PET/MRI: a review of MR-based attenuation correction techniques
Energy Technology Data Exchange (ETDEWEB)
Hofmann, Matthias [Max Planck Institute for Biological Cybernetics, Tuebingen (Germany); University of Tuebingen, Laboratory for Preclinical Imaging and Imaging Technology of the Werner Siemens-Foundation, Department of Radiology, Tuebingen (Germany); University of Oxford, Wolfson Medical Vision Laboratory, Department of Engineering Science, Oxford (United Kingdom); Pichler, Bernd [University of Tuebingen, Laboratory for Preclinical Imaging and Imaging Technology of the Werner Siemens-Foundation, Department of Radiology, Tuebingen (Germany); Schoelkopf, Bernhard [Max Planck Institute for Biological Cybernetics, Tuebingen (Germany); Beyer, Thomas [University Hospital Duisburg-Essen, Department of Nuclear Medicine, Essen (Germany); Cmi-Experts GmbH, Zurich (Switzerland)
2009-03-15
Positron emission tomography (PET) is a fully quantitative technology for imaging metabolic pathways and dynamic processes in vivo. Attenuation correction of raw PET data is a prerequisite for quantification and is typically based on separate transmission measurements. In PET/CT attenuation correction, however, is performed routinely based on the available CT transmission data. Recently, combined PET/magnetic resonance (MR) has been proposed as a viable alternative to PET/CT. Current concepts of PET/MRI do not include CT-like transmission sources and, therefore, alternative methods of PET attenuation correction must be found. This article reviews existing approaches to MR-based attenuation correction (MR-AC). Most groups have proposed MR-AC algorithms for brain PET studies and more recently also for torso PET/MR imaging. Most MR-AC strategies require the use of complementary MR and transmission images, or morphology templates generated from transmission images. We review and discuss these algorithms and point out challenges for using MR-AC in clinical routine. MR-AC is work-in-progress with potentially promising results from a template-based approach applicable to both brain and torso imaging. While efforts are ongoing in making clinically viable MR-AC fully automatic, further studies are required to realize the potential benefits of MR-based motion compensation and partial volume correction of the PET data. (orig.)
Multilevel Modular Converter for VSC-HVDC Transmission Applications: Control and Operational Aspects
DEFF Research Database (Denmark)
Gnanarathna, Udana N.; Gole, Aniruddha M.; Chaudhary, Sanjay Kumar
2010-01-01
Control methods for a new class of converter, the multilevel modular converter (MMC), recently introduced for HVDC transmission are discussed. The paper discusses converter-level controls including firing pulse generation and capacitor voltage balancing. It also covers higher level controls...... for incorporating the converter into a larger power network, with a weak ac receiving end. The performance behavior is studied using electromagnetic transients simulation....
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Whiten, Andrew
2015-11-19
The complexity of Stone Age tool-making is assumed to have relied upon cultural transmission, but direct evidence is lacking. This paper reviews evidence bearing on this question provided through five related empirical perspectives. Controlled experimental studies offer special power in identifying and dissecting social learning into its diverse component forms, such as imitation and emulation. The first approach focuses on experimental studies that have discriminated social learning processes in nut-cracking by chimpanzees. Second come experiments that have identified and dissected the processes of cultural transmission involved in a variety of other force-based forms of chimpanzee tool use. A third perspective is provided by field studies that have revealed a range of forms of forceful, targeted tool use by chimpanzees, that set percussion in its broader cognitive context. Fourth are experimental studies of the development of flint knapping to make functional sharp flakes by bonobos, implicating and defining the social learning and innovation involved. Finally, new and substantial experiments compare what different social learning processes, from observational learning to teaching, afford good quality human flake and biface manufacture. Together these complementary approaches begin to delineate the social learning processes necessary to percussive technologies within the Pan-Homo clade. © 2015 The Author(s).
2017 Technology Showcase Presentations | NCI Technology Transfer Center | TTC
Presentations from the 2017 Technology Showcase by NIH Intramural Research Program scientists held at Frederick National Laboratories for Cancer Research on June 7, 2017. | [google6f4cd5334ac394ab.html
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
International Nuclear Information System (INIS)
Qin Ying-Mei; Wang Jiang; Men Cong; Zhao Jia; Wei Xi-Le; Deng Bin
2012-01-01
Both external and endogenous electrical fields widely exist in the environment of cortical neurons. The effects of a weak alternating current (AC) field on a neural network model with synaptic plasticity are studied. It is found that self-sustained rhythmic firing patterns, which are closely correlated with the cognitive functions, are significantly modified due to the self-organizing of the network in the weak AC field. The activities of the neural networks are affected by the synaptic connection strength, the external stimuli, and so on. In the presence of learning rules, the synaptic connections can be modulated by the external stimuli, which will further enhance the sensitivity of the network to the external signal. The properties of the external AC stimuli can serve as control parameters in modulating the evolution of the neural network. (interdisciplinary physics and related areas of science and technology)
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
International Nuclear Information System (INIS)
Rouabah, Hamza A; Morgan, Hywel; Green, Nicolas G; Park, Benjamin Y; Zaouk, Rabih B; Madou, Marc J
2011-01-01
Lab-on-a-chip devices require integrated pumping and fluid control in microchannels. A recently developed mechanism that can produce fluid flow is an integrated ac-electro-osmosis micropump. However, like most electrokinetic pumps, ac-electro-osmotic pumps are incapable of handling backpressure as the pumping force mechanism acts on the surface of the fluid rather than the bulk. This paper presents a novel 3D electrode structure designed to overcome this limitation. The electrodes are fabricated using carbon-MEMS technology based on the pyrolysis of the photo-patternable polymer SU-8. The novel ac-electro-osmosis micropump shows an increase in the flow velocity compared to planar electrodes.
Energy Technology Data Exchange (ETDEWEB)
Oei, Pao-Yu; Sander, Aram; Hankel, Lisa; Laurisch, Lilian; Lorenz, Casimir [Technische Univ. Berlin (Germany); Schroeder, Andreas [Deutsches Institut fuer Wirtschaftsforschung, Berlin (Germany)
2012-09-15
The grid development plan presented in June 2012 by the German Federal Network Agency envisages a large number of new AC and DC transmission lines for Germany. The purpose of these transmission lines is to facilitate the point-to-point transport of electricity produced from renewable resources to load centres. The authors present a model-assisted analysis of the impact of these transmission lines on the structure of electricity production. They also investigate to what extent an increase in storage capacity and the steering of demand can serve as alternatives to grid expansion.
Energy Technology Data Exchange (ETDEWEB)
Zeiff, Andreas; Homburg, Dietrich
2009-01-15
Electronics is the key technology in control engineering, but even the best control system requires reliable modules to transmit signals. Modern electric motors have become indispensable here. There are nearly as many motor types as there are applications. Electromagnetic conversion of electric into mechanical power is directly related to motor design. There are AC and DC motors, one-speed motors and variable-speed motors. Rotary momentum and synchronisation can be optimized by selecting the appropriate motor type, as can dynamics and detent torque. Correct selection of the electric motor therefore is essential for an optimal drive concept. (orig.)
Klemke, Roland; Specht, Marcus
2013-01-01
Klemke, R., & Specht, M. (2013, 26-27 September). Technology Enhanced Learning. Presentation at the fourth international conference on eLearning (eLearning 2013), Belgrade, Serbia. http://econference.metropolitan.ac.rs/
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Progress and monitoring system on compression and transmission technologies of dynamic image
International Nuclear Information System (INIS)
Kobayashi, Hiroyuki; Saijo, Nobuyuki; Nakajo, Ken
2001-01-01
The Toshiba Corporation developed a real-time dynamic image transmission matched with quality of transmission circuit by using MPEG-4 which was recent international standard system for the dynamic image coding system. Concretely, this system made possible on real-time dynamic image transmission even at transmission on wireless circuit such as portable telephone, PHS, wireless LAN, and so on, at viewpoint of the mobile communication. And, by using the wireless circuit, it could be built without any limit of transmission cable, to realize its layout-free establishment. In addition, this system uses only image for communication without using voice, and some devices were carried out to upgrade image and frame speed as possible. Here were described on outlines of transmission system and principle of detection MPEG-4, and function and application of monitoring system using this system. (G.K.)
Perry, Nicola H; Kim, Jae Jin; Tuller, Harry L
2018-01-01
We compare approaches to measure oxygen surface exchange kinetics, by simultaneous optical transmission relaxation (OTR) and AC-impedance spectroscopy (AC-IS), on the same mixed conducting SrTi 0.65 Fe 0.35 O 3-x film. Surface exchange coefficients were evaluated as a function of oxygen activity in the film, controlled by gas partial pressure and/or DC bias applied across the ionically conducting yttria-stabilized zirconia substrate. Changes in measured light transmission through the film over time (relaxations) resulted from optical absorption changes in the film corresponding to changes in its oxygen and oxidized Fe (~Fe 4+ ) concentrations; such relaxation profiles were successfully described by the equation for surface exchange-limited kinetics appropriate for the film geometry. The k chem values obtained by OTR were significantly lower than the AC-IS derived k chem values and k q values multiplied by the thermodynamic factor (bulk or thin film), suggesting a possible enhancement in k by the metal current collectors (Pt, Au). Long-term degradation in k chem and k q values obtained by AC-IS was also attributed to deterioration of the porous Pt current collector, while no significant degradation was observed in the optically derived k chem values. The results suggest that, while the current collector might influence measurements by AC-IS, the OTR method offers a continuous, in situ , and contact-free method to measure oxygen exchange kinetics at the native surfaces of thin films.
Perry, Nicola H.; Kim, Jae Jin; Tuller, Harry L.
2018-01-01
Abstract We compare approaches to measure oxygen surface exchange kinetics, by simultaneous optical transmission relaxation (OTR) and AC-impedance spectroscopy (AC-IS), on the same mixed conducting SrTi0.65Fe0.35O3-x film. Surface exchange coefficients were evaluated as a function of oxygen activity in the film, controlled by gas partial pressure and/or DC bias applied across the ionically conducting yttria-stabilized zirconia substrate. Changes in measured light transmission through the film over time (relaxations) resulted from optical absorption changes in the film corresponding to changes in its oxygen and oxidized Fe (~Fe4+) concentrations; such relaxation profiles were successfully described by the equation for surface exchange-limited kinetics appropriate for the film geometry. The kchem values obtained by OTR were significantly lower than the AC-IS derived kchem values and kq values multiplied by the thermodynamic factor (bulk or thin film), suggesting a possible enhancement in k by the metal current collectors (Pt, Au). Long-term degradation in kchem and kq values obtained by AC-IS was also attributed to deterioration of the porous Pt current collector, while no significant degradation was observed in the optically derived kchem values. The results suggest that, while the current collector might influence measurements by AC-IS, the OTR method offers a continuous, in situ, and contact-free method to measure oxygen exchange kinetics at the native surfaces of thin films. PMID:29511391
The transmission of information to the authorities is essential in case of severe nuclear accident
International Nuclear Information System (INIS)
Yasui, Masaya
2016-01-01
After an accident has occurred the media and the public want information and now with the new information technologies and social networks the public can be informed very quickly and even before the state authorities themselves. The risk is the rise of a strong psychological pressure yielded by the media on the authorities to supply information and the spread of inaccurate or even false information. It is absolutely necessary that the team in charge of the communication to the public could bring as much information as available in the shortest possible time. It is also necessary that the authorities should be informed of the actions made or planned by the plant operator in order to anticipate the public need for information. The feedback experience from the Fukushima accident shows that the collect, the transmission and the selection of information take time and that, even in the best ever situation, an accident will generate confusion and lack of information inevitably. (A.C.)
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Integrated Transmission and Distribution Control
Energy Technology Data Exchange (ETDEWEB)
Kalsi, Karanjit [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Fuller, Jason C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Tuffner, Francis K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lian, Jianming [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhang, Wei [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Marinovici, Laurentiu D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Fisher, Andrew R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Chassin, Forrest S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hauer, Matthew L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2013-01-01
Distributed, generation, demand response, distributed storage, smart appliances, electric vehicles and renewable energy resources are expected to play a key part in the transformation of the American power system. Control, coordination and compensation of these smart grid assets are inherently interlinked. Advanced control strategies to warrant large-scale penetration of distributed smart grid assets do not currently exist. While many of the smart grid technologies proposed involve assets being deployed at the distribution level, most of the significant benefits accrue at the transmission level. The development of advanced smart grid simulation tools, such as GridLAB-D, has led to a dramatic improvement in the models of smart grid assets available for design and evaluation of smart grid technology. However, one of the main challenges to quantifying the benefits of smart grid assets at the transmission level is the lack of tools and framework for integrating transmission and distribution technologies into a single simulation environment. Furthermore, given the size and complexity of the distribution system, it is crucial to be able to represent the behavior of distributed smart grid assets using reduced-order controllable models and to analyze their impacts on the bulk power system in terms of stability and reliability.
Technology Transmission Across National Innovation Systems
DEFF Research Database (Denmark)
Haakonsson, Stine Jessen; Slepniov, Dmitrij
This paper advances our understanding of how technology upgrading in the Chinese wind turbine industry is linked to internationalisation of Danish component suppliers. In order to grasp the interlinkages and implications hereof, the paper combines perspectives of global value chains (GVC), national.......e. linking up with global suppliers in the wind turbine global value chain, and the new role of component suppliers as technology transmitters across national innovation systems into emerging markets. Conceptually, the paper contributes to understanding how technological catching up in value chains links...
Technology Transmission Across National Innovation Systems
DEFF Research Database (Denmark)
Haakonsson, Stine Jessen; Slepniov, Dmitrij
2018-01-01
This paper advances our understanding of how technology upgrading in the Chinese wind turbine industry is linked to internationalisation of Danish component suppliers. In order to grasp the interlinkages and implications hereof, the paper combines perspectives of global value chains (GVC), national.......e. linking up with global suppliers in the wind turbine global value chain, and the new role of component suppliers as technology transmitters across national innovation systems into emerging markets. Conceptually, the paper contributes to understanding how technological catching up in value chains links...
Power Transmission by Optical Fibers for Component Inherent Communication
Directory of Open Access Journals (Sweden)
Michael Dumke
2010-02-01
Full Text Available The use of optical fibers for power transmission has been investigated intensely. An optically powered device combined with optical data transfer offers several advantages compared to systems using electrical connections. Optical transmission systems consist of a light source, a transmission medium and a light receiver. The overall system performance depends on the efficiency of opto-electronic converter devices, temperature and illumination dependent losses, attenuation of the transmission medium and coupling between transmitter and fiber. This paper will summarize the state of the art for optically powered systems and will discuss reasons for negative influences on efficiency. Furthermore, an outlook on power transmission by the use of a new technology for creating polymer optical fibers (POF via micro dispensing will be given. This technology is capable to decrease coupling losses by direct contacting of opto-electronic devices.
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Hydraulic fluid used for power transmission
Energy Technology Data Exchange (ETDEWEB)
Heikkilae, M.; Pikulinsky, K.; Leisio, C.
1996-11-01
In early October another 50-kilowatt wind turbine was provided with new power transmission technology at the Kopparnaes Energy Park in Inkoo, Finland, west of Helsinki. The new technology is thought to make this wind turbine located on the south coast of Finland more efficient, lighter, and cheaper. Certain aspects of this new technology can be applied to older wind turbines. (orig.)
Web technology for emergency medicine and secure transmission of electronic patient records.
Halamka, J D
1998-01-01
The American Heritage dictionary defines the word "web" as "something intricately contrived, especially something that ensnares or entangles." The wealth of medical resources on the World Wide Web is now so extensive, yet disorganized and unmonitored, that such a definition seems fitting. In emergency medicine, for example, a field in which accurate and complete information, including patients' records, is urgently needed, more than 5000 Web pages are available today, whereas fewer than 50 were available in December 1994. Most sites are static Web pages using the Internet to publish textbook material, but new technology is extending the scope of the Internet to include online medical education and secure exchange of clinical information. This article lists some of the best Web sites for use in emergency medicine and then describes a project in which the Web is used for transmission and protection of electronic medical records.
IMPROVEMENT OF POWER SYSTEM QUALITY USING VSC ...
African Journals Online (AJOL)
The HVDC technology can be represented by the combination of a Direct Current (DC) circuit with two power electronics converters, each one at a link terminal, for AC/DC and DC/AC conversion The principal characteristic of VSC-HVDC transmission is its ability to independently control the reactive and real power flow at ...
Overview of FACTS devices for wind power plants directly connected to the transmission network
DEFF Research Database (Denmark)
Adamczyk, Andrzej Grzegorz; Teodorescu, Remus; Rodriguez, Pedro
2010-01-01
Growing number of wind turbines is changing electricity generation profile all over the world. This brings challenges for power system operation, which was designed and developed around conventional power plants with directly coupled synchronous generators. In result, safety and stability...... of the electrical network with high wind energy penetration might be compromised. For this reason transmission system operators (TSO) impose more stringent connection requirements on the wind power plant (WPP) owners. On the other hand flexible AC transmission systems (FACTS) devices offer enhancement of grid...... research in FACTS applicability for WPPs is summarized. Examples of few existing FACTS applications for wind farms are given....
Data transmission optical link for RF-GUN project
Olowski, Krzysztof; Zielinski, Jerzy; Jalmuzna, Wojciech; Pozniak, Krzysztof; Romaniuk, Ryszard
2005-09-01
Today, the fast optical data transmission is one of the fundamentals of modern distributed control systems. The fibers are widely use as multi-gigabit data stream medium. For a short range transmission, the multimode fibers are in common use. The data rate for this kind of transmission exceeds 10 Gbps for 10 Gigabit Ethernet and 10G Fibre Channel protocols. The Field Programmable Gate Arrays are one of the opportunities of managing the optical transmission. This article is concerning a synchronous optical transmission system via a multimode fiber. The transmission is controlled by the FPGA of two manufacturers: Xilinx and Altera. This paper contains the newest technology overview and market device parameters. It also describes a board for the optical transmission, technical details of the transmission and optical transmission results.
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
Yagotintsev, K.; Nijhuis, A.
2018-07-01
Two prototype Nb3Sn cable-in-conduit conductors conductors were designed and manufactured for the toroidal field (TF) magnet system of the envisaged European DEMO fusion reactor. The AC loss, contact resistance and mechanical properties of two sample conductors were tested in the Twente Cryogenic Cable Press under cyclic load up to 30 000 cycles. Though both conductors were designed to operate at 82 kA in a background magnetic field of 13.6 T, they reflect different approaches with respect to the magnet winding pack assembly. The first approach is based on react and wind technology while the second is the more common wind and react technology. Each conductor was tested first for AC loss in virgin condition without handling. The impact of Lorentz load during magnet operation was simulated using the cable press. In the press each conductor specimen was subjected to transverse cyclic load up to 30 000 cycles in liquid helium bath at 4.2 K. Here a summary of results for AC loss, contact resistance, conductor deformation, mechanical heat production and conductor stiffness evolution during cycling of the load is presented. Both conductors showed similar mechanical behaviour but quite different AC loss. In comparison with previously tested ITER TF conductors, both DEMO TF conductors possess very low contact resistance resulting in high coupling loss. At the same time, load cycling has limited impact on properties of DEMO TF conductors in comparison with ITER TF conductors.
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
In-situ environmental (scanning) transmission electron microscopy of catalysts at the atomic level
International Nuclear Information System (INIS)
Gai, P L; Boyes, E D
2014-01-01
Observing reacting single atoms on the solid catalyst surfaces under controlled reaction conditions is a key goal in understanding and controlling heterogeneous catalytic reactions. In-situ real time aberration corrected environmental (scanning) transmission electron microscopy (E(S)TEM permit the direct imaging of dynamic surface and sub-surface structures of reacting catalysts. In this paper in-situ AC ETEM and AC ESTEM studies under controlled reaction environments of oxide catalysts and supported metal nanocatalysts important in chemical industry are presented. They provide the direct evidence of dynamic processes at the oxide catalyst surface at the atomic scale and single atom dynamics in catalytic reactions. The ESTEM studies of single atom dynamics in controlled reaction environments show that nanoparticles act as reservoirs of ad-atoms. The results have important implications in catalysis and nanoparticle studies
The Insulation Structure of the 1 Megavolt Transmission Line for the ITER Neutral Beam Injector
International Nuclear Information System (INIS)
Lorenzi, A. de; Grando, L.; Gobbo, R; Pesavento, G.; Bettini, P.; Specogna, R.; Trevisan, F.
2006-01-01
The paper describes the studies and the tests for the development of the insulation structure of the 1 MV-50 A Gas Insulated (SF 6 ) Line of the ITER NBI in the SINGAP configuration. Basically, the Transmission Line for the SinGap configuration consists of a coaxial conductor with the inner electrode polarized at the negative value of 1 MV dc. Despite Transmission Line belongs to the Gas Insulated Switchgear (GIS) family, whose technology is nowadays mature, the design of spacers (usually epoxy post and conical type) for High Voltage DC with the same degree of reliability of spacer for High Voltage AC is far away to be attained, due to the substantial difference between AC and DC voltage electric field configuration and insulation behavior at Epoxy-SF 6 interface. Furthermore, the occurrence of very frequent short circuits during the NBI operation introduces further elements of uncertainty in the design of the insulation structure. The first step was then to assess the capability of standard epoxy spacers to withstand DC voltage with frequent short circuits, in order to determine if the choice of the material is suitable for such an application; a test circuit was set up, with the possibility to generate 200 kV DC and to produce a short-circuit every 15'. The system with the spacers was pressurized with SF 6 at 0.3 MPa. For the interpretation of the experimental results, the spacer has been modeled with commercial (ANSYS TM FEM) and research (Cell Method) numerical codes in order to evaluate both the capacitive and resistive electric field distributions. Once assessed the possibility of using epoxy compounds for the spacer construction, the post and cone spacers have been designed taking into consideration various cases, like electrostatic field configuration, resistive distribution for homogeneous and skin conductivity of the spacer, and for high SF 6 conductivity. In these cases the optimization of the triple point screening has been evaluated, leading to
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
Directory of Open Access Journals (Sweden)
H.M. Mobarak
2014-06-01
Full Text Available Increasing environmental awareness and demands for lowering energy consumptions are strong driving forces behind the development of the vehicles of tomorrow. Without the advances of lubricant chemistry and adequate lubricant formulation, expansion of modern engines would not have been possible. Considering environmental awareness factors as compared to mineral oils, vegetal oil based biolubricants are renewable, biodegradable, non-toxic and have a least amount of greenhouse gases. Furthermore, improvement in engine performance and transmission components, which were impossible to achieve by applying only lubricants design, is now possible through diamond like carbon (DLC coatings. DLC coatings exhibit brilliant tribological properties, such as good wear resistance and low friction. In this regard, tribological performance of a-C: H DLC coating when lubricated with Canola vegetal oil has been investigated by the help of a ball-on-flat geometry. Experimental results demonstrated that the a-C: H DLC coating exhibited better performance with Canola oil in terms of friction and wear as compared to the uncoated materials. Large amount of polar components in the Canola oil significantly improved the tribological properties of the a-C:H coating. Thus, usage of a-C: H DLC coating with Canola oil in the long run may have a positive impact on engine life.
METHODS OF POLYMODAL INFORMATION TRANSMISSION
Directory of Open Access Journals (Sweden)
O. O. Basov
2015-03-01
Full Text Available The research results upon the application of the existing information transmission methods in polymodal info communication systems are presented herein. The analysis of the existing commutation ways and multiplexing schemes has revealed that modern means of telecommunication are capable of providing polymodal information delivery with the required quality to the customer correspondent terminal. Under these conditions substantial capacity resource consumption in the data transmission networks with a simultaneous static time multiplexing is required, however, it is easier to achieve the modality synchronization within that kind of an infrastructure. The data networks with a static time multiplexing demand employing more sophisticated supporting algorithms of the guaranteed data blocks delivery quality. However, due to the stochastic data blocks delays modality synchronizing during the off-line processing is more difficult to provide. Nowadays there are objective preconditions for a data networking realization which is invariable to the applied transmission technology. This capability is defined by a wide (person-to-person application of the optical technologies in the transport infrastructure of the polymodal info communication systems. In case of the availability of the customer terminal and networking functioning matching mode it becomes possible to organize channels in the latter which can adaptively select the most effective networking technology according to the current volume allocation and modality types in the messages.
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
El-Bashir, S. M.; Alwadai, N. M.; AlZayed, N.
2018-02-01
Polymer nanocomposite films were prepared by doping fullerene C60 in polymer blend composed of polymethacrylate/polyvinyl acetate blends (PMMA/PVAc) using solution cast technique. The films were characterized by differential scanning calorimeter (DSC), Transmission electron microscope (TEM), DC/AC electrical conductivity and dielectric measurements in the frequency range (100 Hz- 1 MHz). The glass transition temperature, Tg, was increased by increasing the concentration of fullerene C60; this property reflects the increase of thermal stability by increasing the nanofiller content. The DC and AC electrical conductivities were enhanced by increasing C60 concentration due to the electron hopping or tunneling between filled and empty localized states above Tg. The relaxation time was determined from the αβ -relaxations and found to be attenuated by increasing the temperature as a typical behavior of amorphous polymers. The calculated values of thermodynamic parameters revealed the increase of molecular stability by increasing the doping concentration; this feature supports the application of PMMA/PVAc/C60 nanocomposite films in a wide scale of solar energy conversion applications such as luminescent down-shifting (LDS) coatings for photovoltaic cells.
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
International Nuclear Information System (INIS)
Huang Xueqing; Zhang Senru
1999-01-01
Based on Qinshan II Nuclear Power Plant that is designed and constructed by way of self-reliance, China has developed advanced passive PWR AC-600. The design concept of AC-600 not only takes the real situation of China into consideration, but also follows the developing trend of nuclear power in the world. The design of AC-600 has the following technical characteristics: Advanced reactor: 18-24 month fuel cycle, low neutron leakage, low power density of the core, no any penetration in the RPV below the level of the reactor coolant nozzles; Passive safety systems: passive emergency residual heat removal system, passive-active safety injection system, passive containment cooling system and main control room habitability system; System simplified and the number of components reduced; Digital I and C; Modular construction. AC-600 inherits the proven technology China has mastered and used in Qirtshan 11, and absorbs advanced international design concepts, but it also has a distinctive characteristic of bringing forth new ideas independently. It is suited to Chinese conditions and therefore is expected to become an orientation of nuclear power development by self-reliance in China for the next century. (author)
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
Directory of Open Access Journals (Sweden)
Mohamed ZELLAGUI
2012-11-01
Full Text Available This paper presents a study on the performances of distance relays setting in 400 kV in Eastern Algerian transmission networks at Sonelgaz Group (Algerian company of Electrical and Gas compensated by shunt Flexible AC Transmission System (FACTS. The facts are used for controlling transmission voltage, power flow, reactive power, and damping of power system oscillations in high power transfer levels. The effects of SVC devices i.e. Thyristor Controlled Reactor (TCR and the Thyristor Switched Capacitors (TSC insertion, on the total impedance of a transmission line protected by MHO distance relay are investigated. The modified setting zones protections for three forward zones (Z1, Z2 and Z3 have been calculated in order to improve the performances of distance relay protection and prevent circuit breaker nuisance tripping.
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
Cryogenic System for a High-Temperature Superconducting Power Transmission Cable
International Nuclear Information System (INIS)
Demko, J.A.; Gouge, M.J.; Hughey, R.L.; Lue, J.W.; Martin, R.; Sinha, U.; Stovall, J.P.
1999-01-01
High-temperature superconducting (HTS) cable systems for power transmission are under development that will use pressurized liquid nitrogen to provide cooling of the cable and termination hardware. Southwire Company and Oak Ridge National Laboratory have been operating a prototype HTS cable system that contains many of the typical components needed for a commercial power transmission application. It is being used to conduct research in the development of components and systems for eventual commercial deployment. The cryogenic system was built by Air Products and Chemicals, Allentown, Pennsylvania, and can circulate up to 0.35 kg/s of liquid nitrogen at temperatures as low as 67 K at pressures of 1 to 10 bars. Sufficient cooling is provided for testing a 5-m-long HTS transmission cable system that includes the terminations required for room temperature electrical connections. Testing of the 5-m HTS transmission cable has been conducted at the design ac conditions of 1250 A and 7.5 kV line to ground. This paper contains a description of the essential features of the HTS cable cryogenic system and performance results obtained during operation of the system. The salient features of the operation that are important in large commercial HTS cable applications will be discussed
Energy Technology Data Exchange (ETDEWEB)
Mueller, Steffen; Weigel, Robert; Koelpin, Alexander [Institute for Electronics Engineering, University of Erlangen-Nuremberg, Cauerstr. 9, 91058 Erlangen (Germany); Dennerlein, Juergen; Janke, Iryna; Weber, Johannes [AREVA GmbH, Paul-Gossen-Str. 100, 91052 Erlangen (Germany)
2015-07-01
Signal conditioning and transmission for sensor systems and networks within the containment of nuclear power plants (NPPs) still poses a challenge to engineers, particularly in the case of equipment upgrades for existing plants, temporary measurements, decommissioning of plants, but also for new builds. This paper presents an innovative method for efficient and cost-effective instrumentation within high dose rate areas inside the containment. A transmitter-receiver topology is proposed that allows simultaneous, unidirectional point-to-point transmission of multiple sensor signals by superimposing them on existing AC or DC power supply cables using power line communication (PLC) technology. Thereby the need for costly installation of additional cables and containment penetrations is eliminated. Based on commercial off-the-shelf (COTS) electronic parts, a radiation hard transmitter is designed to operate in harsh environment within the containment during full plant operation. Hardware modularity of the transmitter allows application specific tradeoffs between redundancy and channel bandwidth. At receiver side in non-radiated areas, signals are extracted from the power line, demodulated, and provided either in analog or digital output format. Laboratory qualification tests and field test results within a boiling water reactor (BWR) are validating the proof of concept of the proposed system. (authors)
Fractional Modeling of the AC Large-Signal Frequency Response in Magnetoresistive Current Sensors
Directory of Open Access Journals (Sweden)
Sergio Iván Ravelo Arias
2013-12-01
Full Text Available Fractional calculus is considered when derivatives and integrals of non-integer order are applied over a specific function. In the electrical and electronic domain, the transfer function dependence of a fractional filter not only by the filter order n, but additionally, of the fractional order α is an example of a great number of systems where its input-output behavior could be more exactly modeled by a fractional behavior. Following this aim, the present work shows the experimental ac large-signal frequency response of a family of electrical current sensors based in different spintronic conduction mechanisms. Using an ac characterization set-up the sensor transimpedance function is obtained considering it as the relationship between sensor output voltage and input sensing current,[PLEASE CHECK FORMULA IN THE PDF]. The study has been extended to various magnetoresistance sensors based in different technologies like anisotropic magnetoresistance (AMR, giant magnetoresistance (GMR, spin-valve (GMR-SV and tunnel magnetoresistance (TMR. The resulting modeling shows two predominant behaviors, the low-pass and the inverse low-pass with fractional index different from the classical integer response. The TMR technology with internal magnetization offers the best dynamic and sensitivity properties opening the way to develop actual industrial applications.
International Nuclear Information System (INIS)
Noji, H; Haji, K; Hamada, T
2003-01-01
We have calculated the alternating current (ac) losses of a 114 MVA high-T C superconducting (HTS) transmission cable using an electric-circuit (EC) model. The HTS cable is fabricated by Tokyo Electric Power Company and Sumitomo Electric Industries, Ltd. The EC model is comprised of a resistive part and an inductive part. The resistive part is obtained by the approximated Norris equation for a HTS tape. The Norris equation indicates hysteresis losses due to self-fields. The inductive part has two components, i.e. inductances related to axial fields and those related to circumferential fields. The layer currents and applied fields of each layer were calculated by the EC model. By using both values, the ac losses of the one-phase HTS cable were obtained by calculation considering the self-field, the axial field and the circumferential field of the HTS tape. The measured ac loss transporting 1 kA rms is 0.7 W m -1 ph -1 , which is equal to the calculation. The distribution of each layer loss resembles in shape the distribution of the circumferential field in each layer, which indicates that the circumferential fields strongly influence the ac losses of the HTS cable
Energy Technology Data Exchange (ETDEWEB)
Pietryk, Steven [Dominion, Richmond, VA (United States)
2017-01-31
The primary purpose of the VOWTAP was to advance the offshore wind industry in the United States (U.S.) by demonstrating innovative technologies and process solutions that would establish offshore wind as a cost-effective renewable energy resource. The VOWTAP Team proposed to design, construct, and operate a 12 megawatt (MW) offshore wind facility located approximately 27 statute miles (mi) (24 nautical miles [nm], 43 kilometers [km]) off the coast of Virginia. The proposed Project would consist of two Alstom Haliade™ 150-6 MW turbines mounted on inward battered guide structures (IBGS), a 34.5-kilovolt (kV) alternating current (AC) submarine cable interconnecting the WTGs (inter-array cable), a 34.5-kV AC submarine transmission cable (export cable), and a 34.5 kV underground cable (onshore interconnection cable) that would connect the Project with existing Dominion infrastructure located in Virginia Beach, Virginia (Figure 1). Interconnection with the existing Dominion infrastructure would also require an onshore switch cabinet, a fiber optic cable, and new interconnection station to be located entirely within the boundaries of the Camp Pendleton State Military Reservation (Camp Pendleton). The VOWTAP balanced technology innovation with commercial readiness such that turbine operations were anticipated to commence by 2018. Dominion, as the leaseholder of the Virginia Wind Energy Area (WEA), anticipated leveraging lessons learned through the VOWTAP, and applying them to future commercial-scale offshore wind development.
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
EVALUATING THE EFFICIENCY PROGRESS WITH TECHNOLOGY IN A SPANISH HOTEL CHAIN
Directory of Open Access Journals (Sweden)
Maria del Rosario González-Rodriguez
2015-08-01
Full Text Available This paper analyzes the changes in the total factor productivity index of a Spanish hotel chain in the period from 2007 to 2010 with the purpose of identifying efficiency patterns for the chain in a period of financial crisis. The Data envelopment analysis (DEA Malmquist productivity index was used to estimate productivity change in 38 hotels of the AC chain. Results reveal AC hotels’ efficiency trends and, therefore, their competitiveness in the recession period; they also show the changes experienced in these hotels’ total productivity and its components: technological and efficiency changes. Positive efficiency changes were due to positive technical efficiency rather than technological efficiency. The recession period certainly influenced the performance of AC Hotels, which focused on organizational changes rather than investing in technology.
Lei, Yi; Li, Jianqiang; Fan, Yuting; Yu, Dawei; Fu, Songnian; Yin, Feifei; Dai, Yitang; Xu, Kun
2016-01-01
In this paper, we experimentally demonstrate space-division-multiplexed (SDM) transmission of IEEE 802.11ac-compliant 3-spatial-stream WLAN signals over 3 spatial modes of conventional 50um graded-index (GI) multimode fiber (MMF) employing non-mode-selective 3D-waveguide photonic lantern. Two kinds
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
Nonlinear control of voltage source converters in AC-DC power system.
Dash, P K; Nayak, N
2014-07-01
This paper presents the design of a robust nonlinear controller for a parallel AC-DC power system using a Lyapunov function-based sliding mode control (LYPSMC) strategy. The inputs for the proposed control scheme are the DC voltage and reactive power errors at the converter station and the active and reactive power errors at the inverter station of the voltage-source converter-based high voltage direct current transmission (VSC-HVDC) link. The stability and robust tracking of the system parameters are ensured by applying the Lyapunov direct method. Also the gains of the sliding mode control (SMC) are made adaptive using the stability conditions of the Lyapunov function. The proposed control strategy offers invariant stability to a class of systems having modeling uncertainties due to parameter changes and exogenous inputs. Comprehensive computer simulations are carried out to verify the proposed control scheme under several system disturbances like changes in short-circuit ratio, converter parametric changes, and faults on the converter and inverter buses for single generating system connected to the power grid in a single machine infinite-bus AC-DC network and also for a 3-machine two-area power system. Furthermore, a second order super twisting sliding mode control scheme has been presented in this paper that provides a higher degree of nonlinearity than the LYPSMC and damps faster the converter and inverter voltage and power oscillations. Copyright © 2014 ISA. Published by Elsevier Ltd. All rights reserved.
Lei, Yi; Li, Jianqiang; Fan, Yuting; Yu, Dawei; Fu, Songnian; Yin, Feifei; Dai, Yitang; Xu, Kun
2016-12-12
In this paper, we experimentally demonstrate space-division-multiplexed (SDM) transmission of IEEE 802.11ac-compliant 3-spatial-stream WLAN signals over 3 spatial modes of conventional 50um graded-index (GI) multimode fiber (MMF) employing non-mode-selective 3D-waveguide photonic lantern. Two kinds of scenarios, including fiber-only transmission and fiber-wireless hybrid transmission, were investigated by measuring error vector magnitude (EVM) performance for each stream and condition number (CN) of the channel matrix. The experimental results show that, SDM-based MMF link could offer a CNwireless MIMO signals over existing in-building commercially-available MMFs with enormous cost-saving.
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
2015 Plan. Project 5: transmission systems of electric power
International Nuclear Information System (INIS)
1992-12-01
The planning aspects of transmission system expansion in Brazil are described, mentioning the evolution at long date of the transmission system, emphasizing the qualitative and strategic aspects. The engineering aspects and the technological development are also presented. (C.G.C.)
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
Self-field AC losses and critical currents in multi-tube Ag-Bi-2223 conductors
Energy Technology Data Exchange (ETDEWEB)
Ciszek, M; Ashworth, S P; Campbell, A M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); James, M P; Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); Garre, R; Conti, S [Centro Ricerche Europa Metalli, Fornaci di Barga, LU (Italy)
1996-05-01
The purpose of this work was to investigate the influence of different technological treatments of silver sheathed Bi-2223 tapes on the critical current density and the AC transport losses. The tapes were produced using the 'tube-in-tube' technique, by including a silver rod in the centre of the superconducting powder during packing of the silver tube. The aim of the process is to increase the silver to superconductor surface area and thus also the alignment at the centre of the conductor ceramic core. AC transport losses were measured by means of an electrical method using sinusoidally varying currents in the frequency range 30-180 Hz. In this range the power losses are hysteretic. The measured variation in losses from those predicted by a critical state model is attributed to the complex geometry of superconducting regions existing in these tapes. (author)
Design, control and application of modular multilevel converters for HVDC transmission systems
Sharifabadi, Kamran; Nee, Hans-Peter; Norrga, Staffan; Teodorescu, Remus
2016-01-01
Design, Control and Application of Modular Multilevel Converters for HVDC Transmission Systems is a comprehensive guide to semiconductor technologies applicable for MMC design, component sizing control, modulation, and application of the MMC technology for HVDC transmission. Separated into three distinct parts, the first offers an overview of MMC technology, including information on converter component sizing, Control and Communication, Protection and Fault Management, and Generic Modelling and Simulation. The second covers the applications of MMC in offshore WPP, including planning, technical and economic requirements and optimization options, fault management, dynamic and transient stability. Finally, the third chapter explores the applications of MMC in HVDC transmission and Multi Terminal configurations, including Supergrids.
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
Development of Korea telecommunication technology
International Nuclear Information System (INIS)
1992-06-01
It concentrates on development of Korea telecommunication technology, which is made up seven chapters. It gives description of manual central telephone exchange or private automatic telephone exchange, transmission technology on wire line and cable line technology and optical transmission, radio communication technology on mobile and natural satellite communication, network technology with intelligent network, broadband ISDN and packet switched Data Network, terminal technology with telephone and data communication terminal and development of Information Technology in Korea. It has an appendix about development of military communication system.
Proceedings of the North American transmission and distribution conference
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
This conference profiled new transmission and distribution technologies and solutions designed for electric utility operators. Emerging trends in transmission and distribution systems were reviewed. New directions in energy management were discussed in relation to aging infrastructure and anticipated manpower shortages. Computerized control strategies were described, as well as recent advances in monitoring technologies. Issues related to alternative energy and grid interconnections were also discussed. The conference was divided into the following 6 sections, along with a special session for keynote presentations: (1) cybersecurity panel; (2) equipment and apparatus; (3) asset management and network technologies; (4) business solutions; (5) information technology; and (6) workforce panel. The conference featured 57 presentations, of which 13 have been indexed separately for inclusion in this database. refs., tabs., figs.
Proceedings of the North American transmission and distribution conference
International Nuclear Information System (INIS)
2006-01-01
This conference profiled new transmission and distribution technologies and solutions designed for electric utility operators. Emerging trends in transmission and distribution systems were reviewed. New directions in energy management were discussed in relation to aging infrastructure and anticipated manpower shortages. Computerized control strategies were described, as well as recent advances in monitoring technologies. Issues related to alternative energy and grid interconnections were also discussed. The conference was divided into the following 6 sections, along with a special session for keynote presentations: (1) cybersecurity panel; (2) equipment and apparatus; (3) asset management and network technologies; (4) business solutions; (5) information technology; and (6) workforce panel. The conference featured 57 presentations, of which 13 have been indexed separately for inclusion in this database. refs., tabs., figs
Paksuniemi, M; Sorvoja, H; Alasaarela, E; Myllyla, R
2005-01-01
In the intensive care unit, or during anesthesia, patients are attached to monitors by cables. These cables obstruct nursing staff and hinder the patients from moving freely in the hospital. However, rapidly developing wireless technologies are expected to solve these problems. To this end, this study revealed problem areas in current patient monitoring and established the most important medical parameters to monitor. In addition, usable wireless techniques for short-range data transmission were explored and currently employed wireless applications in the hospital environment were studied. The most important parameters measured of the patient include blood pressures, electrocardiography, respiration rate, heart rate and temperature. Currently used wireless techniques in hospitals are based on the WMTS and WLAN standards. There are no viable solutions for short-range data transmission from patient sensors to patient monitors, but potentially usable techniques in the future are based on the WPAN standards. These techniques include Bluetooth, ZigBee and UWB. Other suitable techniques might be based on capacitive or inductive coupling. The establishing of wireless techniques depends on ensuring the reliability of data transmission, eliminating disturbance by other wireless devices, ensuring patient data security and patient safety, and lowering the power consumption and price.
Directory of Open Access Journals (Sweden)
Tariq Mustafa
Full Text Available The potato psyllid, Bactericera cockerelli (Šulc (Hemiptera: Triozidae, is a vector of the phloem-limited bacterium 'Candidatus Liberibacter solanacearum' (Lso, the putative causal agent of zebra chip disease of potato. Little is known about how potato psyllid transmits Lso to potato. We used electrical penetration graph (EPG technology to compare stylet probing behaviors and efficiency of Lso transmission of three haplotypes of potato psyllid (Central, Western, Northwestern. All haplotypes exhibited the full suite of stylet behaviors identified in previous studies with this psyllid, including intercellular penetration and secretion of the stylet pathway, xylem ingestion, and phloem activities, the latter comprising salivation and ingestion. The three haplotypes exhibited similar frequency and duration of probing behaviors, with the exception of salivation into phloem, which was of higher duration by psyllids of the Western haplotype. We manipulated how long psyllids were allowed access to potato ("inoculation access period", or IAP to examine the relationship between phloem activities and Lso transmission. Between 25 and 30% of psyllids reached and salivated into phloem at an IAP of 1 hr, increasing to almost 80% of psyllids as IAP was increased to 24 h. Probability of Lso-transmission was lower across all IAP levels than probability of phloem salivation, indicating that a percentage of infected psyllids which salivated into the phloem failed to transmit Lso. Logistic regression showed that probability of transmission increased as a function of time spent salivating into the phloem; transmission occurred as quickly as 5 min following onset of salivation. A small percentage of infected psyllids showed extremely long salivation events but nonetheless failed to transmit Lso, for unknown reasons. Information from these studies increases our understanding of Lso transmission by potato psyllid, and demonstrates the value of EPG technology in
A single-phase embedded Z-source DC-AC inverter.
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
Obrien, W. J.
1976-01-01
Two types of lift/cruise fan technology aircraft were conceptually designed. One aircraft used turbotip fans pneumatically interconnected to three gas generators, and the other aircraft used variable pitch fans mechanically interconnected to three turboshaft engines. The components of each propulsion transmission system were analyzed and designed to the depth necessary to determine areas of risk, development methods, performance, weights and costs. The types of materials and manufacturing processes were identified to show that the designs followed a low cost approach. The lift/cruise fan thrust vectoring hoods, which are applicable to either aircraft configuration, were also evaluated to assure a low cost/low risk approach.
Centralized vs decentralized lunar power system study
Metcalf, Kenneth; Harty, Richard B.; Perronne, Gerald E.
1991-09-01
Three power-system options are considered with respect to utilization on a lunar base: the fully centralized option, the fully decentralized option, and a hybrid comprising features of the first two options. Power source, power conditioning, and power transmission are considered separately, and each architecture option is examined with ac and dc distribution, high and low voltage transmission, and buried and suspended cables. Assessments are made on the basis of mass, technological complexity, cost, reliability, and installation complexity, however, a preferred power-system architecture is not proposed. Preferred options include transmission based on ac, transmission voltages of 2000-7000 V with buried high-voltage lines and suspended low-voltage lines. Assessments of the total cost associated with the installations are required to determine the most suitable power system.
HVDC: A key solution in future transmission systems
Energy Technology Data Exchange (ETDEWEB)
Heyman, Olof H.; Weimers, Lars; Bohl, Mie-Lotte
2010-09-15
With the transition of power grids, based on sustainable generation, HVDC is a key technology with new applications. This includes connection of remote wind parks and strengthening of existing AC grids. In addition, traditional applications, such as bulk hydropower transfer and interconnections between regions, play a major role in our transition to sustainable generation and the associated grids. The technology for regional grids with a limited number of nodes is already in place and commercial projects are commissioned. For extensive grids, development and verification are ongoing in parallel to industry standards being discussed in groups such as ENTSO-E and CIGRE.
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
Revising the ACS Guidelines for Chemistry Programs in Two-Year Colleges: Shaping the Next Edition
Clevenger, John V.; Wesemann, Jodi L.
2008-06-01
Much has changed since the second edition of the ACS Guidelines for Chemistry Programs in Two-Year Colleges was prepared in 1997. The roles that two-year college programs can and do play in providing access to and success in higher education are receiving more attention. Increased knowledge on how people learn, advances in technology, and demands for accountability are changing the educational landscape.
Proceedings of the North American Transmission and Distribution Conference and Expo. CD ed.
International Nuclear Information System (INIS)
2005-01-01
This conference provided power suppliers with technology information regarding the transmission and distribution marketplace. It profiled industry solutions, information and education regarding the latest products and technologies to help utility professionals in their design, specifications, planning and reliability efforts. More than 1200 decision makers, suppliers and utility professionals attended the conference, including electrical utility chief executive officers, presidents, operations managers, billing experts, customer care facility managers, system planners, transmission/distribution managers, asset management, system operations management, and engineering consultants. Vendors also demonstrated the latest equipment, software and technology for the transmission and distribution market. Transmission was the focal point of core business activities with emphasis on energy management, new technologies, operations, maintenance, and planning and design. Topics of discussion ranged from load response strategies, metering systems, modernization of large industrial plants for interconnection with utilities, streetlight management systems, improvements to circuit utilization, energy fraud detection, power surge protection, de-icing systems, cyber security, and the Canadian electricity workforce. tabs., figs
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Zhong Chen
2017-08-01
Full Text Available A conventional steady-state power flow security check only implements point-by-point assessment, which cannot provide a security margin for system operation. The concept of a steady-state security region is proposed to effectively tackle this problem. Considering that the commissioning of the increasing number of HVDC (High Voltage Direct Current and the fluctuation of renewable energy have significantly affected the operation and control of a conventional AC system, the definition of the steady-state security region of the AC/DC power system is proposed in this paper based on the AC/DC power flow calculation model including LCC/VSC (Line Commutated Converter/Voltage Sourced Converter-HVDC transmission and various AC/DC constraints, and hence the application of the security region is extended. In order to ensure that the proposed security region can accurately provide global security information of the power system under the fluctuations of renewable energy, this paper presents four methods (i.e., a screening method of effective boundary surfaces, a fitting method of boundary surfaces, a safety judging method, and a calculation method of distances and corrected distance between the steady-state operating point and the effective boundary surfaces based on the relation analysis between the steady-state security region geometry and constraints. Also, the physical meaning and probability analysis of the corrected distance are presented. Finally, a case study is demonstrated to test the feasibility of the proposed methods.
[Transmission efficiency analysis of near-field fiber probe using FDTD simulation].
Huang, Wei; Dai, Song-Tao; Wang, Huai-Yu; Zhou, Yun-Song
2011-10-01
A fiber probe is the key component of near-field optical technology which is widely used in high resolution imaging, spectroscopy detection and nano processing. How to improve the transmission efficiency of the fiber probe is a very important problem in the application of near-field optical technology. Based on the results of 3D-FDTD computation, the dependence of the transmission efficiency on the cone angle, the aperture diameter, the wavelength and the thickness of metal cladding is revealed. The authors have also made a comparison between naked probe and the probe with metal cladding in terms of transmission efficiency and spatial resolution. In addition, the authors have discovered the fluctuation phenomena of transmission efficiency as the wavelength of incident laser increases.
A study on the wireless transmission characteristic in the deep underground
International Nuclear Information System (INIS)
Takamura, Hisashi; Okutsu, Kazuo; Sugahara, Norihisa; Torata, Shinichiro; Ohuchi, Jin
2006-01-01
A wireless transmission technology uses a low frequency electromagnetic wave (100[Hz] - 10[kHz]) as a carrier wave to transmit signals in the deep underground geological condition. However, this electromagnetic wave has not been used so much, because the transmission capacity is less than a high frequency electromagnetic wave, which is used to televisions and cellular phones. On the other hand, the wireless transmission technology that doesn't use the cable is considered to be useful in the radioactive waste disposal repository from the viewpoint of decreasing the influence on the barrier. This paper shows the characteristics of the wireless transmission in the granite on the basis of the in situ testing implemented in the Aespoe Hard Rock Laboratory of SKB. (author)
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
Full Scale Test on a 100km, 150kV AC Cable
DEFF Research Database (Denmark)
Faria da Silva, Filipe Farria; Wiechowski, W.; Bak, Claus Leth
2010-01-01
phenomena is conducted. The cases analysed in this paper are: Zero-missing phenomenon, Ferranti effect, energisation transient, effect of the cable's connection in the busbar voltage and cable disconnection. For all the phenomena described in the paper measurement data are presented and it is verified......This paper presents some of the results obtained from the electrical measurements on a 99.7 km, 150 kV three-phase AC cable, connecting 215 MW offshore wind farm Horns Rev 2, located in Denmark west coast, to Denmark's 400 kV transmission network. The measurements were performed at nominal voltage...... if the obtained results are in accordance with the theory and also with simulations performed in PSCAD/EMTDC. With the exception of the cable disconnection, for all the remaining cases introduced in this paper the measurements confirmed the theoretical expectations. Depending on the cable disconnection sequence...
Evaluating the merchant transmission market
International Nuclear Information System (INIS)
Hsieh, E.; Bartholomew Fisher, E.
2007-01-01
This paper reviewed the North American bulk electric transmission system, with particular reference to the following merchant power transmission projects that have applied to sell transmission at negotiated rates by the Federal Energy Regulatory Commission (FERC): Cross Sound Cable; Neptune Phase 1; TransCanada's Northern Lights HVDC line; Montana Alberta Tie; Juan de Fuca Cable; Linden VFT; Connecticut-Long Island Cable; Lake Erie Link; Empire Connection; Harbor Cable; Chesapeake Transmission; and the Neptune/Green Line. The projects were sorted by status as either active, inactive and restructured. Each summary included the interconnection points, capacity, and sponsor. This paper also identified the major hurdles in their approvals. The relative success of the merchant transmission framework in attracting new investment was then reviewed. The successful projects shared 3 common attributes. They connected areas with large price differentials and they used advanced flow control technology such as HVDC, PARs, and VFTs. The successful projects also bridged some type of border, either geographic, electrical, economic, or a combination. Three of the active projects crossed the Canadian-US border, while the other 3 connected New York City to neighbouring regions. It was shown that merchant transmission fills a niche, enabling market responses to connect areas that may be overlooked by a regional planning process. 27 refs
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
Insulation coordination workstation for AC and DC substations
International Nuclear Information System (INIS)
Booth, R.R.; Hileman, A.R.
1990-01-01
The Insulation Coordination Workstation was designed to aid the substation design engineer in the insulation coordination process. The workstation utilizes state of the art computer technology to present a set of tools necessary for substation insulation coordination, and to support the decision making process for all aspects of insulation coordination. The workstation is currently being developed for personal computers supporting OS/2 Presentation Manager. Modern Computer-Aided Software Engineering (CASE) technology was utilized to create an easily expandable framework which currently consists of four modules, each accessing a central application database. The heart of the workstation is a library of user-friendly application programs for the calculation of important voltage stresses used for the evaluation of insulation coordination. The Oneline Diagram is a graphic interface for data entry into the EPRI distributed EMTP program, which allows the creation of complex systems on the CRT screen using simple mouse clicks and keyboard entries. Station shielding is graphically represented in the Geographic Viewport using a three-dimensional substation model, and the interactive plotting package allows plotting of EPRI EMTP output results on the CRT screen, printer, or pen plotter. The Insulation Coordination Workstation was designed by Advanced Systems Technology (AST), a division of ABB Power Systems, Inc., and sponsored by the Electric Power Research Institute under RP 2323-5, AC/DC Insulation Coordination Workstation
EFFECTS OF UNIFIED POWER FLOW CONTROLLER (UPFC) ON ...
African Journals Online (AJOL)
eobe
2015-10-04
Oct 4, 2015 ... environment of Power System Computer Aided Design (PSCAD) and kept within the environment of ... operating characteristic of a mho distance relay, also known as ..... Concept and Technology of AC Transmission. System”.
7 CFR 1737.31 - Area Coverage Survey (ACS).
2010-01-01
... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...
Energy Technology Data Exchange (ETDEWEB)
Heifetz, A. [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Bakhtiari, S. [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Huang, X. [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Ponciroli, R. [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Vilim, R. B. [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division
2017-09-30
The objective of this project is to develop and demonstrate methods for transmission of information in nuclear facilities by acoustic means along existing in-place metal piping infrastructure. Pipes are omnipresent in a nuclear facility, and penetrate enclosures and partitions, such as the containment building wall. In the envisioned acoustic communication (AC) system, packets of information will be transmitted as guided acoustic waves along pipes. Performance of AC hardware and network protocols for efficient and secure communications under development in this project will be eventually evaluated in a representative nuclear power plant environment. Research efforts in the first year of this project have been focused on identification of appropriate transducers, and evaluation of their performance for information transmission along nuclear-grade metallic pipes. COMSOL computer simulations were performed to study acoustic wave generation, propagation, and attenuation on pipes. An experimental benchtop system was used to evaluate signal attenuation and spectral dispersion using piezo-electric transducers (PZTs) and electromagnetic acoustic transducers (EMATs). Communication protocols under evaluation consisted on-off keying (OOK) signal modulation, in particular amplitude shift keying (ASK) and phase shift keying (PSK). Tradeoffs between signal power and communication data rate were considered for ASK and PSK coding schemes.
Enhancing learning with technology
Specht, Marcus; Klemke, Roland
2013-01-01
Specht, M., & Klemke, R. (2013, 26-27 September). Enhancing Learning with Technology. In D. Milosevic (Ed.), Proceedings of the fourth international conference on eLearning (eLearning 2013) (pp. 37-45). Belgrade Metropolitan University, Belgrade, Serbia. http://econference.metropolitan.ac.rs/
Application of WebSphere MQ in data transmission of retail system
Directory of Open Access Journals (Sweden)
Ma Yue
2017-02-01
Full Text Available Considering the requirements of enterprise data communication system functions,this article uses WebSphere message queue (MQ technology to ensure effective data transmission for large amount of commercial files.Taking daily sales data transmission between foreground and background as example,we design and realize the typical retail data transmission function.
Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers
Directory of Open Access Journals (Sweden)
Abdul Sattar Larik
2011-01-01
Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.
Particle Agglomeration in Bipolar Barb Agglomerator Under AC Electric Field
Huang, Chao; Ma, Xiuqin; Sun, Youshan; Wang, Meiyan; Zhang, Changping; Lou, Yueya
2015-04-01
The development of an efficient technology for removing fine particles in flue gas is essential as the haze is becoming more and more serious. To improve agglomeration effectiveness of fine particles, a dual zone electric agglomeration device consisting of a charging chamber and an agglomeration chamber with bipolar barb electrodes was developed. The bipolar barb electric agglomerator with a polar distance of 200 mm demonstrates good agglomeration effectiveness for particles with a size less than 8.0 μm under applied AC electric field. An optimal condition for achieving better agglomeration effectiveness was found to be as follows: flue gas flow velocity of 3.00 m/s, particle concentration of 2.00 g/m3, output voltage of 35 kV and length of the barb of 16 mm. In addition, 4.0-6.0 μm particles have the best effectiveness with the variation of particle volume occupancy of -3.2. supported by the Key Technology R&D Program of Hebei, China (No. 13211207D)
Fuzzy-Wavelet Based Double Line Transmission System Protection Scheme in the Presence of SVC
Goli, Ravikumar; Shaik, Abdul Gafoor; Tulasi Ram, Sankara S.
2015-06-01
Increasing the power transfer capability and efficient utilization of available transmission lines, improving the power system controllability and stability, power oscillation damping and voltage compensation have made strides and created Flexible AC Transmission (FACTS) devices in recent decades. Shunt FACTS devices can have adverse effects on distance protection both in steady state and transient periods. Severe under reaching is the most important problem of relay which is caused by current injection at the point of connection to the system. Current absorption of compensator leads to overreach of relay. This work presents an efficient method based on wavelet transforms, fault detection, classification and location using Fuzzy logic technique which is almost independent of fault impedance, fault distance and fault inception angle. The proposed protection scheme is found to be fast, reliable and accurate for various types of faults on transmission lines with and without Static Var compensator at different locations and with various incidence angles.
Importance of Attenuation Correction (AC) for Small Animal PET Imaging
DEFF Research Database (Denmark)
El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær
2012-01-01
was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...
THE ACS NEARBY GALAXY SURVEY TREASURY
International Nuclear Information System (INIS)
Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.
2009-01-01
The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
Mustafa, Tariq; Horton, David R.; Cooper, W. Rodney; Swisher, Kylie D.; Zack, Richard S.; Pappu, Hanu R.; Munyaneza, Joseph E.
2015-01-01
The potato psyllid, Bactericera cockerelli (Šulc) (Hemiptera: Triozidae), is a vector of the phloem-limited bacterium ‘Candidatus Liberibacter solanacearum’ (Lso), the putative causal agent of zebra chip disease of potato. Little is known about how potato psyllid transmits Lso to potato. We used electrical penetration graph (EPG) technology to compare stylet probing behaviors and efficiency of Lso transmission of three haplotypes of potato psyllid (Central, Western, Northwestern). All haplotypes exhibited the full suite of stylet behaviors identified in previous studies with this psyllid, including intercellular penetration and secretion of the stylet pathway, xylem ingestion, and phloem activities, the latter comprising salivation and ingestion. The three haplotypes exhibited similar frequency and duration of probing behaviors, with the exception of salivation into phloem, which was of higher duration by psyllids of the Western haplotype. We manipulated how long psyllids were allowed access to potato (“inoculation access period”, or IAP) to examine the relationship between phloem activities and Lso transmission. Between 25 and 30% of psyllids reached and salivated into phloem at an IAP of 1 hr, increasing to almost 80% of psyllids as IAP was increased to 24 h. Probability of Lso-transmission was lower across all IAP levels than probability of phloem salivation, indicating that a percentage of infected psyllids which salivated into the phloem failed to transmit Lso. Logistic regression showed that probability of transmission increased as a function of time spent salivating into the phloem; transmission occurred as quickly as 5 min following onset of salivation. A small percentage of infected psyllids showed extremely long salivation events but nonetheless failed to transmit Lso, for unknown reasons. Information from these studies increases our understanding of Lso transmission by potato psyllid, and demonstrates the value of EPG technology in exploring
2018-01-01
NORTH ATLANTIC TREATY ORGANIZATION SCIENCE AND TECHNOLOGY ORGANIZATION AC/323(MSG-098)TP/740 www.sto.nato.int STO TECHNICAL...REPORT TR-MSG-098 Urban Combat Advanced Training Technology Architecture (Architecture de technologie avancée pour l’entraînement au combat urbain...NORTH ATLANTIC TREATY ORGANIZATION SCIENCE AND TECHNOLOGY ORGANIZATION AC/323(MSG-098)TP/740 www.sto.nato.int STO TECHNICAL
Design, Control and Application of Modular Multilevel Converters for HVDC Transmission Systems
DEFF Research Database (Denmark)
Sharifabadi, Kamran; Harnefors, Lennart; Nee, Hans-Peter
distinct parts, the first offers an overview of MMC technology, including information on converter component sizing, Control and Communication, Protection and Fault Management, and Generic Modelling and Simulation. The second covers the applications of MMC in offshore WPP, including planning, technical......Design, Control and Application of Modular Multilevel Converters for HVDC Transmission Systems is a comprehensive guide to semiconductor technologies applicable for MMC design, component sizing control, modulation, and application of the MMC technology for HVDC transmission. Separated into three...
Scaling and universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, Jeppe
2000-01-01
Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...
Andrianov, M. N.; Kostenko, V. I.; Likhachev, S. F.
2018-01-01
The algorithms for achieving a practical increase in the rate of data transmission on the space-craft-ground tracking station line has been considered. This increase is achieved by applying spectral-effective modulation techniques, the technology of orthogonal frequency compression of signals using millimeterrange radio waves. The advantages and disadvantages of each of three algorithms have been revealed. A significant advantage of data transmission in the millimeter range has been indicated.
Directory of Open Access Journals (Sweden)
Mukherjee Sunil K
2010-06-01
Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.
Preliminary study on AC superconducting machines
International Nuclear Information System (INIS)
Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.
1988-01-01
This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed
21 CFR 880.5500 - AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...
Cooperative Frequency Control for Autonomous AC Microgrids
DEFF Research Database (Denmark)
Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.
2015-01-01
Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
AC power flow importance measures considering multi-element failures
International Nuclear Information System (INIS)
Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling
2017-01-01
Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.
Assessment and modelling of switching technologies for application in HVDC-circuit breakers
Lund, Johan
2011-01-01
A key element for future DC-grids is a DC circuit breaker that in case of a short circuit fault reliably can turn off a short circuit current. AC circuit breakers are well known components that has been in use for a long time in AC-grids. The AC circuit breaker is designed to interrupt the current at its natural current zero crossings. In DC grids such does not exists, therefore AC breakers can not be directly applied in DC grids. Different concepts and technologies to solve this problem is a...
Transmission and wind investment in a deregulated electricity industry
DEFF Research Database (Denmark)
Maurovich-Horvat, Lajos; Boomsma, Trine Krogh; Siddiqui, Afzal S.
2015-01-01
Adoption of dispersed renewable energy technologies requires transmission network expansion. Besides the transmission system operator (TSO), restructuring of electricity industries has introduced a merchant investor (MI), who earns congestion rents from constructing new lines. We compare these tw...... proportion of energy is produced by wind. In effect, withholding of generation capacity by producers prompts more transmission investment since the TSO aims to increase welfare by subsidizing wind and the MI creates more flow to maximize profit....
Systémový pohled na klub AC Sparta
Čečák, František
2015-01-01
Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Aragonite coating solutions (ACS) based on artificial seawater
Tas, A. Cuneyt
2015-03-01
Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org
2002-12-01
The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.
Jeong, Jeong-Won; Shin, Dae C; Do, Synho; Marmarelis, Vasilis Z
2006-08-01
This paper presents a novel segmentation methodology for automated classification and differentiation of soft tissues using multiband data obtained with the newly developed system of high-resolution ultrasonic transmission tomography (HUTT) for imaging biological organs. This methodology extends and combines two existing approaches: the L-level set active contour (AC) segmentation approach and the agglomerative hierarchical kappa-means approach for unsupervised clustering (UC). To prevent the trapping of the current iterative minimization AC algorithm in a local minimum, we introduce a multiresolution approach that applies the level set functions at successively increasing resolutions of the image data. The resulting AC clusters are subsequently rearranged by the UC algorithm that seeks the optimal set of clusters yielding the minimum within-cluster distances in the feature space. The presented results from Monte Carlo simulations and experimental animal-tissue data demonstrate that the proposed methodology outperforms other existing methods without depending on heuristic parameters and provides a reliable means for soft tissue differentiation in HUTT images.
Analog signals transmission of up to 100 khz though optical fiber
International Nuclear Information System (INIS)
Cremy, C.
1996-12-01
Around TJ-II device, potential problems may arise as a consequence of an adverse electromagnetic environment, presence of strong DC and AC currents, motors, coils, power supplies, magnetic fields and so on. Consequently, signal transmission towards monitoring or data acquisition systems may be affected due to induced noise, ground loops and other undesirable effects. Trying to avoid such problems, signals may be translated in a proper way in order to be routed through optical fiber. The present report shows a method to solve the difficulty, by means of a galvanic isolation between the signal source and the measurement circuit. (Author)
Influence of AC system design on the realisation of tractive efforts by high adhesion locomotives
Spiryagin, Maksym; Wolfs, Peter; Cole, Colin; Stichel, Sebastian; Berg, Mats; Manfred, Plöchl
2017-08-01
The main task for heavy haul railway operators is to reduce the cost of exported minerals and enhance the long-term viability of rail transport operations through increasing productivity by running longer and heavier trains. The common opinion is that this is achievable by means of implementation of high adhesion locomotives with advanced AC traction technologies. Modern AC high adhesion locomotives are very complex mechatronic systems and can be designed with two alternative traction topologies of either bogie or individual axle controls. This paper describes a modelling approach for these two types of AC traction systems with the application of an advanced co-simulation methodology, where an electrical system and a traction algorithm are modelled in Matlab/Simulink, and a mechanical system is modelled in a multibody software package. Although the paper concentrates on the analysis of the functioning for these two types of traction control systems, the choice of reference slip values also has an influence on the performance of both systems. All these design variations and issues have been simulated for various adhesion conditions at the wheel-rail interface and their influence on the high traction performance of a locomotive equipped with two three-axle bogies has been discussed.
Systémový pohled na klub AC Sparta
Čečák, František
2014-01-01
Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...
Storage, transmission and distribution of hydrogen
Kelley, J. H.; Hagler, R., Jr.
1979-01-01
Current practices and future requirements for the storage, transmission and distribution of hydrogen are reviewed in order to identify inadequacies to be corrected before hydrogen can achieve its full potential as a substitute for fossil fuels. Consideration is given to the storage of hydrogen in underground solution-mined salt caverns, portable high-pressure containers and dewars, pressure vessels and aquifers and as metal hydrides, hydrogen transmission in evacuated double-walled insulated containers and by pipeline, and distribution by truck and internal distribution networks. Areas for the improvement of these techniques are indicated, and these technological deficiencies, including materials development, low-cost storage and transmission methods, low-cost, long-life metal hydrides and novel methods for hydrogen storage, are presented as challenges for research and development.
Fradi, Aniss
The ability to allocate the active power (MW) loading on transmission lines and transformers, is the basis of the "flow based" transmission allocation system developed by the North American Electric Reliability Council. In such a system, the active power flows must be allocated to each line or transformer in proportion to the active power being transmitted by each transaction imposed on the system. Currently, this is accomplished through the use of the linear Power Transfer Distribution Factors (PTDFs). Unfortunately, no linear allocation models exist for other energy transmission quantities, such as MW and MVAR losses, MVAR and MVA flows, etc. Early allocation schemes were developed to allocate MW losses due to transactions to branches in a transmission system, however they exhibited diminished accuracy, since most of them are based on linear power flow modeling of the transmission system. This thesis presents a new methodology to calculate Energy Transaction Allocation factors (ETA factors, or eta factors), using the well-known process of integration of a first derivative function, as well as consistent and well-established mathematical and AC power flow models. The factors give a highly accurate allocation of any non-linear system quantity to transactions placed on the transmission system. The thesis also extends the new ETA factors calculation procedure to restructure a new economic dispatch scheme where multiple sets of generators are economically dispatched to meet their corresponding load and their share of the losses.
Wheeling and transmission system service policy in North America
International Nuclear Information System (INIS)
Casazza, J.A.; Schultz, A.J.; Limmer, H.D.
1991-01-01
This paper provides a review and discussion of the status of wheeling in the USA and Canada; the pros and cons of the new policies that are evolving and under consideration for wheeling and transmission access; specific case examples of some of the difficulties that have arisen; and the potential for new transmission technology. (author)
Analysis of Power Network for Line Reactance Variation to Improve Total Transmission Capacity
Directory of Open Access Journals (Sweden)
Ikram Ullah
2016-11-01
Full Text Available The increasing growth in power demand and the penetration of renewable distributed generations in competitive electricity market demands large and flexible capacity from the transmission grid to reduce transmission bottlenecks. The bottlenecks cause transmission congestion, reliability problems, restrict competition, and limit the maximum dispatch of low cost generations in the network. The electricity system requires efficient utilization of the current transmission capability to improve the Available Transfer Capability (ATC. To improve the ATC, power flow among the lines can be managed by using Flexible AC Transmission System (FACTS devices as power flow controllers, which alter the parameters of power lines. It is important to place FACTS devices on suitable lines to vary the reactance for improving Total Transmission Capacity (TTC of the network and provide flexibility in the power flow. In this paper a transmission network is analyzed based on line parameters variation to improve TTC of the interconnected system. Lines are selected for placing FACTS devices based on real power flow Performance Index (PI sensitivity factors. TTC is computed using the Repeated Power Flow (RPF method using the constraints of lines thermal limits, bus voltage limits and generator limits. The reactance of suitable lines, selected on the basis of PI sensitivity factors are changed to divert the power flow to other lines with enough transfer capacity available. The improvement of TTC using line reactance variation is demonstrated with three IEEE test systems with multi-area networks. The results show the variation of the selected lines’ reactance in improving TTC for all the test networks with defined contingency cases.
Mapa acústico parcial de Benetusser
MORILLA CASTELLANOS, EMILIO
2012-01-01
Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-05-01
The development of a superconduction circuit designing and manufacturing technology has achieved the following results: with respect to designing a circuit for single flux quantum (SFQ), the 'high-speed high-accuracy AC converter for front end of software radio' was selected as the target for a prototype to demonstrate the performance of the SFQ circuit. In analyzing movements of different SFQ basic circuits, such circuit simulator software versions were introduced as Saber, WR-SPICE, Wins, and Microcap, different motion waveforms for basic theoretical circuits were derived to compare their performances, and the effectiveness was verified respectively. In trial fabrication of a small demonstration circuit, design parameters were acquired from SQUID. In developing the technology to measure superconduction circuit characteristics, the following results were obtained: with regard to the element measuring and evaluating technology, an in-plane distribution measuring device was started up; and with respect to the circuit characteristics measuring and evaluating technology, a measuring system with low noise and low magnetic field was introduced. Regarding the circuit high-speed characteristics evaluating technology, development was made on a micro-strip line and coplanar transmission route converter. (NEDO)
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-05-01
The development of a superconduction circuit designing and manufacturing technology has achieved the following results: with respect to designing a circuit for single flux quantum (SFQ), the 'high-speed high-accuracy AC converter for front end of software radio' was selected as the target for a prototype to demonstrate the performance of the SFQ circuit. In analyzing movements of different SFQ basic circuits, such circuit simulator software versions were introduced as Saber, WR-SPICE, Wins, and Microcap, different motion waveforms for basic theoretical circuits were derived to compare their performances, and the effectiveness was verified respectively. In trial fabrication of a small demonstration circuit, design parameters were acquired from SQUID. In developing the technology to measure superconduction circuit characteristics, the following results were obtained: with regard to the element measuring and evaluating technology, an in-plane distribution measuring device was started up; and with respect to the circuit characteristics measuring and evaluating technology, a measuring system with low noise and low magnetic field was introduced. Regarding the circuit high-speed characteristics evaluating technology, development was made on a micro-strip line and coplanar transmission route converter. (NEDO)
DEFF Research Database (Denmark)
Liu, Xiong; Wang, Peng; Loh, Poh Chiang
2011-01-01
This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...
AC conductivity of a quantum Hall line junction
International Nuclear Information System (INIS)
Agarwal, Amit; Sen, Diptiman
2009-01-01
We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.
International Nuclear Information System (INIS)
King, D.S.; Cox, A.N.; Hodson, S.W.
1975-01-01
Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)
ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus
International Nuclear Information System (INIS)
Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi
2007-01-01
orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae
Ge, LinQuan; Gu, HaoTian; Huang, Bo; Song, Qisheng; Stanley, David; Liu, Fang; Yang, Guo-Qing; Wu, Jin-Cai
2017-01-01
The cAMP/PKA intracellular signaling pathway is launched by adenylyl cyclase (AC) conversion of adenosine triphosphate (ATP) to 3', 5'-cyclic AMP (cAMP) and cAMP-dependent activation of PKA. Although this pathway is very well known in insect physiology, there is little to no information on it in some very small pest insects, such as the brown planthopper (BPH), Nilaparvata lugens Stål. BPH is a destructive pest responsible for tremendous crop losses in rice cropping systems. We are investigating the potentials of novel pest management technologies from RNA interference perspective. Based on analysis of transcriptomic data, the BPH AC like-9 gene (NlAC9) was up-regulated in post-mating females, which led us to pose the hypothesis that NlAC9 is a target gene that would lead to reduced BPH fitness and populations. Targeting NlAC9 led to substantially decreased soluble ovarian protein content, yeast-like symbiont abundance, and vitellogenin gene expression, accompanied with stunted ovarian development and body size. Eggs laid were decreased and oviposition period shortened. Taken together, our findings indicated that NlAC9 exerted pronounced effects on female fecundity, growth and longevity, which strongly supports our hypothesis.
Directory of Open Access Journals (Sweden)
LinQuan Ge
Full Text Available The cAMP/PKA intracellular signaling pathway is launched by adenylyl cyclase (AC conversion of adenosine triphosphate (ATP to 3', 5'-cyclic AMP (cAMP and cAMP-dependent activation of PKA. Although this pathway is very well known in insect physiology, there is little to no information on it in some very small pest insects, such as the brown planthopper (BPH, Nilaparvata lugens Stål. BPH is a destructive pest responsible for tremendous crop losses in rice cropping systems. We are investigating the potentials of novel pest management technologies from RNA interference perspective. Based on analysis of transcriptomic data, the BPH AC like-9 gene (NlAC9 was up-regulated in post-mating females, which led us to pose the hypothesis that NlAC9 is a target gene that would lead to reduced BPH fitness and populations. Targeting NlAC9 led to substantially decreased soluble ovarian protein content, yeast-like symbiont abundance, and vitellogenin gene expression, accompanied with stunted ovarian development and body size. Eggs laid were decreased and oviposition period shortened. Taken together, our findings indicated that NlAC9 exerted pronounced effects on female fecundity, growth and longevity, which strongly supports our hypothesis.
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
Detection of Genetic Modification 'ac2' in Potato Foodstuffs
Directory of Open Access Journals (Sweden)
Petr Kralik
2009-01-01
Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.
Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk
2015-01-01
An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493
An analysis of environmental data transmission
Yuan, Lina; Chen, Huajun; Gong, Jing
2017-05-01
To comprehensively construct environmental automatic monitoring has become the urgent need of environmental management, is a major measure to implement the scientific outlook on development and build a harmonious socialist society, and is an inevitable choice of “building a resource-conserving and environment-friendly society”, which is of great importance and profound significance to adjust the economic structure and transform growth pattern. This article first introduces the importance of environmental data transmission, then expounds the characteristics, key technologies, transmitting mode, and design ideas of environmental data transmission process, and finally, summarizes the full text.
Estimation of the Thurstonian model for the 2-AC protocol
DEFF Research Database (Denmark)
Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.
2012-01-01
. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...
System and method for determining stator winding resistance in an AC motor
Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI
2011-05-31
A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.
Lamin A/C might be involved in the EMT signalling pathway.
Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu
2018-07-15
We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.
Assessing the impact of new technology on complex sociotechnical systems
CSIR Research Space (South Africa)
Oosthuizen, R
2016-08-01
Full Text Available , South Africa roosthuizen@csir.co.za Department of Engineering and Technology Management University of Pretoria, South Africa Leon.Pretorius@up.ac.za ABSTRACT In complex sociotechnical systems, cognitive and social humans use technology...
Energy Technology Data Exchange (ETDEWEB)
Rivas, Elena [ed.; Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)
1999-07-01
At the moment one looks for the application of the superconductivity in the generation, transformation, transmission and storage of electrical energy. In this article recent technologies are briefly described , their advantages and their effects on the transmission and distribution networks. In some cases specific reference is made of the effect that they will have in Mexico. [Spanish] Actualmente se busca la aplicacion de la superconductividad en la generacion, transformacion, transmision y almacenamiento de energia eletrica. En este articulo se describen brevemente tecnologias recientes, sus ventajas y sus efectos sobre las redes de transmision y distribucion. En algunos casos se hace referencia especifica al efecto que tendran en Mexico.
Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids
DEFF Research Database (Denmark)
Chiang Loh, Poh; Li, Ding; Kang Chai, Yi
2013-01-01
sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...
Energy Technology Data Exchange (ETDEWEB)
Karaagac, U.; Mahseredjian, J.; Saad, H. [Ecole Polytechnique de Montreal, QC (Canada); Jensen, S.; Cai, L. [REpower Systems AG, Hamburg (Germany)
2012-07-01
The fault ride-through (FRT) performance of offshore wind farms (OWFs) is a challenging task when the OWF is connected to the onshore ac grid through a voltage source converter (VSC) based HVDC transmission system. The injected power from the OWF cannot be reduced by the offshore VSC during onshore ac faults and this causes a fast increase in the dc network voltage. Without any special FRT method, the dc network voltage may increase up to intolerable levels and cause operation of dc overvoltage protection. This paper compares various FRT methods based on fast reduction of power generation in OWFs. In addition, this paper proposes an improved FRT method based on controlled voltage drop for output power reduction in OWFs. The proposed improvement reduces mechanical stress on the wind turbine (WT) drive train, and electrical stress on the insulated gate bipolar transistors (IGBTs) of the HVDC and doubly-fed induction generator (DFIG) converters. Practical onshore ac fault scenarios are simulated for an OWF composed of DFIG type WTs and connected to a practical ac grid through a point-to-point modular multilevel converter (MMC) based HVDC system. (orig.)
Directory of Open Access Journals (Sweden)
Glebov V.V.
2017-05-01
Full Text Available The article gives an estimation of possible using the hybrid electromechanical transmission performed as a series circuit in tracked vehicle of 50-tonnes weight category using the series-manufactured components of hybrid electric drive system. As components of electric drive (motor-generators and traction electric motors it is invited to use AC induction motors with squirrel-cage rotor, that has no moving contacts and can work both in motor and generator modes, and energy storage buffer is made on the basis of consecutively connected Lithium-ion batteries.
Offline detection of broken rotor bars in AC induction motors
Powers, Craig Stephen
ABSTRACT. OFFLINE DETECTION OF BROKEN ROTOR BARS IN AC INDUCTION MOTORS. The detection of the broken rotor bar defect in medium- and large-sized AC induction machines is currently one of the most difficult tasks for the motor condition and monitoring industry. If a broken rotor bar defect goes undetected, it can cause a catastrophic failure of an expensive machine. If a broken rotor bar defect is falsely determined, it wastes time and money to physically tear down and inspect the machine only to find an incorrect diagnosis. Previous work in 2009 at Baker/SKF-USA in collaboration with the Korea University has developed a prototype instrument that has been highly successful in correctly detecting the broken rotor bar defect in ACIMs where other methods have failed. Dr. Sang Bin and his students at the Korea University have been using this prototype instrument to help the industry save money in the successful detection of the BRB defect. A review of the current state of motor conditioning and monitoring technology for detecting the broken rotor bar defect in ACIMs shows improved detection of this fault is still relevant. An analysis of previous work in the creation of this prototype instrument leads into the refactoring of the software and hardware into something more deployable, cost effective and commercially viable.
The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology
Directory of Open Access Journals (Sweden)
Anja Pahor
2018-01-01
Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.
Design of the ITER Electron Cyclotron Heating and Current Drive Waveguide Transmission Line
Bigelow, T. S.; Rasmussen, D. A.; Shapiro, M. A.; Sirigiri, J. R.; Temkin, R. J.; Grunloh, H.; Koliner, J.
2007-11-01
The ITER ECH transmission line system is designed to deliver the power, from twenty-four 1 MW 170 GHz gyrotrons and three 1 MW 127.5 GHz gyrotrons, to the equatorial and upper launchers. The performance requirements, initial design of components and layout between the gyrotrons and the launchers is underway. Similar 63.5 mm ID corrugated waveguide systems have been built and installed on several fusion experiments; however, none have operated at the high frequency and long-pulse required for ITER. Prototype components are being tested at low power to estimate ohmic and mode conversion losses. In order to develop and qualify the ITER components prior to procurement of the full set of 24 transmission lines, a 170 GHz high power test of a complete prototype transmission line is planned. Testing of the transmission line at 1-2 MW can be performed with a modest power (˜0.5 MW) tube with a low loss (10-20%) resonant ring configuration. A 140 GHz long pulse, 400 kW gyrotron will be used in the initial tests and a 170 GHz gyrotron will be used when it becomes available. Oak Ridge National Laboratory, managed by UT-Battelle, LLC, for the U.S. Dept. of Energy under contract DE-AC05-00OR22725.
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
SMS-Based Medical Diagnostic Telemetry Data Transmission Protocol for Medical Sensors
Townsend, Ben; Abawajy, Jemal; Kim, Tai-Hoon
2011-01-01
People with special medical monitoring needs can, these days, be sent home and remotely monitored through the use of data logging medical sensors and a transmission base-station. While this can improve quality of life by allowing the patient to spend most of their time at home, most current technologies rely on hardwired landline technology or expensive mobile data transmissions to transmit data to a medical facility. The aim of this paper is to investigate and develop an approach to increase...
Nuclear structure of {sup 231}Ac
Energy Technology Data Exchange (ETDEWEB)
Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)
2008-10-15
The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.
Statistical time lags in ac discharges
International Nuclear Information System (INIS)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F
2011-01-01
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Statistical time lags in ac discharges
Energy Technology Data Exchange (ETDEWEB)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)
2011-04-06
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Force transmissibility versus displacement transmissibility
Lage, Y. E.; Neves, M. M.; Maia, N. M. M.; Tcherniak, D.
2014-10-01
It is well-known that when a single-degree-of-freedom (sdof) system is excited by a continuous motion of the foundation, the force transmissibility, relating the force transmitted to the foundation to the applied force, equals the displacement transmissibility. Recent developments in the generalization of the transmissibility to multiple-degree-of-freedom (mdof) systems have shown that similar simple and direct relations between both types of transmissibility do not appear naturally from the definitions, as happens in the sdof case. In this paper, the authors present their studies on the conditions under which it is possible to establish a relation between force transmissibility and displacement transmissibility for mdof systems. As far as the authors are aware, such a relation is not currently found in the literature, which is justified by being based on recent developments in the transmissibility concept for mdof systems. Indeed, it does not appear naturally, but the authors observed that the needed link is present when the displacement transmissibility is obtained between the same coordinates where the applied and reaction forces are considered in the force transmissibility case; this implies that the boundary conditions are not exactly the same and instead follow some rules. This work presents a formal derivation of the explicit relation between the force and displacement transmissibilities for mdof systems, and discusses its potential and limitations. The authors show that it is possible to obtain the displacement transmissibility from measured forces, and the force transmissibility from measured displacements, opening new perspectives, for example, in the identification of applied or transmitted forces. With this novel relation, it becomes possible, for example, to estimate the force transmissibility matrix with the structure off its supports, in free boundary conditions, and without measuring the forces. As far as force identification is concerned, this
a.c. conductance study of polycrystal C60
International Nuclear Information System (INIS)
Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin
1995-01-01
The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))
SMS-Based Medical Diagnostic Telemetry Data Transmission Protocol for Medical Sensors
Townsend, Ben; Abawajy, Jemal; Kim, Tai-Hoon
2011-01-01
People with special medical monitoring needs can, these days, be sent home and remotely monitored through the use of data logging medical sensors and a transmission base-station. While this can improve quality of life by allowing the patient to spend most of their time at home, most current technologies rely on hardwired landline technology or expensive mobile data transmissions to transmit data to a medical facility. The aim of this paper is to investigate and develop an approach to increase the freedom of a monitored patient and decrease costs by utilising mobile technologies and SMS messaging to transmit data from patient to medico. To this end, we evaluated the capabilities of SMS and propose a generic communications protocol which can work within the constraints of the SMS format, but provide the necessary redundancy and robustness to be used for the transmission of non-critical medical telemetry from data logging medical sensors. PMID:22163845
SMS-Based Medical Diagnostic Telemetry Data Transmission Protocol for Medical Sensors
Directory of Open Access Journals (Sweden)
Tai-Hoon Kim
2011-04-01
Full Text Available People with special medical monitoring needs can, these days, be sent home and remotely monitored through the use of data logging medical sensors and a transmission base-station. While this can improve quality of life by allowing the patient to spend most of their time at home, most current technologies rely on hardwired landline technology or expensive mobile data transmissions to transmit data to a medical facility. The aim of this paper is to investigate and develop an approach to increase the freedom of a monitored patient and decrease costs by utilising mobile technologies and SMS messaging to transmit data from patient to medico. To this end, we evaluated the capabilities of SMS and propose a generic communications protocol which can work within the constraints of the SMS format, but provide the necessary redundancy and robustness to be used for the transmission of non-critical medical telemetry from data logging medical sensors.
Directory of Open Access Journals (Sweden)
Aswir Premadi
2013-09-01
Full Text Available This paper introduces an in-service transmission surveillance and protection-based approach for fiber failures/faults over fiber-to-the-home passive optical network (FTTH-PON with an excellent combination of Access Control System (ACS and Smart Access Network Testing, Analyzing and Database (SANTAD. Our hardware design works on a standard local area network (LAN using a specially designed hardware interfaced with a microcontroller integrated Ethernet to monitor the status of optical signals flow and provide the restoration against fiber failures/faults in FTTH-PON. We also introduce the centralized management and access control program by means of SANTAD. ACS is used to control the troubleshooting mechanism carried out by SANTAD. This design will be implemented at central office (CO for distant monitoring and remote controlling each optical fiber line’s status as well as for detecting any failures/faults that occurs in the network system downwardly from CO towards multiple optical network units (ONUs. The scope of this discussion only highlighted on the monitoring and controlling instead of the restoration scheme.
Directory of Open Access Journals (Sweden)
Aswir Premadi
2009-05-01
Full Text Available This paper introduces an in-service transmission surveillance and protection-based approach for fiber failures/faults over fiber-to-the-home passive optical network (FTTH-PON with an excellent combination of Access Control System (ACS and Smart Access Network Testing, Analyzing and Database (SANTAD. Our hardware design works on a standard local area network (LAN using a specially designed hardware interfaced with a microcontroller integrated Ethernet to monitor the status of optical signals flow and provide the restoration against fiber failures/faults in FTTH-PON. We also introduce the centralized management and access control program by means of SANTAD. ACS is used to control the troubleshooting mechanism carried out by SANTAD. This design will be implemented at central office (CO for distant monitoring and remote controlling each optical fiber line’s status as well as for detecting any failures/faults that occurs in the network system downwardly from CO towards multiple optical network units (ONUs. The scope of this discussion only highlighted on the monitoring and controlling instead of the restoration scheme.
Control of Power Converters in AC Microgrids
DEFF Research Database (Denmark)
Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede
2012-01-01
The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...
Droop-free Distributed Control for AC Microgrids
DEFF Research Database (Denmark)
Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.
2016-01-01
A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...
Effect of AC electric fields on the stabilization of premixed bunsen flames
Kim, Minkuk
2011-01-01
The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.
Ogawa, H. S.; Mcmullin, D.; Judge, D. L.; Korde, R.
1992-01-01
New developments in transmission grating and photodiode technology now make it possible to realize spectrometers in the extreme ultraviolet (EUV) spectral region (wavelengths less than 1000 A) which are expected to be virtually constant in their diffraction and detector properties. Time dependent effects associated with reflection gratings are eliminated through the use of free standing transmission gratings. These gratings together with recently developed and highly stable EUV photodiodes have been utilized to construct a highly stable normal incidence spectrophotometer to monitor the variability and absolute intensity of the solar 304 A line. Owing to its low weight and compactness, such a spectrometer will be a valuable tool for providing absolute solar irradiance throughout the EUV. This novel instrument will also be useful for cross-calibrating other EUV flight instruments and will be flown on a series of Hitchhiker Shuttle Flights and on SOHO. A preliminary version of this instrument has been fabricated and characterized, and the results are described.
Multi-Speed Transmission For Commercial Delivery Medium Duty PEDVs
Energy Technology Data Exchange (ETDEWEB)
Chavdar, Bulent [Eaton Corp., Menomonee Falls, WI (United States)
2017-12-31
Successful completion of the proposed project will set a course for improving quality of life by overcoming key challenges in the gearbox for commercial-delivery, medium-duty, plug-in electric drive vehicles: It will reduce US dependency on foreign oil through the use of electric driven propulsion instead of fuel driven. It will reduce health risks by replacing tailpipe emissions in densely populated city centers. Finally, it will improve the performance-cost basis to meet or exceed the expectations of the targeted medium duty vehicle fleet owners and the independent customers. The proposed multi-speed transmission will narrow motor operation to the peak efficiency region, thereby increasing the electric powertrain efficiency to help close the range gap. Further, it will enhance customer satisfaction by improving vehicle acceleration, top speed and gradeability over the baseline. The project was conducted in three budget periods: In BP1: Technology Development, High-level vehicle powertrain models were used to optimize candidate transmission architectures and ratios along with a variety of traction motor characteristics for concept selection. The detailed driveline designs and component dynamics were investigated to meet medium-duty EV requirements; In BP2: Technology Development and Prototype Demonstration, The modeling and simulations with multi-speed transmissions were extended to other MD and HD EV platforms. Clean sheet design of a compact, lightweight, flexible, and modular, four-speed transmission was completed. Development of novel shifting and controls strategies were started and procurement of the prototype transmission and the controller hardware was begun; In BP3: Technology Integration, Testing, and Demonstration, Prototyping the four-speed automated mechanical transmission was completed. The transmission controls system and software development and preliminary gearbox dyno tests were done at Eaton. ORNL conducted integrated powertrain HIL tests. One
Objectives and status of development of AC600
International Nuclear Information System (INIS)
Zhao Chengkun
1997-01-01
AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600
21 CFR 880.5510 - Non-AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...
Effect of temperature on the AC impedance of protein
Indian Academy of Sciences (India)
The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...
Thomas, Heiko; Chervyakov, Alexander; Stückrad, Stefan; Salmieri, Delia; Rubbia, Carlo
2016-01-01
Despite the extensive research and development investments into superconducting science and technology, both at the fundamental and at the applied levels, many benefits of superconducting transmission lines (SCTL) remain unknown to the public and decision makers at large. This paper aims at informing about the progress in this important research field. Superconducting transmission lines have a tremendous size advantage and lower total electrical losses for high capacity transmission plus a number of technological advantages compared to solutions based on standard conductors. This leads to a minimized environmental impact and enables an overall more sustainable transmission of electric energy. One of the direct benefits may be an increased public acceptance due to the low visual impact with a subsequent reduction of approval time. The access of remote renewable energy (RE) sources with high-capacity transmission is rendered possible with superior efficiency. That not only translates into further reducing $CO_2...
Directory of Open Access Journals (Sweden)
Vinod Kumar Singh
2016-09-01
Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.
Microwave power engineering generation, transmission, rectification
Okress, Ernest C
1968-01-01
Microwave Power Engineering, Volume 1: Generation, Transmission, Rectification considers the components, systems, and applications and the prevailing limitations of the microwave power technology. This book contains four chapters and begins with an introduction to the basic concept and developments of microwave power technology. The second chapter deals with the development of the main classes of high-power microwave and optical frequency power generators, such as magnetrons, crossed-field amplifiers, klystrons, beam plasma amplifiers, crossed-field noise sources, triodes, lasers. The third
Novel technical solutions for wireless ECG transmission & analysis in the age of the internet cloud.
Al-Zaiti, Salah S; Shusterman, Vladimir; Carey, Mary G
2013-01-01
Current guidelines recommend early reperfusion therapy for ST-elevation myocardial infarction (STEMI) within 90 min of first medical encounter. Telecardiology entails the use of advanced communication technologies to transmit the prehospital 12-lead electrocardiogram (ECG) to offsite cardiologists for early triage to the cath lab; which has been shown to dramatically reduce door-to-balloon time and total mortality. However, hospitals often find adopting ECG transmission technologies very challenging. The current review identifies seven major technical challenges of prehospital ECG transmission, including: paramedics inconvenience and transport delay; signal noise and interpretation errors; equipment malfunction and transmission failure; reliability of mobile phone networks; lack of compliance with the standards of digital ECG formats; poor integration with electronic medical records; and costly hardware and software pre-requisite installation. Current and potential solutions to address each of these technical challenges are discussed in details and include: automated ECG transmission protocols; annotatable waveform-based ECGs; optimal routing solutions; and the use of cloud computing systems rather than vendor-specific processing stations. Nevertheless, strategies to monitor transmission effectiveness and patient outcomes are essential to sustain initial gains of implementing ECG transmission technologies. © 2013.
Macedonian transmission grid capability and development
International Nuclear Information System (INIS)
Naumoski, K.; Achkoska, E.; Paunoski, A.
2015-01-01
The main task of the transmission grid is to guarantee evacuation of electricity from production facilities and, at the same time, supply the electricity to all customers, in a secure, reliable and qualitative manner. During the last years, transmission grid goes through the period of fast and important development, as a result of implementation of renewable and new technologies and creation of internal European electricity market. Due to these reasons, capacity of the existing grid needs to be upgraded either with optimization of existing infrastructure or constructing the new transmission projects. Among the various solutions for strengthening the grid, the one with the minimal investment expenses for construction is selected. While planning the national transmission grid, MEPSO planners apply multi-scenarios analyses, in order to handle all uncertainties, particularly in the forecasts on loads, production and exchange of electricity, location and size of the new power plants, hydrological conditions, integration of renewable sources and the evolution of the electricity market. Visions for development of European transmission grid are also considered. Special attention in the development plan is paid to modelling of power systems in the region of South-Eastern Europe and covering a wider area of the regional transmission grid with simulations of various market transactions. Macedonian transmission grid is developed to satisfy all requirements for electricity production/supply and transits, irrespective which scenario will be realized on long-term basis. Transmission development plan gives the road map for grid evolution from short-term and mid-term period towards long-term horizons (15-20 years ahead). While creating long-term visions, a big challenge in front of transmission planners is implementation of NPP. The paper gives overview of the planning process of Macedonian transmission grid,comprising: definition of scenarios,planning methodology and assessment of
Improved Scheduling Mechanisms for Synchronous Information and Energy Transmission.
Qin, Danyang; Yang, Songxiang; Zhang, Yan; Ma, Jingya; Ding, Qun
2017-06-09
Wireless energy collecting technology can effectively reduce the network time overhead and prolong the wireless sensor network (WSN) lifetime. However, the traditional energy collecting technology cannot achieve the balance between ergodic channel capacity and average collected energy. In order to solve the problem of the network transmission efficiency and the limited energy of wireless devices, three improved scheduling mechanisms are proposed: improved signal noise ratio (SNR) scheduling mechanism (IS2M), improved N-SNR scheduling mechanism (INS2M) and an improved Equal Throughput scheduling mechanism (IETSM) for different channel conditions to improve the whole network performance. Meanwhile, the average collected energy of single users and the ergodic channel capacity of three scheduling mechanisms can be obtained through the order statistical theory in Rayleig, Ricean, Nakagami- m and Weibull fading channels. It is concluded that the proposed scheduling mechanisms can achieve better balance between energy collection and data transmission, so as to provide a new solution to realize synchronous information and energy transmission for WSNs.
Case study on the US superconducting power transmission program
Energy Technology Data Exchange (ETDEWEB)
Hammel, E.F.
1996-02-01
After the 1911 discovery of superconductivity (the abrupt loss of electrical resistance in certain materials at very low temperatures), attempts were made to make practical use of this phenomenon. Initially these attempts failed, but in the early 1960s (after 50 years of research) they succeeded. By then, the projected growth in the production and consumption of electrical energy required much higher capacity power transmission capabilities than were available or likely to become available from incremental improvements in existing transmission technology. Since superconductors were capable in principle of transmitting huge amounts of power, research programs to develop and demonstrate superconducting transmission lines were initiated in the US and abroad. The history of the US program, including the participants, their objectives, funding and progress made, is outlined. Since the R&D program was terminated before the technology was completely demonstrated, the reasons for and consequences of this action are discussed in a final section.
International Nuclear Information System (INIS)
Schneider, Jochen M.; Music, Denis; Sun Zhimei
2005-01-01
We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion
Low ac loss geometries in YBCO coated conductors and impact on conductor stability
Energy Technology Data Exchange (ETDEWEB)
Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.
Dynamic simulation of hvdc transmission systems on digital computers
Energy Technology Data Exchange (ETDEWEB)
Hingorani, N G; Hay, J L; Crosbie, R E
1966-05-01
A digital computer technique is based on the fact that the operation of an hvdc converter consists of similar consecutive processes, each process having features which are common to all processes. Each bridge converter of an hvdc system is represented by a central process, and repetitive use of the latter simulates continuous converter operation. This technique may be employed to obtain the waveforms of transient or steady state voltages and currents anywhere in the dc system. To illustrate the method, an hvdc link is considered; the link which connects two independent ac systems conprises two converters with their control systems, and a dc transmission line. As an example, the transient behavior of the system is examined following changes in the current settings of the control system.
Transmission line properties of long strings of superconducting magnets
International Nuclear Information System (INIS)
Shafer, R.E.
1980-09-01
The purpose of this paper is to discuss the electrical characteristics of a long string of superconducting magnets, such as in a superconducting storage ring or accelerator. As the magnets have a shunt capacitance to ground as well as a series inductance, travelling waves can propagate along the string, as in a transmission line. As the string is of finite length, standing waves can also exist. In accelerator quality superconducting magnets, considerable effort has been devoted to minimizing ac losses, the net result being that the magnet string has a high Q precisely at the frequencies which are important for the standing and travelling waves. The magnitude of these effects are estimated, and the solution to be used at Fermilab will be discussed
Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven
International Nuclear Information System (INIS)
Smedley, K.
1992-04-01
The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab
An overview of power electronics applications in fuel cell systems: DC and AC converters.
Ali, M S; Kamarudin, S K; Masdar, M S; Mohamed, A
2014-01-01
Power electronics and fuel cell technologies play an important role in the field of renewable energy. The demand for fuel cells will increase as fuel cells become the main power source for portable applications. In this application, a high-efficiency converter is an essential requirement and a key parameter of the overall system. This is because the size, cost, efficiency, and reliability of the overall system for portable applications primarily depend on the converter. Therefore, the selection of an appropriate converter topology is an important and fundamental aspect of designing a fuel cell system for portable applications as the converter alone plays a major role in determining the overall performance of the system. This paper presents a review of power electronics applications in fuel cell systems, which include various topology combinations of DC converters and AC inverters and which are primarily used in fuel cell systems for portable or stand-alone applications. This paper also reviews the switching techniques used in power conditioning for fuel cell systems. Finally, this paper addresses the current problem encountered with DC converters and AC inverter.
AC loss time constant measurements on Nb3Al and NbTi multifilamentary superconductors
International Nuclear Information System (INIS)
Painter, T.A.
1988-03-01
The AC loss time constant is a previously univestigated property of Nb 3 Al, a superconductor which, with recent technological developments, shows some advantages over the more commonly used superconductors, NbTi and Nb 3 Sn. Four Nb 3 Al samples with varying twist pitches and one NbTi sample are inductively measured for their AC loss time constants. The measured time constants are compared to the theoretical time constant limits imposed by the limits of the transverse resistivity found by Carr [5] and to the theoretical time constants found using the Bean Model as well as to each other. The measured time constants of the Nb 3 Al samples fall approximately halfway between the theoretical time constant limits, and the measured time constants of the NbTi sample is close to the theoretical lower time constant limit. The Bean Model adequately accounts for the variance of the permeability of the Nb 3 Al superconductor in a background magnetic field. Finally, the measured time constant values of the Nb 3 Al samples vary approximately according to the square of their twist pitch. (author)
Flame spread over inclined electrical wires with AC electric fields
Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho
2017-01-01
Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field
Next wave EM technology : Electromagnetic communication technology continues to progress
International Nuclear Information System (INIS)
Ludwick, J.
1998-01-01
Alpine Oil Services Corp. and Ryan Energy Technologies Inc., have made technological advances in the use of real time electromagnetic (EM) data transmission, using low frequency radio waves to transmit well commands or geological information. The development of the telemetry activated tool was done in two steps. The first technology was real time EM data transmission from the subsurface which used the wellbore to transfer information. The second step was constructing a memory pack which involved an electronic instrument installed in the wellbore which was programmed to perform certain tasks at certain times by transmitting signals back and forth. The use of EM communication allows the geological steering information to come back faster. The EM signal is much faster compared to MWD systems for deeper directional wells. The EM technology also has immediate applications in underbalanced drilling. 1 fig
International Nuclear Information System (INIS)
Nakahata, Masaaki; Amemiya, Naoyuki
2008-01-01
Two-dimensional electromagnetic field analyses were undertaken using two representative cross sections of two-layer cables consisting of coated conductors with magnetic and non-magnetic substrates. The following two arrangements were used for the coated conductors between the inner and outer layers: (1) tape-on-tape and (2) alternate. The calculated magnetic flux profile around each coated conductor was visualized. In the case of the non-magnetic substrate, the magnetic field to which coated conductors in the outer layer are exposed contains more perpendicular component to the conductor wide face (perpendicular field component) when compared to that in the inner layer. On the other hand, for the tape-on-tape arrangement of coated conductors with a magnetic substrate, the reverse is true. In the case of the alternate arrangement of the coated conductor with a magnetic substrate, the magnetic field to which the coated conductors in the inner and outer layers are exposed experiences a small perpendicular field component. When using a non-magnetic substrate, the AC loss in the superconductor layer of the coated conductors in the two-layer cables is dominated by that in the outer layer, whereas the reverse is true in the case of a magnetic substrate. When comparing the AC losses in superconductor layers of coated conductors with non-magnetic and magnetic substrates in two-layer cables, the latter is larger than the former, but the influence of the magnetism of substrates on AC losses in superconductor layers is not remarkable
Varma, Niraj; Love, Charles J; Schweikert, Robert; Moll, Philip; Michalski, Justin; Epstein, Andrew E
2018-04-01
Benefits of automatic remote home monitoring (HM) among implantable cardioverter defibrillator (ICD) patients may require high transmission frequency. However, transmission reliability and effects on battery longevity remain uncertain. We hypothesized that HM would have high transmission success permitting punctual guideline based follow-up, and improve battery longevity. This was tested in the prospective randomized TRUST trial. Implantable cardioverter defibrillator patients were randomized post-implant 2:1 to HM (n = 908) (transmit daily) or to Conventional in-person monitoring [conventional management (CM), n = 431 (HM disabled)]. In both groups, five evaluations were scheduled every 3 months for 15 months. Home Monitoring technology performance was assessed by transmissions received vs. total possible, and number of scheduled HM checks failing because of missed transmissions. Battery longevity was compared in HM vs. CM at 15 months, and again in HM 3 years post-implant using continuously transmitted data. Transmission success per patient was 91% (median follow-up of 434 days). Overall, daily HM transmissions were received in 315 795 of a potential 363 450 days (87%). Only 55/3759 (1.46%) of unsuccessful scheduled evaluations in HM were attributed to transmission loss. Shock frequency and pacing percentage were similar in HM vs. CM. Fifteen month battery longevity was 12% greater in HM (93.2 ± 8.8% vs. 83.5 ± 6.0% CM, P battery longevity was 50.9 ± 9.1% (median 52%) at 36 months. Automatic remote HM demonstrated robust transmission reliability. Daily transmission load may be sustained without reducing battery longevity. Home Monitoring conserves battery longevity and tracks long term device performance. ClinicalTrials.gov; NCT00336284.
DC and AC biasing of a transition edge sensor microcalorimeter
International Nuclear Information System (INIS)
Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.
2002-01-01
We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions
Engineering Design of the ITER AC/DC Power Supplies
International Nuclear Information System (INIS)
Oh, B. H.; Lee, K. W.; Hwang, C. K.; Jin, J. T.; Chang, D. S.; Kim, T. S.
2009-02-01
To design high power pulse power supplies, especially in huge power supplies have not designed till now, it is necessary to analyze a system's characteristics and relations with another systems as well as to know high voltage, high current control technologies. Contents of this project are; - Study for the engineering designs changed recently by ITER Organization(IO) and writing specifications for the power supplies to reduce project risk. - Detailed analysis of the AC/DC Converters and writing subtask reports on the Task Agreement. - Study for thyristor numbers, DCR's specifications for Korea-China sharing meetings. - Study for the grounding systems of the ITER power supply system. The results may used as one of reference for practical designs of the high power coil power supplies and also may used in various field such as electroplating, plasma arc furnaces, electric furnaces
Aragonite coating solutions (ACS) based on artificial seawater
International Nuclear Information System (INIS)
Tas, A. Cuneyt
2015-01-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry
Aragonite coating solutions (ACS) based on artificial seawater
Energy Technology Data Exchange (ETDEWEB)
Tas, A. Cuneyt, E-mail: c_tas@hotmail.com
2015-03-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
International Nuclear Information System (INIS)
Lee, Z.; Rose, H.; Lehtinen, O.; Biskupek, J.; Kaiser, U.
2014-01-01
In order to achieve the highest resolution in aberration-corrected (AC) high-resolution transmission electron microscopy (HRTEM) images, high electron doses are required which only a few samples can withstand. In this paper we perform dose-dependent AC-HRTEM image calculations, and study the dependence of the signal-to-noise ratio, atom contrast and resolution on electron dose and sampling. We introduce dose-dependent contrast, which can be used to evaluate the visibility of objects under different dose conditions. Based on our calculations, we determine optimum samplings for high and low electron dose imaging conditions. - Highlights: • The definition of dose-dependent atom contrast is introduced. • The dependence of the signal-to-noise ratio, atom contrast and specimen resolution on electron dose and sampling is explored. • The optimum sampling can be determined according to different dose conditions
Transmission line component testing for the ITER Ion Cyclotron Heating and Current Drive System
Goulding, Richard; Bell, G. L.; Deibele, C. E.; McCarthy, M. P.; Rasmussen, D. A.; Swain, D. W.; Barber, G. C.; Barbier, C. N.; Cambell, I. H.; Moon, R. L.; Pesavento, P. V.; Fredd, E.; Greenough, N.; Kung, C.
2014-10-01
High power RF testing is underway to evaluate transmission line components for the ITER Ion Cyclotron Heating and Current Drive System. The transmission line has a characteristic impedance Z0 = 50 Ω and a nominal outer diameter of 305 mm. It is specified to carry up to 6 MW at VSWR = 1.5 for 3600 s pulses, with transient voltages up to 40 kV. The transmission line is actively cooled, with turbulent gas flow (N2) used to transfer heat from the inner to outer conductor, which is water cooled. High voltage and high current testing of components has been performed using resonant lines generating steady state voltages of 35 kV and transient voltages up to 60 kV. A resonant ring, which has operated with circulating power of 6 MW for 1 hr pulses, is being used to test high power, low VSWR operation. Components tested to date include gas barriers, straight sections of various lengths, and 90 degree elbows. Designs tested include gas barriers fabricated from quartz and aluminum nitride, and transmission lines with quartz and alumina inner conductor supports. The latest results will be presented. This manuscript has been authored by UT-Battelle, LLC, under Contract No. DE-AC05-00OR22725 with the U.S. Department of Energy.
Dong, Zhijun; Yu, Yanwen; Li, Shenghui; Wang, Juan; Tang, Saijun; Huang, Rongfeng
2016-01-04
Increasing evidence has revealed that abscisic acid (ABA) negatively modulates ethylene biosynthesis, although the underlying mechanism remains unclear. To identify the factors involved, we conducted a screen for ABA-insensitive mutants with altered ethylene production in Arabidopsis. A dominant allele of ABI4, abi4-152, which produces a putative protein with a 16-amino-acid truncation at the C-terminus of ABI4, reduces ethylene production. By contrast, two recessive knockout alleles of ABI4, abi4-102 and abi4-103, result in increased ethylene evolution, indicating that ABI4 negatively regulates ethylene production. Further analyses showed that expression of the ethylene biosynthesis genes ACS4, ACS8, and ACO2 was significantly decreased in abi4-152 but increased in the knockout mutants, with partial dependence on ABA. Chromatin immunoprecipitation-quantitative PCR assays showed that ABI4 directly binds the promoters of these ethylene biosynthesis genes and that ABA enhances this interaction. A fusion protein containing the truncated ABI4-152 peptide accumulated to higher levels than its full-length counterpart in transgenic plants, suggesting that ABI4 is destabilized by its C terminus. Therefore, our results demonstrate that ABA negatively regulates ethylene production through ABI4-mediated transcriptional repression of the ethylene biosynthesis genes ACS4 and ACS8 in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.
Transmission of data: Digital processing of isodose patterns
Energy Technology Data Exchange (ETDEWEB)
Tsien, K C [Department of Radiology, Temple University School of Medicine and Hospital, Philadelphia, PA (United States)
1966-06-15
Communication technology has now reached a stage in which we can transmit almost any form of data from one place to another. While television is the best general form of transmission for visual data, the simplest and least expensive way is by coding the data into numerals. Transmission of data by numerical coding, however, requires decoding at the receiving end to restore it to the original form. The transmission of line curves is done most often by translating the curve into a series of points and then determining the co-ordinates of the I points for transmission. The decoding of these data is generally time-consuming if there is no automatic plotter available. A new method of digitizing line drawings has been developed for use in pattern recognition, which simplifies greatly both coding and decoding in the transmission of line curves. This system can be readily adopted for use with isodose curves.
D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.
2016-07-01
The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC particle rejection efficiency.
Improving the Energy Market: Algorithms, Market Implications, and Transmission Switching
Lipka, Paula Ann
This dissertation aims to improve ISO operations through a better real-time market solution algorithm that directly considers both real and reactive power, finds a feasible Alternating Current Optimal Power Flow solution, and allows for solving transmission switching problems in an AC setting. Most of the IEEE systems do not contain any thermal limits on lines, and the ones that do are often not binding. Chapter 3 modifies the thermal limits for the IEEE systems to create new, interesting test cases. Algorithms created to better solve the power flow problem often solve the IEEE cases without line limits. However, one of the factors that makes the power flow problem hard is thermal limits on the lines. The transmission networks in practice often have transmission lines that become congested, and it is unrealistic to ignore line limits. Modifying the IEEE test cases makes it possible for other researchers to be able to test their algorithms on a setup that is closer to the actual ISO setup. This thesis also examines how to convert limits given on apparent power---as is in the case in the Polish test systems---to limits on current. The main consideration in setting line limits is temperature, which linearly relates to current. Setting limits on real or apparent power is actually a proxy for using the limits on current. Therefore, Chapter 3 shows how to convert back to the best physical representation of line limits. A sequential linearization of the current-voltage formulation of the Alternating Current Optimal Power Flow (ACOPF) problem is used to find an AC-feasible generator dispatch. In this sequential linearization, there are parameters that are set to the previous optimal solution. Additionally, to improve accuracy of the Taylor series approximations that are used, the movement of the voltage is restricted. The movement of the voltage is allowed to be very large at the first iteration and is restricted further on each subsequent iteration, with the restriction
Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies
Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.
2016-11-01
We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.
Determining optimal stations for HVDC terminals; Ermittlung vorteilhafter HGUe-Anschluss knoten
Energy Technology Data Exchange (ETDEWEB)
Linnemann, C.; Echternacht, D.; Breuer, C.; Heuberger, D.; Moser, A. [RWTH Aachen (Germany). Inst. fuer Elektrische Anlagen und Energiewirtschaft (IAEW)
2012-07-01
Due to a massiv increase in renewable generation capacity the need for grid reinforcements in the European transmission grid is rising significantly. The nuclear phase out in Germany enlarges this effect furthermore. The required transmission capacity can be provided using conventional AC equipment but also the usage of HVDC technology is currently discussed. This paper presents an approach for identifying suitable locations for HVDc terminals. Subsequently the approach is applied to a model of the German transmission network in the year 2022. (orig.)
Development of low AC loss windings for superconducting traction transformer
International Nuclear Information System (INIS)
Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K
2010-01-01
We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.
AC Calorimetric Design for Dynamic of Biological Materials
Shigeo Imaizumi
2006-01-01
We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...
Study of dielectric relaxation and AC conductivity of InP:S single crystal
El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.
2012-07-01
The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.
Self-field AC losses in Bi-2223 superconducting tapes
International Nuclear Information System (INIS)
Mueller, K. H.; Leslie, K.E.
1996-01-01
Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed
Workshop on power conditioning for alternative energy technologies. Executive summary
Energy Technology Data Exchange (ETDEWEB)
Smith, D. R.
1979-01-01
As various alternative energy technologies such as photovoltaics, wind, fuel cells, and batteries are emerging as potential sources of energy for the future, the need arises for development of suitable power-conditioning systems to interface these sources to their respective loads. Since most of these sources produce dc electricity and most electrical loads require ac, an important component of the required power-conditioning units is a dc-to-ac inverter. The discussions deal with the development of power conditioners for each alternative energy technology. Discussion topics include assessments of current technology, identification of operational requirements with a comparison of requirements for each source technology, the identification of future technology trends, the determination of mass production and marketing requirements, and recommendations for program direction. Specifically, one working group dealt with source technology: photovoltaics, fuel cells and batteries, and wind followed by sessions discussing system size and application: large grid-connected systems, small grid-connected systems, and stand alone and dc applications. A combined group session provided an opportunity to discuss problems common to power conditioning development.
Ballweg, Verena; Eibofner, Frank; Graf, Hansjorg
2011-10-01
State of the art to access radiofrequency (RF) heating near implants is computer modeling of the devices and solving Maxwell's equations for the specific setup. For a set of input parameters, a fixed result is obtained. This work presents a theoretical approach in the alternating current (ac) limit, which can potentially render closed formulas for the basic behavior of tissue heating near metallic structures. Dedicated experiments were performed to support the theory. For the ac calculations, the implant was modeled as an RLC parallel circuit, with L being the secondary of a transformer and the RF transmission coil being its primary. Parameters influencing coupling, power matching, and specific absorption rate (SAR) were determined and formula relations were established. Experiments on a copper ring with a radial gap as capacitor for inductive coupling (at 1.5 T) and on needles for capacitive coupling (at 3 T) were carried out. The temperature rise in the embedding dielectric was observed as a function of its specific resistance using an infrared (IR) camera. Closed formulas containing the parameters of the setup were obtained for the frequency dependence of the transmitted power at fixed load resistance, for the calculation of the resistance for optimum power transfer, and for the calculation of the transmitted power in dependence of the load resistance. Good qualitative agreement was found between the course of the experimentally obtained heating curves and the theoretically determined power curves. Power matching revealed as critical parameter especially if the sample was resonant close to the Larmor frequency. The presented ac approach to RF heating near an implant, which mimics specific values for R, L, and C, allows for closed formulas to estimate the potential of RF energy transfer. A first reference point for worst-case determination in MR testing procedures can be obtained. Numerical approaches, necessary to determine spatially resolved heating maps, can
DEFF Research Database (Denmark)
Sharma, Ranjan
The increasing demand of electric power and the growing consciousness towards the changing climate has led to a rapid development of renewable energy in the recent years. Among all, wind energy has been the fastest growing energy source in the last decade. But the growing size of wind power plants......, better wind conditions at off-shore and the general demand to put them out of sight have all contributed to the installation of large wind power plants in off-shore condition. However, moving wind power plants far out in the off-shore comes with many associated problems. One of the main challenges...... is the transmission of power over long distance. Historically, the power transmission from off-shore wind power plants has been done via HVAC submarine cables. This provides a simple solution, but AC cables cannot be arbitrarily long. It is shown in the report that major issues with HVAC cable transmission system...
AC susceptibility of thin Pb films in intermediate and mixed state
Energy Technology Data Exchange (ETDEWEB)
Janu, Zdenek, E-mail: janu@fzu.cz [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Svindrych, Zdenek [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Trunecek, Otakar [Charles University in Prague, Faculty of Mathematics and Physics, Ke Karlovu 3, CZ-121 16 Prague 2 (Czech Republic); Kus, Peter; Plecenik, Andrej [Komenius University in Bratislava, Faculty of Mathematics, Physics, and Informatics, Mlynska dolina, 842 48 Bratislava 4 (Slovakia)
2011-12-15
Thickness dependent transition in AC susceptibility between intermediate and mixed state in type-I superconducting films. The temperature induced crossover between reversible and irreversible behavior was observed in the thicker film. The temperature dependence of the AC susceptibility in mixed state follows prediction of model based on Bean critical state. The temperature dependence of the harmonics of the complex AC susceptibility in the intermediate state is explained. Thin films of type I superconductors of a thickness comparable or less than a flux penetration length behave like type II superconductors in a mixed state. With decreasing film thickness normal domains carrying a magnetic flux get smaller with smaller number of flux quanta per domain and finally transform into single quantum flux lines, i.e. quantum vortices similar to those found in type II superconductors. We give an evidence of this behavior from the measurements of the nonlinear response of a total magnetic moment to an applied AC magnetic field, directly from the temperature dependence of an AC susceptibility.
International Nuclear Information System (INIS)
Kawamura, Atsuo; Ishioka, Kazuaki; Hirai, Junji.
1995-01-01
A contact-less decentralized power supply is proposed with communication capability through only one transformer. A prototype of wireless transmission system of power and information (WTPI system) was built, and the two axis position control for servo motors was achieved by transferring the power and signal through one rotatable high frequency transformer. The proposed concept can be applied for robotics and NC machines
Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.
2010-11-01
AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.
Operation of AC Adapters Visualized Using Light-Emitting Diodes
Regester, Jeffrey
2016-01-01
A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…
White LED visible light communication technology research
Yang, Chao
2017-03-01
Visible light communication is a new type of wireless optical communication technology. White LED to the success of development, the LED lighting technology is facing a new revolution. Because the LED has high sensitivity, modulation, the advantages of good performance, large transmission power, can make it in light transmission light signal at the same time. Use white LED light-emitting characteristics, on the modulation signals to the visible light transmission, can constitute a LED visible light communication system. We built a small visible optical communication system. The system composition and structure has certain value in the field of practical application, and we also research the key technology of transmitters and receivers, the key problem has been resolved. By studying on the optical and LED the characteristics of a high speed modulation driving circuit and a high sensitive receiving circuit was designed. And information transmission through the single chip microcomputer test, a preliminary verification has realized the data transmission function.
A.C. losses in current-carrying superconductors
International Nuclear Information System (INIS)
Reuver, J.L. de.
1985-01-01
The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)
Logistics Reduction: Advanced Clothing System (ACS)
National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...
Early function of the Abutilon mosaic virus AC2 gene as a replication brake.
Krenz, Björn; Deuschle, Kathrin; Deigner, Tobias; Unseld, Sigrid; Kepp, Gabi; Wege, Christina; Kleinow, Tatjana; Jeske, Holger
2015-04-01
The C2/AC2 genes of monopartite/bipartite geminiviruses of the genera Begomovirus and Curtovirus encode important pathogenicity factors with multiple functions described so far. A novel function of Abutilon mosaic virus (AbMV) AC2 as a replication brake is described, utilizing transgenic plants with dimeric inserts of DNA B or with a reporter construct to express green fluorescent protein (GFP). Their replicational release upon AbMV superinfection or the individual and combined expression of epitope-tagged AbMV AC1, AC2, and AC3 was studied. In addition, the effects were compared in the presence and in the absence of an unrelated tombusvirus suppressor of silencing (P19). The results show that AC2 suppresses replication reproducibly in all assays and that AC3 counteracts this effect. Examination of the topoisomer distribution of supercoiled DNA, which indicates changes in the viral minichromosome structure, did not support any influence of AC2 on transcriptional gene silencing and DNA methylation. The geminiviral AC2 protein has been detected here for the first time in plants. The experiments revealed an extremely low level of AC2, which was slightly increased if constructs with an intron and a hemagglutinin (HA) tag in addition to P19 expression were used. AbMV AC2 properties are discussed with reference to those of other geminiviruses with respect to charge, modification, and size in order to delimit possible reasons for the different behaviors. The (A)C2 genes encode a key pathogenicity factor of begomoviruses and curtoviruses in the plant virus family Geminiviridae. This factor has been implicated in the resistance breaking observed in agricultural cotton production. AC2 is a multifunctional protein involved in transcriptional control, gene silencing, and regulation of basal biosynthesis. Here, a new function of Abutilon mosaic virus AC2 in replication control is added as a feature of this protein in viral multiplication, providing a novel finding on
Directory of Open Access Journals (Sweden)
Zbynek Kocur
2014-01-01
Full Text Available There is a great diversity in the transmission technologies in current data networks. Individual technologies are in most cases incompatible at physical and partially also at the link layer of the reference ISO/OSI model. Network compatibility, as the ability to transmit data, is realizable through the third layer, which is able to guarantee the operation of the different devices across their technological differences. The proposed inverse packet multiplexer addresses increase of the speed and reliability of packet transmission to the third layer, and at the same time it increases the stability of the data communication by the regulation of the delay value during the transmission. This article presents implementation of a communication system and its verification in real conditions. The conclusion compares the strengths and weaknesses of the proposed control system.
Monolithic blue LED series arrays for high-voltage AC operation
Energy Technology Data Exchange (ETDEWEB)
Ao, Jin-Ping [Satellite Venture Business Laboratory, University of Tokushima, Tokushima 770-8506 (Japan); Sato, Hisao; Mizobuchi, Takashi; Morioka, Kenji; Kawano, Shunsuke; Muramoto, Yoshihiko; Sato, Daisuke; Sakai, Shiro [Nitride Semiconductor Co. Ltd., Naruto, Tokushima 771-0360 (Japan); Lee, Young-Bae; Ohno, Yasuo [Department of Electrical and Electronic Engineering, University of Tokushima, Tokushima 770-8506 (Japan)
2002-12-16
Design and fabrication of monolithic blue LED series arrays that can be operated under high ac voltage are described. Several LEDs, such as 3, 7, and 20, are connected in series and in parallel to meet ac operation. The chip size of a single device is 150 {mu}m x 120 {mu}m and the total size is 1.1 mm x 1 mm for a 40(20+20) LED array. Deep dry etching was performed as device isolation. Two-layer interconnection and air bridge are utilized to connect the devices in an array. The monolithic series array exhibit the expected operation function under dc and ac bias. The output power and forward voltage are almost proportional to LED numbers connected in series. On-wafer measurement shows that the output power is 40 mW for 40(20+20) LED array under ac 72 V. (Abstract Copyright [2002], Wiley Periodicals, Inc.)
pH sensing via bicarbonate-regulated ‘soluble’ adenylyl cyclase (sAC
Directory of Open Access Journals (Sweden)
Nawreen eRahman
2013-11-01
Full Text Available Soluble adenylyl cyclase (sAC is a source of the second messenger cyclic adenosine 3',5' monophosphate (cAMP. sAC is directly regulated by bicarbonate (HCO3- ions. In living cells, HCO3- ions are in nearly instantaneous equilibrium with carbon dioxide (CO2 and pH due to the ubiquitous presence of carbonic anhydrases. Numerous biological processes are regulated by CO2, HCO3-, and/or pH, and in a number of these, sAC has been shown to function as a physiological CO2/HCO3/pH sensor. In this review, we detail the known pH sensing functions of sAC, and we discuss two highly-studied, pH-dependent pathways in which sAC might play a role.
International Nuclear Information System (INIS)
Radford, E.P.
1980-07-01
The report evaluates major public health impacts of electric power generation and transmission associated with the nuclear fuel cycle and with coal use. Only existing technology is evaluated. For the nuclear cycle, effects of future use of fuel reprocessing and long-term radioactive waste disposal are briefly considered. The health effects of concern are those leading to definable human disease and injury. Health effects are scaled to numbers of persons and activities associated with a nominal 1000-megawatt electric plant fueled by either option. Comparison of the total health effects to the general public shows that the health risks from the coal cycle are about 50 times greater than for the nuclear cycle (coal, 0.7-3.7 major health effects per 1000 MWe per year; nuclear, 0.03-0.05 per 1000 MWe per year). For workers, these rates are higher. No evidence is found that electrical transmission contributes any health effects to the general public, except when broken power lines come in contact with people
An Annotated Bibliography of HVDC Transmission and FACTS Devices, 1996-1997.
Energy Technology Data Exchange (ETDEWEB)
Litzenberger, Wayne H.; Varma, Rajiv K.; Flanagan, John D. [eds.
1998-06-01
This edition of the Annotated Bibliography of HVDC Transmission and FACTS Devices continues work begun in 1962 by the late Erik Bromberg, Bonneville Power Administration Librarian. His original bibliography covered the period 1932--1962. Subsequent editions were compiled by Bromberg, Val S. Lava, and Wayne Litzenberger, all of Bonneville Power Administration. Beginning with the 1991--1993 edition, the scope of the bibliography was expanded to include flexible ac transmission (FACTS) devices. This 1996--1997 edition also contains information for 1998. Preparation of the present edition took place primarily in May-June of 1998. All pertinent references have been included that were available to the editors at the time of preparation. Papers for the 1998 IEEE Winter and Summer Power Meetings and 1998 T and D Conference have been included. This edition contains the organizational affiliation of the first-named author as an aid to accessing the reference. Unfortunately, space limitations prevented the inclusion of the affiliations of all authors. Some minor editorial changes have been made to abstracts to ensure consistency in style and syntax.
Nuclear data transmission based on zigbee
International Nuclear Information System (INIS)
Cui Yan; Fang Fang; Chen Wei; Jiang Zancheng
2007-01-01
Zigbee, a new wireless communication protocol, which is an important technology supporting wireless sensor networks. We introduce a solution of nuclear data transmission based on zigbee, the cc2420 build up the core of the data acquisition module and the wireless transceive module, and realized remote monitor and nuclear data quickly analysis. (authors)
Normal form of particle motion under the influence of an ac dipole
Directory of Open Access Journals (Sweden)
R. Tomás
2002-05-01
Full Text Available ac dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the ac dipole is adiabatically turned on and off. Therefore the ac dipole seems to be an adequate tool for nonlinear diagnostics provided the particle motion is well described in the presence of the ac dipole and nonlinearities. Normal forms and Lie algebra are powerful tools to study the nonlinear content of an accelerator lattice. In this article a way to obtain the normal form of the Hamiltonian of an accelerator with an ac dipole is described. The particle motion to first order in the nonlinearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the ac dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn motion and the Hamiltonian terms.
AC impedance electrochemical modeling of lithium-ion positive electrodes
International Nuclear Information System (INIS)
Dees, D.; Gunen, E.; Abraham, D.; Jansen, A.; Prakash, J.
2004-01-01
Under Department of Energy's Advanced Technology Development Program,various analytical diagnostic studies are being carried out to examine the lithium-ion battery technology for hybrid electric vehicle applications, and a series of electrochemical studies are being conducted to examine the performance of these batteries. An electrochemical model was developed to associate changes that were observed in the post-test analytical diagnostic studies with the electrochemical performance loss during testing of lithium ion batteries. While both electrodes in the lithium-ion cell have been studied using a similar electrochemical model, the discussion here is limited to modeling of the positive electrode. The positive electrode under study has a composite structure made of a layered nickel oxide (LiNi 0.8 Co 0.15 Al 0.05 O 2 ) active material, a carbon black and graphite additive for distributing current, and a PVDF binder all on an aluminum current collector. The electrolyte is 1.2M LiPF 6 dissolved in a mixture of EC and EMC and a Celgard micro-porous membrane is used as the separator. Planar test cells (positive/separator/negative) were constructed with a special fixture and two separator membranes that allowed the placement of a micro-reference electrode between the separator membranes (1). Electrochemical studies including AC impedance spectroscopy were then conducted on the individual electrodes to examine the performance and ageing effects in the cell. The model was developed by following the work of Professor Newman at Berkeley (2). The solid electrolyte interface (SEI) region, based on post-test analytical results, was assumed to be a film on the oxide and an oxide layer at the surface of the oxide. A double layer capacity was added in parallel with the Butler-Volmer kinetic expression. The pertinent reaction, thermodynamic, and transport equations were linearized for a small sinusoidal perturbation (3). The resulting system of differential equations was solved
Analysis of Input and Output Ripples of PWM AC Choppers
Directory of Open Access Journals (Sweden)
Pekik Argo Dahono
2008-11-01
Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.