Energy Technology Data Exchange (ETDEWEB)
Chandler, K.; Eudy, L.
2007-03-01
This report provides an evaluation of three prototype fuel cell-powered transit buses operating at AC Transit in Oakland, California, and six baseline diesel buses similar in design to the fuel cell buses.
Energy Technology Data Exchange (ETDEWEB)
Chandler, K.; Eudy, L.
2009-01-01
This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 through October 2008. Evaluation results include implementation experience, fueling station operation, fuel cell bus operations at Golden Gate Transit, and evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and roadcalls).
National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit
2009-01-01
This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...
Transit experience with hydrogen fueled hybrid electric buses
International Nuclear Information System (INIS)
Scott, P.B.; Mazaika, D.M.; Levin, J.; Edwards, T.
2006-01-01
Both AC Transit and SunLine Transit operate hybrid electric hydrogen fueled buses in their transit service. ACT presently operates three fuel cell buses in daily revenue service, and SunLine operates a fuel cell bus and a HHICE (Hybrid Hydrogen Internal Combustion Engine) bus. All these buses use similar electric drive train and electric accessories, although the detailed design differs notably between the fuel cell and the hybrid ICE buses. The fuel cell buses use a 120kW UTC fuel cell and a Van Hool Chassis, whereas the HHICE bus uses a turbocharged Ford engine which is capable of 140kW generator output in a New Flyer Chassis. The HHICE bus was the first in service, and has been subjected to both winter testing in Manitoba, Canada and summer testing in the Palm Springs, CA region. The winter testing included passenger sampling using questionnaires to ascertain passenger response. The fuel cell buses were introduced to service at the start of 2006. All five buses are in daily revenue service use. The paper will describe the buses and the experience of the transit properties in operating the buses. (author)
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2015
Energy Technology Data Exchange (ETDEWEB)
Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States); Gikakis, Christina [Federal Transit Administration, Washington, DC (United States)
2015-12-11
This report, published annually, summarizes the progress of fuel cell electric bus (FCEB) development in the United States and discusses the achievements and challenges of introducing fuel cell propulsion in transit. Various stakeholders, including FCEB developers, transit agencies, and system integrators, have expressed the value of this annual status report, which provides a summary of results from evaluations performed by the National Renewable Energy Laboratory. The annual status report tracks the progress of the FCEB industry toward meeting technical targets, documents the lessons learned, and discusses the path forward for commercial viability of fuel cell technology for transit buses. The 2015 summary results primarily focus on the most recent year for each demonstration, from August 2014 through July 2015. The results for these buses account for more than 1,045,000 miles traveled and 83,000 hours of fuel cell power system operation. The primary results presented in the report are from two demonstrations of fuel-cell-dominant bus designs: the Zero Emission Bay Area Demonstration Group led by Alameda-Contra Costa Transit District (AC Transit) in California and the American Fuel Cell Bus Project at SunLine Transit Agency in California.
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2016
Energy Technology Data Exchange (ETDEWEB)
Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jeffers, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2016-11-01
This report, published annually, summarizes the progress of fuel cell electric bus development in the United States and discusses the achievements and challenges of introducing fuel cell propulsion in transit. The report provides a summary of results from evaluations performed by the National Renewable Energy Laboratory. Funding for this effort is provided by the U.S. Department of Energy's Fuel Cell Technologies Office within the Office of Energy Efficiency and Renewable Energy and by the U.S. Department of Transportation's Federal Transit Administration. The 2016 summary results primarily focus on the most recent year for each demonstration, from August 2015 through July 2016. The results for these buses account for more than 550,000 miles traveled and 59,500 hours of fuel cell power system operation. The primary results presented in the report are from three demonstrations of two different fuel-cell-dominant bus designs: Zero Emission Bay Area Demonstration Group led by Alameda-Contra Costa Transit District (AC Transit) in California; American Fuel Cell Bus Project at SunLine Transit Agency in California; and American Fuel Cell Bus Project at the University of California at Irvine.
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2017
Energy Technology Data Exchange (ETDEWEB)
Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew B [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2017-11-21
This report, published annually, summarizes the progress of fuel cell electric bus (FCEB) development in the United States and discusses the achievements and challenges of introducing fuel cell propulsion in transit. The report provides a summary of results from evaluations performed by the National Renewable Energy Laboratory. This annual status report combines results from all FCEB demonstrations, tracks the progress of the FCEB industry toward meeting technical targets, documents the lessons learned, and discusses the path forward for commercial viability of fuel cell technology for transit buses. These data and analyses help provide needed information to guide future early-stage research and development. The 2017 summary results primarily focus on the most recent year for each demonstration, from August 2016 through July 2017. The primary results presented in the report are from five demonstrations of two different fuel-cell-dominant bus designs: Zero Emission Bay Area Demonstration Group led by Alameda-Contra Costa Transit District (AC Transit) in California; American Fuel Cell Bus (AFCB) Project at SunLine Transit Agency in California; AFCB Project at the University of California at Irvine; AFCB Project at Orange County Transportation Authority; and AFCB Project at Massachusetts Bay Transportation Authority.
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2010
Energy Technology Data Exchange (ETDEWEB)
Eudy, L.; Chandler, K.; Gigakis, C.
2010-11-01
This status report, fourth in a series of annual status reports from the U.S. Department of Energy's National Renewable Energy Laboratory, summarizes progress and accomplishments from demonstrations of fuel cell transit buses in the United States. This year's assessment report provides the results from the fifth year of operation of five Van Hool, ISE, and UTC Power fuel cell buses operating at AC Transit, SunLine, and CTTRANSIT. The achievements and challenges of this bus design, implementation, and operating are presented, with a focus on the next steps for implementing larger numbers and new and different designs of fuel cell buses. The major positive result from nearly five years of operation is the dramatic increase in reliability experienced for the fuel cell power system.
Application of ac impedance in fuel cell research and development
Energy Technology Data Exchange (ETDEWEB)
Selman, J R; Lin, Y P [Illinois Inst. of Tech., Chicago, IL (United States). Dept. of Chemical Engineering
1993-10-01
In applying ac impedance to fuel cells and their porous (gas diffusion) electrodes the emphasis lies on different fuel cell components, and their properties, according to the fuel cell type. The focus has been directed at the electrode/electrolyte interface in MCFC and PAFC, whereas in SOFC and PEMFC the ionic/electronic conductivity of the electrolyte or the characteristics of its composite with the electrocatalyst is of primary interest. The limitations of ac impedance in fuel cell application are in part due to difficulties of interpretation and in part due to experimental difficulties because of the generally fast electrode reaction kinetics. Further research directions are indicated. (author)
Design and fuel fabrication processes for the AC-3 mixed-carbide irradiation test
International Nuclear Information System (INIS)
Latimer, T.W.; Chidester, K.M.; Stratton, R.W.; Ledergerber, G.; Ingold, F.
1992-01-01
The AC-3 test was a cooperative U.S./Swiss irradiation test of 91 wire-wrapped helium-bonded U-20% Pu carbide fuel pins irradiated to 8.3 at % peak burnup in the Fast Flux Test Facility. The test consisted of 25 pins that contained spherepac fuel fabricated by the Paul Scherrer Institute (PSI) and 66 pins that contained pelletized fuel fabricated by the Los Alamos National Laboratory. Design of AC-3 by LANL and PSI was begun in 1981, the fuel pins were fabricated from 1983 to 1985, and the test was irradiated from 1986 to 1988. The principal objective of the AC-3 test was to compare the irradiation performance of mixed-carbide fuel pins that contained either pelletized or sphere-pac fuel at prototypic fluence and burnup levels for a fast breeder reactor
Checklist for transition to new highway fuel(s).
Energy Technology Data Exchange (ETDEWEB)
Risch, C.; Santini, D.J. (Energy Systems)
2011-12-15
Transportation is vital to the U.S. economy and society. As such, U.S. Presidents have repeatedly stated that the nation needs to reduce dependence on petroleum, especially for the highway transportation sector. Throughout history, highway transportation fuel transitions have been completed successfully both in United States and abroad. Other attempts have failed, as described in Appendix A: Historical Highway Fuel Transitions. Planning for a transition is critical because the changes can affect our nation's ability to compete in the world market. A transition will take many years to complete. While it is tempting to make quick decisions about the new fuel(s) of choice, it is preferable and necessary to analyze all the pertinent criteria to ensure that correct decisions are made. Doing so will reduce the number of changes in highway fuel(s). Obviously, changes may become necessary because of occurrences such as significant technology breakthroughs or major world events. With any and all of the possible transitions to new fuel(s), the total replacement of gasoline and diesel fuels is not expected. These conventional fuels are envisioned to coexist with the new fuel(s) for decades, while the revised fuel and vehicle infrastructures are implemented. The transition process must analyze the needs of the primary 'players,' which consist of the customers, the government, the fuel industry, and the automotive industry. To maximize the probability of future successes, the prime considerations of these groups must be addressed. Section 2 presents a succinct outline of the Checklist. Section 3 provides a brief discussion about the groupings on the Checklist.
DC and AC biasing of a transition edge sensor microcalorimeter
International Nuclear Information System (INIS)
Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.
2002-01-01
We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions
Progress in hydrogen fueled busses
International Nuclear Information System (INIS)
Scott, P.B.; Mazaika, D.M.; Tyler, T.
2004-01-01
'Full text:' The Thor/ISE fuel cell bus has been in demonstration and revenue service during 2002-2003 at sites including SunLine Transit, Chula Vista Transit, Los Angeles County Metropolitan Transit Authority, and AC Transit in Oakland. By taking advantage of ISE's advanced hybrid-electric drive technology, this 30-foot bus operates with a much smaller fuel cell than those used in other buses of this class. Further, stress on the fuel cell is diminished. Based on the exceptional performance of this prototype bus, the transit agencies listed above have concluded that hybrid electric hydrogen fueled buses are attractive. Two types of hydrogen fueled hybrid electric buses will be described: - fuel cell powered, and - HICE (Hydrogen Internal Combustion Engine) This progress report will include: 1. Experience with the Thor/ISE fuel cell bus, including results from revenue service at two transit locations, 2. Design and fabrication status of the advanced fuel cell buses being built for AC Transit and SunLine Transit, 3. Design and fabrication status of the prototype HHICE (Hybrid electric Hydrogen fueled Internal Combustion Engine) bus that uses a Ford hydrogen burning engine, mated to a generator, rather than a fuel cell. Other than the engine, the drive train in the HHICE bus is nearly identical to that of a fuel cell hybrid-electric bus. Canadian participation in the HHICE bus is extensive, it is a New Flyer platform and will be winter tested in Winnipeg. (author)
Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration Results. Fourth Report
Energy Technology Data Exchange (ETDEWEB)
Eudy, Leslie [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2015-07-02
This report presents results of a demonstration of fuel cell electric buses (FCEB) operating in Oakland, California. Alameda-Contra Costa Transit District (AC Transit) leads the Zero Emission Bay Area (ZEBA) demonstration, which includes 12 advanced-design fuel cell buses and two hydrogen fueling stations. The FCEBs in service at AC Transit are 40-foot, low-floor buses built by Van Hool with a hybrid electric propulsion system that includes a US Hybrid fuel cell power system and EnerDel lithium-based energy storage system. The buses began revenue service in May 2010.
An overview of power electronics applications in fuel cell systems: DC and AC converters.
Ali, M S; Kamarudin, S K; Masdar, M S; Mohamed, A
2014-01-01
Power electronics and fuel cell technologies play an important role in the field of renewable energy. The demand for fuel cells will increase as fuel cells become the main power source for portable applications. In this application, a high-efficiency converter is an essential requirement and a key parameter of the overall system. This is because the size, cost, efficiency, and reliability of the overall system for portable applications primarily depend on the converter. Therefore, the selection of an appropriate converter topology is an important and fundamental aspect of designing a fuel cell system for portable applications as the converter alone plays a major role in determining the overall performance of the system. This paper presents a review of power electronics applications in fuel cell systems, which include various topology combinations of DC converters and AC inverters and which are primarily used in fuel cell systems for portable or stand-alone applications. This paper also reviews the switching techniques used in power conditioning for fuel cell systems. Finally, this paper addresses the current problem encountered with DC converters and AC inverter.
Connecticut Transit (CTTRANSIT) Fuel Cell Transit Bus: Preliminary Evaluation Results
Energy Technology Data Exchange (ETDEWEB)
Chandler, K.; Eudy, L.
2008-10-01
This report provides preliminary results from a National Renewable Energy Laboratory evaluation of a protoptye fuel cell transit bus operating at Connecticut Transit in Hartford. Included are descriptions of the planned fuel cell bus demonstration and equipment; early results and agency experience are also provided.
Transition to a hydrogen fuel cell transit bus fleet for Canadian urban transit system
International Nuclear Information System (INIS)
Ducharme, P.
2004-01-01
'Full text:' The Canadian Transportation Fuel Cell Alliance (CTFCA), created by the Canadian Government as part of its 2000 Climate Change Action Plan, has commissioned MARCON-DDM's Hydrogen Intervention Team (HIT) to provide a roadmap for urban transit systems that wish to move to hydrogen fuel cell-powered bus fleets. HIT is currently in the process of gathering information from hydrogen technology providers, bus manufacturers, fuelling system providers and urban transit systems in Canada, the US and Europe. In September, HIT will be in a position to provide a preview of its report to the CTFCA, due for October 2004. The planned table of contents includes: TOMORROW'S FUEL CELL (FC) URBAN TRANSIT BUS - Powertrain, on-board fuel technologies - FC engine system manufacturers - Bus technical specifications, performances, operating characteristics - FC bus manufacturers TOMORROW'S FC TRANSIT PROPERTY - Added maintenance, facilities and fuelling infrastructure requirements - Supply chain implications - Environmental and safety issues - Alternative operational concepts PATHWAYS TO THE FUTURE - Choosing the future operational concept - 'Gap' assessment - how long from here to there? - Facilities and fleet adjustments, including fuelling infrastructure - Risk mitigation, code compliance measures TRANSITIONAL CONSIDERATIONS - Cost implications - Transition schedule (author)
International Nuclear Information System (INIS)
Jeong, Chang Joon; Suk, Ho Chun
2002-01-01
A transition from 37-element natural uranium fuel to CANFLEX-NU fuel has been modeled in a 1200-day time-dependent fuel management simulation for a CANDU 6 reactor. The simulation was divided into three parts. The pre-transition period extended from 0 to 300 FPD, in which the reactor was fuelled only with standard 37-element fuel bundles. In the transition period, refueling took place only with the CANFLEX-NU fuel bundle. The transition stage lasted from 300 to 920 FPD, at which point all of the 37-element fuel in the core had been replaced by CANFLEX-NU fuel bundle. In the post-transition phase, refueling continued with CANFLEX-NU fuel until 1200 FPD, to arrive at estimate of the equilibrium core characteristics with CANFLEX-NU fuel. Simulation results show that the CANFLEX-NU fuel bundle has a operational compatibility with the CANDU 6 reactor during the transition core, and also show that the transition core from 37-element natural uranium fuel to CANFLEX-NU can be operated without violating any license limit of the CANDU 6 reactor
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Connecticut Transit (CTTRANSIT) Fuel Cell Transit Bus Preliminary Evaluation Results
2008-10-16
This report describes operations at Connecticut Transit (CTTRANSIT) in Hartford for one prototype fuel cell bus and three new diesel buses operating from the same location. The report discusses the planned fuel cell bus demonstration and equipment us...
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2011
Energy Technology Data Exchange (ETDEWEB)
Eudy, L.; Chandler, K.; Gikakis, C.
2011-11-01
This status report, fifth in a series of annual status reports from the U.S. Department of Energy's National Renewable Energy Laboratory (NREL), discusses the achievements and challenges of fuel cell propulsion for transit and summarizes the introduction of fuel cell transit buses in the United States. Progress this year includes an increase in the number of fuel cell electric buses (FCEBs), from 15 to 25, operating at eight transit agencies, as well as increased diversity of the fuel cell design options for transit buses. The report also provides an analysis of the combined results from fuel cell transit bus demonstrations evaluated by NREL with a focus on the most recent data through July 2011 including fuel cell power system reliability and durability; fuel economy; roadcall; and hydrogen fueling results. These evaluations cover 22 of the 25 FCEBs currently operating.
Transition Analysis of Promising U.S. Future Fuel Cycles Using ORION
International Nuclear Information System (INIS)
Sunny, Eva E.; Worrall, Andrew; Peterson, Joshua L.; Powers, Jeffrey J.; Gehin, Jess C.; Gregg, Robert
2015-01-01
The US Department of Energy Office of Fuel Cycle Technologies performed an evaluation and screening (E&S) study of nuclear fuel cycle options to help prioritize future research and development decisions. Previous work for this E&S study focused on establishing equilibrium conditions for analysis examples of 40 nuclear fuel cycle evaluation groups (EGs) and evaluating their performance according to a set of 22 standardized metrics. Following the E&S study, additional studies are being conducted to assess transitioning from the current US fuel cycle to future fuel cycle options identified by the E&S study as being most promising. These studies help inform decisions on how to effectively achieve full transition, estimate the length of time needed to undergo transition from the current fuel cycle, and evaluate performance of nuclear systems and facilities in place during the transition. These studies also help identify any barriers to achieve transition. Oak Ridge National Laboratory (ORNL) Fuel Cycle Options Campaign team used ORION to analyze the transition pathway from the existing US nuclear fuel cycle—the once-through use of low-enriched-uranium (LEU) fuel in thermal-spectrum light water reactors (LWRs)—to a new fuel cycle with continuous recycling of plutonium and uranium in sodium fast reactors (SFRs). This paper discusses the analysis of the transition from an LWR to an SFR fleet using ORION, highlights the role of lifetime extensions of existing LWRs to aid transition, and discusses how a slight delay in SFR deployment can actually reduce the time to achieve an equilibrium fuel cycle.
US activities on fuel cycle transition scenarios
International Nuclear Information System (INIS)
McCarthy, Kathryn A.
2010-01-01
Countries with active nuclear programmes typically have as a goal transition to a closed fuel cycle. A closed fuel cycle enables long-term sustainability, provides waste management benefits, and as a system, can reduce overall proliferation risk. This transition will take many decades, thus the study of the actual transition is an important topic. The United States systems analysis activities as part of the Advanced Fuel Cycle Initiative (AFCI) provide the integrating analyses for the fuel cycle programme, and recent activities are focusing on transition options, and specifically, the dynamics of the transition. The United States is still studying both one-tier (recycling in fast reactors only) and two-tier (recycling in both thermal and fast reactors) systems, and the systems analysis activities provide insight into the trade-offs associated with the systems, and variations of each. Most recently, a series of sensitivity studies have been completed which provide insight into the behaviour of a transition system. These studies evaluate the impact of changing various parameters in the fuel cycle system, and provide insight into how the system will change as parameters change. Because these deployment analyses look at the development of nuclear energy systems over a long period of time, it is very unlikely that we will accurately predict the system's characteristics over time (for example, growth in electricity demand, how quickly nuclear reactors will be deployed, how many fast rectors versus thermal reactors, the conversion ratio of the fast reactors, etc.). How the system will develop will depend on a variety of factors, ranging from political to technical, rational to irrational. Because we cannot accurately predict the future, we need to understand how things could change, and what impact those changes have. Analyses of future fuel cycle systems require a number of assumptions. These include growth rates for nuclear energy, general architecture of fuel cycle
75 FR 62695 - Physical Protection of Irradiated Reactor Fuel in Transit
2010-10-13
... Irradiated Reactor Fuel in Transit AGENCY: Nuclear Regulatory Commission. ACTION: Proposed rule. SUMMARY: The... nuclear fuel in transit? H. Why require a telemetric position monitoring system or an alternative tracking... nuclear fuel in transit. The interim final rule added 10 CFR 73.37, ``Requirements for Physical Protection...
78 FR 50313 - Physical Protection of Irradiated Reactor Fuel in Transit
2013-08-19
... Irradiated Reactor Fuel in Transit AGENCY: Nuclear Regulatory Commission. ACTION: Orders; rescission. SUMMARY... the NRC published a final rule, ``Physical Protection of Irradiated Fuel in Transit,'' on May 20, 2013... of Irradiated Reactor Fuel in Transit'' (RIN 3150-AI64; NRC-2009-0163). The final rule incorporates...
Transition analysis of promising U.S. future fuel cycles using ORION - 5114
International Nuclear Information System (INIS)
Sunny, E.; Worrall, A.; Peterson, J.; Powers, J.; Gehin, J.
2015-01-01
The US Department of Energy Office of Fuel Cycle Technologies performed an evaluation and screening (E/S) study of nuclear fuel cycle options to help prioritize future research and development decisions. Previous work for this E/S study focused on establishing equilibrium conditions for analysis examples of 40 nuclear fuel cycle evaluation groups and evaluating their performance according to a set of 22 standardized metrics. Following the E/S study, additional studies are being conducted to assess transition period from the current US fuel cycle to future fuel cycle options identified by the E/S study as being most promising. These studies help inform decisions on how to effectively achieve full transition, estimate the length of time needed to undergo transition from the current fuel cycle, and evaluate performance of nuclear systems and facilities in place during the transition. These studies also help identify any barriers to achieve transition. Oak Ridge National Laboratory (ORNL) Fuel Cycle Options Campaign team used ORION to analyze the transition pathway from the existing US nuclear fuel cycle - the once-through use of low-enriched-uranium (LEU) fuel in thermal-spectrum light water reactors (LWRs) - to a new fuel cycle with continuous recycling of plutonium and uranium in sodium fast reactors (SFRs). This paper discusses the analysis of the transition from an LWR to an SFR fleet using ORION, highlights the role of lifetime extensions of existing LWRs to aid transition, and discusses how a slight delay in SFR deployment can actually reduce the time to achieve an equilibrium fuel cycle. (authors)
Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration Results: Sixth Report
2017-09-01
This report presents results of a demonstration of fuel cell electric buses (FCEBs) operating in Oakland, California. Alameda-Contra Costa Transit District (AC Transit) leads the Zero Emission Bay Area (ZEBA) demonstration that includes 13 advanced-d...
CIEMAT analyses of transition fuel cycle scenarios
International Nuclear Information System (INIS)
Alvarez-Velarde, F.; Gonzalez-Romero, E.M.
2010-01-01
The efficient design of strategies for the long-term sustainability of nuclear energy or the phase-out of this technology is possible after the study of transition scenarios from the current fuel cycle to a future one with advanced technologies and concepts. CIEMAT has participated in numerous fuel cycle scenarios studies for more than a decade and, from some years ago, special attention has been put in the study of transition scenarios. In this paper, the main characteristics of each studied transition scenario are described. The main results and partial conclusions of each scenario are also analyzed. As general conclusions of transition studies, we highlight that the advantages of advanced technologies in transition scenarios can be obtained by countries or regions with sufficiently large nuclear parks, with a long-term implementation of the strategy. For small countries, these advantages are also accessible with an affordable cost, by means of the regional collaboration during several decades. (authors)
Core analysis during transition from 37-element fuel to CANFLEX-NU fuel in CANDU 6
Energy Technology Data Exchange (ETDEWEB)
Jeong, Chang Joon; Suk, Ho Chun [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
1999-12-31
An 1200-day time-dependent fuel-management for the transition from 37-element fuel to CANFLEX-NU fuel in a CANDU 6 reactor has been simulated to show the compatibility of the CANFLEX-NU fuel with the reactor operation. The simulation calculations were carried out with the RFSP code, provided by cell averaged fuel properties obtained from the POWDERPUFS-V code. The refueling scheme for both fuels was an eight bundle shift at a time. The simulation results show that the maximum channel and bundle powers were maintained below the license limit of the CANDU 6. This indicates that the CANFLEX-NU fuel bundle is compatible with the CANDU 6 reactor operation during the transition period. 3 refs., 2 figs., 1 tab. (Author)
Core analysis during transition from 37-element fuel to CANFLEX-NU fuel in CANDU 6
Energy Technology Data Exchange (ETDEWEB)
Jeong, Chang Joon; Suk, Ho Chun [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
1998-12-31
An 1200-day time-dependent fuel-management for the transition from 37-element fuel to CANFLEX-NU fuel in a CANDU 6 reactor has been simulated to show the compatibility of the CANFLEX-NU fuel with the reactor operation. The simulation calculations were carried out with the RFSP code, provided by cell averaged fuel properties obtained from the POWDERPUFS-V code. The refueling scheme for both fuels was an eight bundle shift at a time. The simulation results show that the maximum channel and bundle powers were maintained below the license limit of the CANDU 6. This indicates that the CANFLEX-NU fuel bundle is compatible with the CANDU 6 reactor operation during the transition period. 3 refs., 2 figs., 1 tab. (Author)
Safety issues in urban transit facilities for hydrogen-fueled buses
International Nuclear Information System (INIS)
Hay, R.H.; Ducharme, P.
2004-01-01
'Full text:' The Canadian Transportation Fuel Cell Alliance (CTFCA), created by the Canadian Government as part of its 2000 Climate Change Action Plan, has commissioned MARCON-DDM's Hydrogen Intervention Team (HIT) to provide a roadmap for urban transit systems that wish to move to hydrogen fuel cell-powered bus fleets. HIT is currently in the process of gathering information from hydrogen technology providers, bus manufacturers, fuelling system providers and urban transit systems in Canada, the US and Europe. In September, HIT will be in a position to provide a hands-on perspective of the introduction of fuel-cell buses in the Canadian environment. Part of the process of adding hydrogen-fueled busses to urban transit systems involves phasing in the new technology to minimize the economic cost. This involves substituting hydrogen buses into the normal bus procurement life cycle and maximizing the use of existing facilities for garaging, maintenance and fueling. Using a schematic outline of an urban transit system, this presentation will outline the safety issues specific to hydrogen in such systems, particularly for garaging, maintenance and fueling components. It will then outline how safety of these component is addressed in current and proposed codes, standards and recommended practices. Based on these requirements the impact of the introduction of hydrogen-fueled buses on each component of the transit system will be addressed in terms of the adaptations of current facilities and practices or the requirements for new facilities and practices. (author)
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2010
2010-11-11
This past year has been one of transition for the introduction of fuel cell transit buses. The existing generation of fuel cell buses from Van Hool and UTC Power has continued to operate in service at three transit agencies. At the same time, a new g...
Connecticut Transit (CTTRANSIT) Fuel Cell Transit Bus: Third Evaluation Report and Appendices
Energy Technology Data Exchange (ETDEWEB)
Chandler, K.; Eudy, L.
2010-01-01
This report describes operations at Connecticut Transit (CTTRANSIT) in Hartford for one prototype fuel cell bus and three new diesel buses operating from the same location. The prototype fuel cell bus was manufactured by Van Hool and ISE Corp. and features an electric hybrid drive system with a UTC Power PureMotion 120 Fuel Cell Power System and ZEBRA batteries for energy storage. The fuel cell bus started operation in April 2007, and evaluation results through October 2009 are provided in this report.
Energy Technology Data Exchange (ETDEWEB)
2017-05-22
The Federal Transit Administration's National Fuel Cell Bus Program focuses on developing commercially viable fuel cell bus technologies. Nuvera is leading the Massachusetts Fuel Cell Bus project to demonstrate a complete transit solution for fuel cell electric buses that includes one bus and an on-site hydrogen generation station for the Massachusetts Bay Transportation Authority (MBTA). A team consisting of ElDorado National, BAE Systems, and Ballard Power Systems built the fuel cell electric bus, and Nuvera is providing its PowerTap on-site hydrogen generator to provide fuel for the bus.
The development of spent fuel storage process equipment
International Nuclear Information System (INIS)
Yoon, Wan Ki; Kim, Ho Dong; Kim, Ki Joon; Kim, Bum Hoe
1992-02-01
A nuclear material accounting system were designed to track the transitions of nuclear materials at the spent-fuel technology research facility. It is embedded in a distributed control system real-time structure of the system gives timely on-line accountancy. And performance of AC servo motor with fuzzy logic control and its applicability to spent fuel management were experimentally evaluated. (Author)
Hidden transition in multiferroic and magnetodielectric CuCrO2 evidenced by ac-susceptibility
Shukla, Kaushak K.; Pal, Arkadeb; Singh, Abhishek; Singh, Rahul; Saha, J.; Sinha, A. K.; Ghosh, A. K.; Patnaik, S.; Awasthi, A. M.; Chatterjee, Sandip
2017-04-01
Ferroelectric polarization, magnetic-field dependence of the dielectric constant and ac and dc magnetizations of frustrated CuCrO2 have been measured. A new spin freezing transition below 32 K is observed which is thermally driven. The nature of the spin freezing is to be a single-ion process. Dilution by the replacements of Cr ions by magnetic Mn ions showed suppression of the spin freezing transition suggesting it to be fundamentally a single-ion freezing process. The observed freezing, which is seemingly associated to geometrical spin frustration, represents a novel form of magnetic glassy behavior.
Electrocatalysis and kinetics of the direct alcohol fuel cells. DEMS and ac voltammetry studies
Energy Technology Data Exchange (ETDEWEB)
Othman Mostafa, Ehab Mostafa
2013-01-11
For the direct methanol fuel cell (DMFC) operating at low temperature, the main problem that arises at the anode is its poisoning (deactivation) due to the accumulation of the fuel adsorption product (CO{sub ad}) which can only be oxidized at high potentials (> 0.7 V). For low temperature direct ethanol fuel cells (DEFCs), the main problem that arises at the anode, beside its poisoning by ethanol adsorption products (CO{sub ad} and CH{sub x,ad}), is the incomplete ethanol oxidation due to the difficulty of (C-C) bond breaking. In the previous types of fuel cells, a sluggish oxygen reduction reaction (ORR) kinetics was observed at the cathode which results in a large voltage drop. Such behavior is due to strong inhibition of the cathodic ORR, resulting in high overpotentials and therefore, significant deterioration in the energy conversion efficiency of the cell. The slow kinetic behavior stems from the difficulty of (O=O) bond breaking. In order to model the conditions of continuous oxidation/reduction in a fuel cell, the continuous mass transfer to the electrode surface is necessary. Therefore, mass spectrometry and AC voltammetry measurements presented here were done using the thin layer flow through cell. This thesis aims at a determination of the rate constant of single reaction steps during the oxidation of CO, methanol and ethanol at different platinum surfaces. Towards that aim, I investigated the electrocatalytic oxidation and adsorption rate of methanol (chapter 3) and the electrocatalytic oxidation of ethanol (chapter 4) at different Pt surfaces, using DEMS. In chapter 5, the potential dependence of the bulk and adsorbed methanol oxidation reaction rate (presented by the apparent transfer coefficient, {alpha}') and the corresponding Tafel slope of the reaction have been determined under convection conditions using a potential modulation ac voltammetry technique. Finally, as an application of the method presented in chapter 5, my work in chapter 6
Transition from uranium to denatured uranium/thorium fuel in an existing PWR
International Nuclear Information System (INIS)
Walters, M.A.
1982-01-01
The purpose of this research was to determine whether it is possible to make a gradual transition from uranium to denatured uranium/thorium (DUTH) fuel in an existing PWR by adding DUTH assemblies during each scheduled refueling and, if the transition is possible, to develop a general procedure for making it. The feasibility of the transition was established by identifying acceptable refueling schemes for a series of transition cores, and in the process, a method for identifying acceptable schemes evolved. The utility of the method was then demonstrated by applying it to a standard reactor operating under normal conditions. The vehicle used to examine proposed fuel mixtures and to select acceptable ones was a set of one-dimensional computer codes. The core was modeled as a set of five concentric fuel zones with a reflector. Fuel mixtures were proposed and the computer codes were used to determine whether a mixture was acceptable, i.e., whether it had the desired k-effective and flux and power distributions. The parameters allowed to vary in selection of proposed fuel mixtures were enrichment of fresh fuel assemblies, number of uranium and DUTH assemblies added during each refueling, and distribution of fuel in the core. Results of the research showed that a gradual transition is possible. Furthermore, there is a method that allows the identification of fuel mixtures that are likely to be acceptable. It requires the calculation of K-infinity for the entire proposed core and for some of its regions. These values of K-infinity and relationships developed in this research can be used to predict the flux distribution and the final k-effective for the proposed fuel mixture
Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration Results: Fifth Report
Energy Technology Data Exchange (ETDEWEB)
Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jeffers, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2016-06-01
This report presents results of a demonstration of fuel cell electric buses (FCEB) operating in Oakland, California. Alameda-Contra Costa Transit District (AC Transit) leads the Zero Emission Bay Area (ZEBA) demonstration, which includes 13 advanced-design fuel cell buses and two hydrogen fueling stations. The ZEBA partners are collaborating with the U.S. Department of Energy (DOE) and DOE's National Renewable Energy Laboratory (NREL) to evaluate the buses in revenue service. NREL has published four previous reports describing operation of these buses. This report presents new and updated results covering data from January 2015 through December 2015.
Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration Results: Sixth Report
Energy Technology Data Exchange (ETDEWEB)
Eudy, Leslie [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Post, Matthew B. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Jeffers, Matthew A. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-09-11
This report presents results of a demonstration of fuel cell electric buses (FCEB) operating in Oakland, California. Alameda-Contra Costa Transit District (AC Transit) leads the Zero Emission Bay Area (ZEBA) demonstration, which includes 13 advanced-design fuel cell buses and two hydrogen fueling stations. The ZEBA partners are collaborating with the U.S. Department of Energy (DOE) and DOE's National Renewable Energy Laboratory (NREL) to evaluate the buses in revenue service. NREL has published five previous reports describing operation of these buses. This report presents new and updated results covering data from January 2016 through December 2016.
Effect of alkali content on AC conductivity of borate glasses containing two transition metals
International Nuclear Information System (INIS)
Kashif, I.; Rahman, Samy A.; Soliman, A.A.; Ibrahim, E.M.; Abdel-Khalek, E.K.; Mostafa, A.G.; Sanad, A.M.
2009-01-01
Sodium borate glasses containing iron and molybdenum ions with the total concentration of transition ions constant and gradual substitution of sodium oxide (network modifier) by borate oxide (network former) was prepared. Densities, molar volume, DC and AC conductivities are measured. The trends of these properties are attributed to changes in the glass network structure. Their DC and AC conductivity increased with increasing NaO concentration. The increase of AC conductivity of sodium borate glasses is attributed to the chemical composition and the hopping mechanism of conduction. Measurements of the dielectric constant (ε) and dielectric loss (tan δ) as a function of frequency (50 Hz-100 kHz) and temperature (RT-600 K) indicate that the increase in dielectric constant and loss (ε and tan δ) values with increasing sodium ion content could be attributed to the assumption that Fe and Mo ions tend to assume network-forming position in the glass compositions studied. The variation of the value of frequency exponent s for all glass samples as the function of temperature at a definite frequency indicates that the value of s decreases with increasing the temperature which agrees with the correlated barrier-hopping (CBH) model.
Using Checklists to Assess Your Transition to Alternative Fuels: A Technical Reference
Energy Technology Data Exchange (ETDEWEB)
Risch, C. E. [Argonne National Lab. (ANL), Argonne, IL (United States); Santini, D. J. [Argonne National Lab. (ANL), Argonne, IL (United States); Johnson, L. R. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-12-01
The Checklist for Transition to New Alternative Fuel(s) was published in September 2011 by Chuck Risch and Dan Santini. Many improvements, described below, have been incorporated into this current document, Checklists for Assessing the Transitions to New Highway Fuels.2 Further, the original authors and Larry Johnson, co-author of the current report, identified a need for a succinct version of the full report and prepared a brochure based on it to aid busy decisionmakers: Check It Out: Using Checklists to Assess Your Transition to Alternative Fuels.2 These checklists are tools for those stakeholders charged with determining a feasible alternative fuel or fuels for highway transportation systems of the future. The original had four major players whose needs had to be satisfied for a successful transition. The term “activist,” intended to encompass environmental and other special interests, was included in the “customers” category. Activists are customers of the government in the sense that they organize citizens to exert political pressure to regulate the design of vehicles, fuel infrastructure, and roadway networks. Many who evaluate alternative fuels view activists, particularly environmental activists, as a separate category. Further, “activist” has become a pejorative term to many people. Therefore, we have used the word “advocate” or “activist/advocate” instead. Thus, in this update we recognize that environmental and other activists/advocates have been--and will continue to be--a powerful force promoting change in the nature of the fuels that are used in transportation.
Transitioning aluminum clad spent fuels from wet to interim dry storage
International Nuclear Information System (INIS)
Louthan, M.R. Jr.; Iyer, N.C.; Sindelar, R.L.; Peacock, H.B. Jr.
1994-01-01
The United States Department of Energy (DOE) currently owns several hundred metric tons of aluminum clad, spent nuclear fuel and target assemblies. The vast majority of these irradiated assemblies are currently stored in water basins that were designed and operated for short term fuel cooling prior to fuel reprocessing. Recent DOE decisions to severely limit the reprocessing option have significantly lengthened the time of storage, thus increasing the tendency for corrosion induced degradation of the fuel cladding and the underlying core material. The portent of continued corrosion, coupled with the age of existing wet storage facilities and the cost of continuing basin operations, including necessary upgrades to meet current facility standards, may force the DOE to transition these wet stored, aluminum clad spent fuels to interim dry storage. The facilities for interim dry storage have not been developed, partially because fuel storage requirements and specifications for acceptable fuel forms are lacking. In spite of the lack of both facilities and specifications, current plans are to dry store fuels for approximately 40 to 60 years or until firm decisions are developed for final fuel disposition. The transition of the aluminum clad fuels from wet to interim dry storage will require a sequence of drying and canning operations which will include selected fuel preparations such as vacuum drying and conditioning of the storage atmosphere. Laboratory experiments and review of the available literature have demonstrated that successful interim dry storage may also require the use of fuel and canister cleaning or rinsing techniques that preclude, or at least minimize, the potential for the accumulation of chloride and other potentially deleterious ions in the dry storage environment. This paper summarizes an evaluation of the impact of fuel transitioning techniques on the potential for corrosion induced degradation of fuel forms during interim dry storage
A seismic analysis of Korean standard PWR fuels under transition core conditions
International Nuclear Information System (INIS)
Kim, Hyeong Koo; Park, Nam Kyu; Jang, Young Ki; Kim, Jae Ik; Kim, Kyu Tae
2005-01-01
The PLUS7 fuel is developed to achieve higher thermal performance, burnup and more safety margin than the conventional fuel used in the Korean Standard Nuclear Plants (KSNPs) and to sustain structural integrity under increased seismic requirement in Korea. In this study, a series of seismic analysis have been performed in order to evaluate the structural integrity of fuel assemblies associated with seismic loads in the KSNPs under transition core conditions replacing the Guardian fuel, which is a resident fuel in the KSNP reactors, with the PLUS7 fuel. For the analysis, transition core seismic models have been developed, based on the possible fuel loading patterns. And the maximum impact forces on the spacer grid and various stresses acting on the fuel components have been evaluated and compared with the through-grid strength of spacer grids and the stress criteria specified in the ASME code for each fuel component, respectively. Then three noticeable parameters regarding as important parameters governing fuel assembly dynamic behavior are evaluated to clarify their effects on the fuel impact and stress response. As a result of the study, it has been confirmed that both the PLUS7 and the Guardian fuel sustain their structural integrity under the transition core condition. And when the damping ratio is constant, increasing the natural frequency of fuel assembly results in a decrease in impact force. The fuel assembly flexural stiffness has an effect increasing the stress of fuel assembly, but not the impact force. And the spacer grid stiffness is directly related with the impact force response. (author)
Thermal-hydraulic effects of transition to improved System 80TM fuel
International Nuclear Information System (INIS)
Rodack, T.; Joffre, P.F.; Kapoor, R.K.
2004-01-01
ABB CE's improved System 80 TM PWR fuel design includes GUARDIAN debris-resistant features and laser-welded Zircaloy grids. The GUARDIAN features include an Inconel grid with debris-filtering features located just above the Lower End Fitting, and a solid fuel rod bottom end cap that extends above the filtering features. Tests and analyses were done to establish the impact of these design improvements on fuel assembly hydraulic performance. Further analysis was done to determine the mixed core thermal-hydraulic performance as the transition is made over two fuel cycles to a full core of the improved System 80 TM fuel. Results confirm that the Thermal-Hydraulic (T-H) effects of the reduction in hydraulic resistance between the improved and resident fuel due to the laser-welded Zircaloy grids offsets the effects of the increased resistance GUARDIAN grid. Therefore, the mechanically improved System 80 TM fuel can be implemented with no net impact on Departure from Nucleate Boiling (DNB) margin in transition cores. (author)
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2013
Energy Technology Data Exchange (ETDEWEB)
Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Gikakis, Christina [Federal Transit Administration, Washington, DC (United States)
2013-12-01
This report is the seventh in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. The report also provides a snapshot of current FCEB performance results from August 2012 through July 2013 for five FCEB demonstrations at four transit agencies.
10 CFR 73.37 - Requirements for physical protection of irradiated reactor fuel in transit.
2010-01-01
... fuel in transit. 73.37 Section 73.37 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) PHYSICAL PROTECTION OF PLANTS AND MATERIALS Physical Protection of Special Nuclear Material in Transit § 73.37 Requirements for physical protection of irradiated reactor fuel in transit. (a) Performance objectives. (1...
Lim, Seungjae
2015-04-01
The effect of electric field on the characteristics of flame spread along a polyethylene (PE) insulated electrical wire was investigated experimentally by varying the AC frequency and voltage applied to the wire. The results showed that the flame spread rate was accelerated due to the convergence of electric flux near the end of wire, having three distinct regimes depending on applied voltage. In each regime, several subregimes could be identified depending on AC frequency. Flame shape (height and width) and slanted direction of the spreading flame were influenced differently. Fuel-vapor jets were ejected from the molten PE surface even for the baseline case without the application of an electric field; this could be attributed to the bursting of fuel vapor bubbles generated from internal boiling at the molten PE surface. An internal circulation of molten-PE was also observed as a result of non-uniform heating by the spreading flame. In the high voltage regime with a high AC frequency, excessive dripping of molten PE led to flame extinction.
Transitioning to a Hydrogen Future: Learning from the Alternative Fuels Experience
Energy Technology Data Exchange (ETDEWEB)
Melendez, M.
2006-02-01
This paper assesses relevant knowledge within the alternative fuels community and recommends transitional strategies and tactics that will further the hydrogen transition in the transportation sector.
BC Transit Fuel Cell Bus Project: Evaluation Results Report
Energy Technology Data Exchange (ETDEWEB)
Eudy, L. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2014-02-01
This report evaluates a fuel cell electric bus demonstration led by British Columbia Transit (BC Transit) in Whistler, Canada. BC Transit is collaborating with the California Air Resources Board and the U.S. Department of Energy's National Renewable Energy Laboratory to evaluate the buses in revenue service. This evaluation report covers two years of revenue service data on the buses from April 2011 through March 2013.
An evaluation of alternative fuels usage by public transit agencies.
2009-12-01
The oil crisis of the 1970s forced Americans to reconsider using fossil fuels as a primary energy source. In : the public transit arena, private transit companies found themselves unable to compete in the urban : environment as rapidly rising oil pri...
Leveraging Fuel Subsidy Reform for Transition in Yemen
Clemens Breisinger; Wilfried Engelke; Olivier Ecker
2012-01-01
Yemen is currently undergoing a major political transition, yet many economic challenges—including fuel subsidy reform—remain highly relevant. To inform the transition process with respect to a potential subsidy reform, we use a dynamic computable general equilibrium and microsimulation model for Yemen; we show that overall growth effects of subsidy reduction are positive in general, but poverty can increase or decrease depending on reform design. A promising strategy for ...
Irradiation and examination results of the AC-3 mixed-carbide test
International Nuclear Information System (INIS)
Mason, R.E.; Hoth, C.W.; Stratton, R.W.; Botta, F.
1992-01-01
The AC-3 test was a cooperative Swiss/US irradiation test of mixed-carbide, (U,Pr)C, fuel pins in the Fast Flux Test Facility. The test included 25 Swiss-fabricated sphere-pac-type fuel pins and 66 U.S. fabricated pellet-type fuel pins. The test was designed to operate at prototypical fast reactor conditions to provide a direct comparison of the irradiation performance of the two fuel types. The test design and fuel fabrication processes used for the AC-3 test are presented
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration: First Results Report
Energy Technology Data Exchange (ETDEWEB)
Chandler, K.; Eudy, L.
2011-08-01
This report documents the early implementation experience for the Zero Emission Bay Area (ZEBA) Demonstration, the largest fleet of fuel cell buses in the United States. The ZEBA Demonstration group includes five participating transit agencies: AC Transit (lead transit agency), Santa Clara Valley Transportation Authority (VTA), Golden Gate Transit (GGT), San Mateo County Transit District (SamTrans), and San Francisco Municipal Railway (Muni). The ZEBA partners are collaborating with the U.S. Department of Energy (DOE) and DOE's National Renewable Energy Laboratory (NREL) to evaluate the buses in revenue service.
Fuel Cell Buses in U.S. Transit Fleets : Current Status 2014
2014-12-03
This report, published annually, summarizes the progress of fuel cell electric bus (FCEB) development in the United States and discusses the achievements and challenges of introducing fuel cell propulsion in transit. Various stakeholders, including d...
Analysis of fuel cycle strategies and U.S. transition scenarios
Energy Technology Data Exchange (ETDEWEB)
Wigeland, Roald; Taiwo, Temitope A.
2016-10-17
The nuclear fuel cycle Evaluation and Screening (E&S) study that was completed in October 2014 [1] enabled the identification of four fuel cycle groups that are considered most promising based on a set of nine evaluation criteria: (a) six benefit criteria of Nuclear Waste Management, Proliferation Risk, Nuclear Material Security Risk, Safety, Environmental Impact, Resource Utilization, and (b) three challenge criteria of Development and Deployment Risk, Institutional Issues, Financial Risk and Economics. The E&S study was conducted at a level of analysis that is "technology- neutral," that is, without consideration of specific technologies, but using the fundamental physics characteristics of each part of the fuel cycle. The study focused on the fuel cycle performance benefits at the fuel cycle equilibrium state, with only limited consideration of transition and deployment impacts. Common characteristics of the four most promising fuel cycle options include continuous recycle of all U/Pu or U/TRU, the use of fast-spectrum reactors, and no use of uranium enrichment once fuel cycle equilibrium has been established. The high-level wastes are mainly from processing of irradiated fuel, and there would be no disposal of any spent fuel. Building on the findings of the E&S study, additional studies have been conducted in the last two years following the information exchange meeting, the 13th IEMPT, which was held in Seoul, the Republic of Korea in 2014. Insights are presented from the recent studies on the benefits and challenges of recycling minor actinides, and transition considerations to some of the most promising fuel cycle options.
Leveraging Fuel Subsidy Reform for Transition in Yemen
Directory of Open Access Journals (Sweden)
Olivier Ecker
2012-10-01
Full Text Available Yemen is currently undergoing a major political transition, yet many economic challenges—including fuel subsidy reform—remain highly relevant. To inform the transition process with respect to a potential subsidy reform, we use a dynamic computable general equilibrium and microsimulation model for Yemen; we show that overall growth effects of subsidy reduction are positive in general, but poverty can increase or decrease depending on reform design. A promising strategy for a successful reform combines fuel subsidy reduction with direct income transfers to the poorest one-third of households during reform, and productivity-enhancing investment in infrastructure, plus fiscal consolidation. Public investments should be used for integrating economic spaces and restructuring of agricultural, industrial and service value chains in order to create a framework that encourages private-sector-led and job-creating growth.
Fuel Cell Buses in U.S. Transit Fleets : Current Status 2015
2015-12-01
This report, published annually, summarizes the progress of fuel cell electric bus (FCEB) development in the United States and discusses the achievements and challenges of introducing fuel cell propulsion in transit. The report provides a summary of ...
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2017
2017-11-01
This report, published annually, summarizes the progress of fuel cell electric bus (FCEB) development in the United States and discusses the achievements and challenges of introducing fuel cell propulsion in transit. The report provides a summary of ...
Transition cycle fuel management problems of NPP Krsko
International Nuclear Information System (INIS)
Petrovic, B.; Pevec, D.; Smuc, T.; Urli, N.
1989-01-01
Transition cycle fuel management problems are described and illustrated using results and experience attained during core reload design of NPP Krsko. Improved version of computer code package PSU-LEOPARD/Mcrac is successfully applied to NPP Krsko loading pattern design. (author)
Fuel Cell Buses in U.S. Transit Fleets : Current Status 2013
2013-12-01
This report is the seventh in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. This r...
Fuel Cell Buses in U.S. Transit Fleets : Current Status 2012
2012-11-12
This report is the sixth in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. The repo...
International Nuclear Information System (INIS)
Xu, Yanzhi; Gbologah, Franklin E.; Lee, Dong-Yeon; Liu, Haobing; Rodgers, Michael O.; Guensler, Randall L.
2015-01-01
Highlights: • We present a practical fuel and emissions modeling tool for alternative fuel buses. • The model assesses well-to-wheels emissions impacts of bus fleet decisions. • Mode-based approach is used to account for duty cycles and local conditions. • A case study using real-world operations data from Atlanta, GA is presented. • Impacts of alternative bus options depend on operating and geographic features. - Abstract: Hybrid and electric powertrains and alternative fuels (e.g., compressed natural gas (CNG), biodiesel, or hydrogen) can often reduce energy consumption and emissions from transit bus operations relative to conventional diesel. However, the magnitude of these energy and emissions savings can vary significantly, due to local conditions and transit operating characteristics. This paper introduces the transit Fuel and Emissions Calculator (FEC), a mode-based life-cycle emissions modeling tool for transit bus and rail technologies that compares the performance of multiple alternative fuels and powertrains across a range of operational characteristics and conditions. The purpose of the FEC is to provide a practical, yet technically sophisticated tool for regulatory agencies and policy analysts in assessing transit fleet options. The FEC’s modal modeling approach estimates emissions as a function of engine load, which in turn is a function of transit service parameters, including duty cycle (idling and speed-acceleration profile), road grade, and passenger loading. This approach allows for customized assessments that account for local conditions. Direct emissions estimates are derived from the scaled tractive power (STP) operating mode bins and emissions factors employed in the U.S. EPA’s MOVES (MOtor Vehicle Emissions Simulator) model. Life-cycle emissions estimates are calculated using emissions factors from the GREET (Greenhouse Gases, Regulated Emissions, and Energy Use in Transportation) model. The case study presented in this paper
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2011
2011-11-11
his report is the fifth in a series of annual status reports that summarize the progress resulting from fuel cell transit bus demonstrations in the United States and provide a discussion of the achievements and challenges of fuel cell propulsion in t...
Connecticut Transit (CTTRANSIT) Fuel Cell Transit Bus: Second Evaluation Report and Appendices
Energy Technology Data Exchange (ETDEWEB)
Chandler, K.; Eudy, L.
2009-05-01
This report describes operations at Connecticut Transit (CTTRANSIT) in Hartford for one prototype fuel cell bus and three new diesel buses operating from the same location. The evaluation period in this report (January 2008 through February 2009) has been chosen to coincide with a UTC Power propulsion system changeout that occurred on January 15, 2008.
International Nuclear Information System (INIS)
Kumar, Santosh; Singh, Ravi P.; Thamizhavel, A.; Tomy, C.V.; Grover, A.K.
2014-01-01
Highlights: • This work pertains to new findings related to a broad SMP anomaly. • Broad SMP prima facie encompasses two phase transformations in vortex matter. • We demarcated two phase boundaries pertaining to order–disorder transitions which have quasi first-order nature. - Abstract: We present distinct demarcation of the Bragg glass (BG) to multi-domain vortex glass (VG) transition line and the eventual amorphization of the VG phase in a weakly pinned single crystal of the superconducting compound Ca 3 Ir 4 Sn 13 on the basis of comprehension of the different yields about the second magnetization peak (SMP) anomaly in the dc magnetization and the corresponding anomalous feature in the ac susceptibility measurements. The shaking by a small ac magnetic field, inevitably present in the ac susceptibility measurements, is seen to result in contrasting responses in two different portions of the field-temperature (H, T) phase space of the multi-domain VG. In one of the portions, embracing the BG to VG transition across the onset of the SMP anomaly, the ac drive is surprisingly seen to assist the transformation of the well ordered BG phase to a lesser ordered VG phase. The BG phase exists as a superheated state over a small portion of the VG space and this attests to the first order nature of the BG to VG transition
Speeding the transition: Designing a fuel-cell hypercar
Energy Technology Data Exchange (ETDEWEB)
Williams, B.D.; Moore, T.C.; Lovins, A.B. [Rocky Mountain Inst., Snowmass, CO (United States). Hypercar Center
1997-12-31
A rapid transformation now underway in automotive technology could accelerate the transition to transportation powered by fuel cells. Ultralight, advanced-composite, low-drag, hybrid-electric hypercars--using combustion engines--could be three- to fourfold more efficient and one or two orders of magnitude cleaner than today`s cars, yet equally safe, sporty, desirable, and (probably) affordable. Further, important manufacturing advantages--including low tooling and equipment costs, greater mechanical simplicity, autobody parts consolidation, shorter product cycles, and reduced assembly effort and space--permit a free-market commercialization strategy. This paper discusses a conceptual hypercar powered by a proton-exchange-membrane fuel cell (PEMFC). It outlines the implications of platform physics and component selection for the vehicle`s mass budget and performance. The high fuel-to-traction conversion efficiency of the hypercar platform could help automakers overcome the Achilles` heel of hydrogen-powered vehicles: onboard storage. Moreover, because hypercars would require significantly less tractive power, and even less fuel-cell power, they could adopt fuel cells earlier, before fuel cells` specific cost, mass, and volume have fully matured. In the meantime, commercialization in buildings can help prepare fuel cells for hypercars. The promising performance of hydrogen-fueled PEMFC hypercars suggests important opportunities in infrastructure development for direct-hydrogen vehicles.
Optimization analysis of the nuclear fuel cycle transition to the last core
International Nuclear Information System (INIS)
Rebollo, L.; Blanco, J.
2001-01-01
The Zorita NPP was the first Spanish commercial nuclear reactor connected to the grid. It is a 160 MW one loop PWR, Westinghouse design, owned by UFG, in operation since 1968. The configuration of the reactor core is based on 69 fuel elements type 14 x 14, the standard reload of the present equilibrium cycle being based on 16 fuel elements with 3.6% enrichment in 235 U. In order to properly plan the nuclear fuel management of the transition cycles to its end of life, presently foreseen by 2008, an based on the non-reprocessing option required by the policy of the Spanish Administration, a technical-economical optimization analysis has been performed. As a result, a fuel management strategy has been defined looking for getting simultaneously the minimum integral fuel cost of the transition from the present equilibrium cycle to the last core, as well as the minimum residual worth of the fuel remaining in the core after the final outage. Based on the ''lessons learned'' derived from the study, the time margin for the decision making has been determined, and a planning of the nuclear fuel supply for the transition reloads, specifying both the number of fuel elements and their enrichment in 235 U, as been prepared. Finally, based on the calculated economical worth of the partially burned fuel of the last core, after the end of its operation cycle, a financial cover for yearly compensation from now on of the foreseen final lost has been elaborated. Most of the conceptual conclusions obtained are applicable to the other commercial nuclear reactors in operation owned by UFG, so that they are understood to be of general interest and broad application to commercial PWR. (author)
Nuclear structure of {sup 231}Ac
Energy Technology Data Exchange (ETDEWEB)
Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)
2008-10-15
The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.
Bubna, Piyush; Brunner, Doug; Gangloff, John J.; Advani, Suresh G.; Prasad, Ajay K.
The fuel cell hybrid bus (FCHB) program was initiated at the University of Delaware in 2005 to demonstrate the viability of fuel cell vehicles for transit applications and to conduct research and development to facilitate the path towards their eventual commercialization. Unlike other fuel cell bus programs, the University of Delaware's FCHB design features a battery-heavy hybrid which offers multiple advantages in terms of cost, performance and durability. The current fuel cell hybrid bus is driven on a regular transit route at the University of Delaware. The paper describes the baseline specifications of the bus with a focus on the fuel cell and the balance of plant. The fuel cell/battery series-hybrid design is well suited for urban transit routes and provides key operational advantages such as hydrogen fuel economy, efficient use of the fuel cell for battery recharging, and regenerative braking. The bus is equipped with a variety of sensors including a custom-designed cell voltage monitoring system which provide a good understanding of bus performance under normal operation. Real-time data collection and analysis have yielded key insights for fuel cell bus design optimization. Results presented here illustrate the complex flow of energy within the various subsystems of the fuel cell hybrid bus. A description of maintenance events has been included to highlight the issues that arise during general operation. The paper also describes several modifications that will facilitate design improvements in future versions of the bus. Overall, the fuel cell hybrid bus demonstrates the viability of fuel cells for urban transit applications in real world conditions.
Comparison of Gasoline and Primary Reference Fuel in the Transition from HCCI to PPC
Li, Changle
2017-10-10
Our previous research investigated the sensitivity of combustion phasing to intake temperature and injection timing during the transition from homogeneous charge compression ignition (HCCI) to partially premixed combustion (PPC) fuelled with generic gasoline. The results directed particular attention to the relationship between intake temperature and combustion phasing which reflected the changing of stratification level with the injection timing. To confirm its applicability with the use of different fuels, and to investigate the effect of fuel properties on stratification formation, primary reference fuels (PRF) were tested using the same method: a start of injection sweep from -180° to -20° after top dead center with constant combustion phasing by tuning the intake temperature. The present results are further developed compared with those of our previous work, which were based on generic gasoline. In the present work, a three-stage fuel-air stratification development process was observed during the transition from HCCI to PPC. Moreover, a transition stage was observed between the HCCI and PPC stages. Within this transition stage, both the combustion and emission characteristics deteriorated. The allocation of this transition area was mainly determined by the geometric design of the fuel injector and combustion chamber. Some differences in charge stratification were observed between the PRF and gasoline. The NO emissions of the PRF were comparable to those of gasoline. However, the NO emissions surged during the transition stage, indicating that the PRF combustion was probably more stratified. The soot emissions from PRF and gasoline were both much higher in the PPC than the HCCI mode, though the PRF produced much less soot than did gasoline in the PPC mode.
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2012
Energy Technology Data Exchange (ETDEWEB)
Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Chandler, Kevin [Battelle, Columbus, OH (United States); Gikakis, Christina [Federal Transit Administration, Washington, DC (United States)
2012-11-01
This report is the sixth in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. The report also provides a snapshot of current FCEB performance results over the last year.
Energy Technology Data Exchange (ETDEWEB)
Bubna, Piyush; Brunner, Doug; Gangloff, John J. Jr.; Advani, Suresh G.; Prasad, Ajay K. (Center for Fuel Cell Research, Department of Mechanical Engineering, University of Delaware, Newark, DE 19716 United States)
2010-06-15
The fuel cell hybrid bus (FCHB) program was initiated at the University of Delaware in 2005 to demonstrate the viability of fuel cell vehicles for transit applications and to conduct research and development to facilitate the path towards their eventual commercialization. Unlike other fuel cell bus programs, the University of Delaware's FCHB design features a battery-heavy hybrid which offers multiple advantages in terms of cost, performance and durability. The current fuel cell hybrid bus is driven on a regular transit route at the University of Delaware. The paper describes the baseline specifications of the bus with a focus on the fuel cell and the balance of plant. The fuel cell/battery series-hybrid design is well suited for urban transit routes and provides key operational advantages such as hydrogen fuel economy, efficient use of the fuel cell for battery recharging, and regenerative braking. The bus is equipped with a variety of sensors including a custom-designed cell voltage monitoring system which provide a good understanding of bus performance under normal operation. Real-time data collection and analysis have yielded key insights for fuel cell bus design optimization. Results presented here illustrate the complex flow of energy within the various subsystems of the fuel cell hybrid bus. A description of maintenance events has been included to highlight the issues that arise during general operation. The paper also describes several modifications that will facilitate design improvements in future versions of the bus. Overall, the fuel cell hybrid bus demonstrates the viability of fuel cells for urban transit applications in real world conditions. (author)
Transition Towards a Sustainable Nuclear Fuel Cycle
International Nuclear Information System (INIS)
McCarthy, K.; Romanello, V.; Schwenk-Ferrero, A.; Vezzoni, B.; Gabrielli, F.; Maschek, W.; Rineiski, A.; Salvatores, M.
2013-01-01
To support the evaluation of R and D needs and relevant technology requirements for future nuclear fuel cycles, the OECD/NEA WPFC Expert Group on Advanced Fuel Cycle Scenarios was created in 2010, replacing the WPFC Expert Group on Fuel Cycle Transition Scenario Studies (1) to assemble, organise and understand the scientific issues of advanced fuel cycles and (2) to provide a framework for assessing specific national needs related to the implementation of advanced fuel cycles. In this framework, a simulation of world transition scenarios towards possible future fuel cycles with fast reactors has been performed, using both a homogeneous and a heterogeneous approach involving different world regions. In fact, it has been found that a crucial feature of any world scenario study is to provide not only trends for an idealised 'homogeneous' description of the world, but also trends for different regions in the world, selected with simple criteria (mostly of geographical type), in order to apply different hypotheses to energy demand growth, different fuel cycle strategies and different reactor types implementation in the different regions. This approach was an attempt to avoid focusing on selected countries, in particular on those where no new spectacular energy demand growth is expected, but to provide trends and conclusions that account for the features of countries that will be major future players in the world's energy development. The heterogeneous approach considered a subdivision of the world in four main macro-regions (where countries have been grouped together according to their economic development dynamics). An original global electricity production envelope was used in simulations and a specific regional energy share was defined. In the regional approach two different fuel cycles were analysed: a once-through LWR cycle was used as the reference and a transition to fast reactor closed cycle to enable a better management of resources and minimisation of waste
SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: Fourth Results Report
Energy Technology Data Exchange (ETDEWEB)
Eudy, L.; Chandler, K.
2013-01-01
SunLine Transit Agency, which provides public transit services to the Coachella Valley area of California, has demonstrated hydrogen and fuel cell bus technologies for more than 10 years. In May 2010, SunLine began demonstrating the advanced technology (AT) fuel cell bus with a hybrid electric propulsion system, fuel cell power system, and lithium-based hybrid batteries. This report describes operations at SunLine for the AT fuel cell bus and five compressed natural gas buses. The U.S. Department of Energy's National Renewable Energy Laboratory (NREL) is working with SunLine to evaluate the bus in real-world service to document the results and help determine the progress toward technology readiness. NREL has previously published three reports documenting the operation of the fuel cell bus in service. This report provides a summary of the results with a focus on the bus operation from February 2012 through November 2012.
Geng, Xi; Shi, Zhiwei; Cheng, Keming; Dong, Hao; Zhao, Qun; Chen, Sinuo
2018-03-01
Plasma-based flow control is one of the most promising techniques for aerodynamic problems, such as delaying the boundary layer transition. The boundary layer’s characteristics induced by AC-DBD plasma actuators and applied by the actuators to delay the boundary layer transition on airfoil at Ma = 0.3 were experimentally investigated. The PIV measurement was used to study the boundary layer’s characteristics induced by the plasma actuators. The measurement plane, which was parallel to the surface of the actuators and 1 mm above the surface, was involved in the test, including the perpendicular plane. The instantaneous results showed that the induced flow field consisted of many small size unsteady vortices which were eliminated by the time average. The subsequent oil-film interferometry skin friction measurement was conducted on a NASA SC(2)-0712 airfoil at Ma = 0.3. The coefficient of skin friction demonstrates that the plasma actuators successfully delay the boundary layer transition and the efficiency is better at higher driven voltage.
Energy Technology Data Exchange (ETDEWEB)
Kumar, Santosh, E-mail: santoshkumar@phy.iitb.ac.in [Department of Physics, Indian Institute of Technology Bombay, Mumbai 400076 (India); Singh, Ravi P.; Thamizhavel, A. [Department of Condensed Matter Physics and Materials Science, Tata Institute of Fundamental Research, Mumbai 400005 (India); Tomy, C.V., E-mail: tomy@phy.iitb.ac.in [Department of Physics, Indian Institute of Technology Bombay, Mumbai 400076 (India); Grover, A.K. [Department of Condensed Matter Physics and Materials Science, Tata Institute of Fundamental Research, Mumbai 400005 (India); Department of Physics, Panjab University, Chandigarh 160014 (India)
2014-11-15
Highlights: • This work pertains to new findings related to a broad SMP anomaly. • Broad SMP prima facie encompasses two phase transformations in vortex matter. • We demarcated two phase boundaries pertaining to order–disorder transitions which have quasi first-order nature. - Abstract: We present distinct demarcation of the Bragg glass (BG) to multi-domain vortex glass (VG) transition line and the eventual amorphization of the VG phase in a weakly pinned single crystal of the superconducting compound Ca{sub 3}Ir{sub 4}Sn{sub 13} on the basis of comprehension of the different yields about the second magnetization peak (SMP) anomaly in the dc magnetization and the corresponding anomalous feature in the ac susceptibility measurements. The shaking by a small ac magnetic field, inevitably present in the ac susceptibility measurements, is seen to result in contrasting responses in two different portions of the field-temperature (H, T) phase space of the multi-domain VG. In one of the portions, embracing the BG to VG transition across the onset of the SMP anomaly, the ac drive is surprisingly seen to assist the transformation of the well ordered BG phase to a lesser ordered VG phase. The BG phase exists as a superheated state over a small portion of the VG space and this attests to the first order nature of the BG to VG transition.
BC Transit Fuel Cell Bus Project Evaluation Results: Second Report
Energy Technology Data Exchange (ETDEWEB)
Eudy, L.; Post, M.
2014-09-01
Second report evaluating a fuel cell electric bus (FCEB) demonstration led by British Columbia Transit (BC Transit) in Whistler, Canada. BC Transit is collaborating with the California Air Resources Board and the U.S. Department of Energy's National Renewable Energy Laboratory to evaluate the buses in revenue service. NREL published its first report on the demonstration in February 2014. This report is an update to the previous report; it covers 3 full years of revenue service data on the buses from April 2011 through March 2014 and focuses on the final experiences and lessons learned.
Fuel Cell Buses in U.S. Transit Fleets: Current Status 2012
Energy Technology Data Exchange (ETDEWEB)
Eudy, L.; Chander, K.; Gikakis, C.
2012-11-01
This report is the sixth in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. The report also provides a snapshot of current FCEB performance results over the last year. There are 25 active FCEBs in demonstrations this year at eight locations.
SunLine Transit Agency Fuel Cell Transit Bus: Fourth Evaluation Report (Report and Appendices)
Energy Technology Data Exchange (ETDEWEB)
Chandler, K.; Eudy, L.
2009-01-01
This report describes operations at SunLine Transit Agency for a prototype fuel cell bus and five new compressed natural gas (CNG) buses. This is the fourth evaluation report for this site, and it describes results and experiences from April 2008 through October 2008. These results are an addition to those provided in the previous three evaluation reports.
SunLine Transit Agency Fuel Cell Transit Bus: Fifth Evaluation Report (Report and Appendices)
Energy Technology Data Exchange (ETDEWEB)
Eudy, L.; Chandler, K.
2009-08-01
This report describes operations at SunLine Transit Agency for a prototype fuel cell bus and five compressed natural gas (CNG) buses. This is the fifth evaluation report for this site, and it describes results and experiences from October 2008 through June 2009. These results are an addition to those provided in the previous four evaluation reports.
Considerations for the transition from fuel cell R ampersand D to manufacturing
International Nuclear Information System (INIS)
Cobb, M.A.
1992-01-01
There are a growing number of contractors within the present fuel cell community who have the potential of becoming high volume manufacturers of fuel cell power plants or components. Many are transitioning from basic research operations to manufacturing for the first time. Moving a product from the R ampersand D stage to a viable commercial product depends upon many factors. Some companies are more successful at it than others. We believe there is an underlying transition process from invention to market that is much the same for large, well established firms, as it is for start-ups. How well the process is understood and executed often determines the winners and losers in product commercialization. This paper presents a viewpoint on considerations for transitioning a new technology into commercial production and discusses some affects on organizational development
Directory of Open Access Journals (Sweden)
Michael W. Levin
2017-12-01
Full Text Available As fuel prices increase, drivers may make travel choices to minimize not only travel time, but also fuel consumption. Consideration of fuel consumption would affect route choice and influence trip frequency and mode choice. For instance, travelers may elect to live closer to their workplace, or use public transit to avoid fuel consumption and the associated costs. To incorporate network characteristics into predictions of the effects of fuel prices, we develop a multi-class combined elastic demand, mode choice, and user equilibrium model using a generalized cost function of travel time and fuel consumption with a combined solution algorithm. The algorithm is implemented in a custom software package, and a case study application on the Austin, Texas network is presented. We evaluate the fuel-price sensitivity of key variables such as drive-alone and transit class proportions, person-miles traveled, link-level traffic flow and per capita fuel consumption and emissions. These effects are examined across a heterogeneous demand set, with multiple user-classes categorized based on their value of travel time. The highest relative transit elasticities against fuel price are observed among low value of time classes, as expected. Although total personal vehicle travel decreases, congestion increases on some roads due to the generalized cost function. Reductions in system-wide fuel consumption and greenhouse gas emissions are observed as well. The study uncovers the combined interactions among fuel prices, multi-modal choice behavior, travel performance, and resultant environmental impacts, all of which dictate the urban travel market. It also equips agencies with motivation to tailor emissions reduction and transit-ridership stimulus policies around the most responsive user classes.
Safety evaluation of a hydrogen fueled transit bus
Energy Technology Data Exchange (ETDEWEB)
Coutts, D.A.; Thomas, J.K.; Hovis, G.L.; Wu, T.T. [Westinghouse Savannah River Co., Aiken, SC (United States)
1997-12-31
Hydrogen fueled vehicle demonstration projects must satisfy management and regulator safety expectations. This is often accomplished using hazard and safety analyses. Such an analysis has been completed to evaluate the safety of the H2Fuel bus to be operated in Augusta, Georgia. The evaluation methods and criteria used reflect the Department of Energy`s graded approach for qualifying and documenting nuclear and chemical facility safety. The work focused on the storage and distribution of hydrogen as the bus motor fuel with emphases on the technical and operational aspects of using metal hydride beds to store hydrogen. The safety evaluation demonstrated that the operation of the H2Fuel bus represents a moderate risk. This is the same risk level determined for operation of conventionally powered transit buses in the United States. By the same criteria, private passenger automobile travel in the United States is considered a high risk. The evaluation also identified several design and operational modifications that resulted in improved safety, operability, and reliability. The hazard assessment methodology used in this project has widespread applicability to other innovative operations and systems, and the techniques can serve as a template for other similar projects.
Transitioning nuclear fuel cycles with uncertain fast reactor costs
Energy Technology Data Exchange (ETDEWEB)
Phathanapirom, U.B., E-mail: bphathanapirom@utexas.edu; Schneider, E.A.
2016-06-15
This paper applies a novel decision making methodology to a case study involving choices leading to the transition from the current once-through light water reactor fuel cycle to one relying on continuous recycle of plutonium and minor actinides in fast reactors in the face of uncertain fast reactor capital costs. Unique to this work is a multi-stage treatment of a range of plausible trajectories for the evolution of fast reactor capital costs over time, characterized by first-of-a-kind penalties as well as time- and unit-based learning. The methodology explicitly incorporates uncertainties in key parameters into the decision-making process by constructing a stochastic model and embedding uncertainties as bifurcations in the decision tree. “Hedging” strategies are found by applying a choice criterion to select courses of action which mitigate “regrets”. These regrets are calculated by evaluating the performance of all possible transition strategies for every feasible outcome of the uncertain parameter. The hedging strategies are those that preserve the most flexibility for adjusting the fuel cycle strategy in response to new information as uncertainties are resolved.
Transitioning nuclear fuel cycles with uncertain fast reactor costs
International Nuclear Information System (INIS)
Phathanapirom, U.B.; Schneider, E.A.
2016-01-01
This paper applies a novel decision making methodology to a case study involving choices leading to the transition from the current once-through light water reactor fuel cycle to one relying on continuous recycle of plutonium and minor actinides in fast reactors in the face of uncertain fast reactor capital costs. Unique to this work is a multi-stage treatment of a range of plausible trajectories for the evolution of fast reactor capital costs over time, characterized by first-of-a-kind penalties as well as time- and unit-based learning. The methodology explicitly incorporates uncertainties in key parameters into the decision-making process by constructing a stochastic model and embedding uncertainties as bifurcations in the decision tree. “Hedging” strategies are found by applying a choice criterion to select courses of action which mitigate “regrets”. These regrets are calculated by evaluating the performance of all possible transition strategies for every feasible outcome of the uncertain parameter. The hedging strategies are those that preserve the most flexibility for adjusting the fuel cycle strategy in response to new information as uncertainties are resolved.
Transit experience with hydrogen fueled hybrid electric buses
Energy Technology Data Exchange (ETDEWEB)
Scott, P.B.; Mazaika, D.M. [ISE Corp., Poway, CA (United States)
2006-07-01
Mass transit buses are ideal candidates for hydrogen implementation due to their capability of carrying 30 to 60 kg of hydrogen. ISE Corporation is a supplier of hydrogen fueled buses, including the first hybrid electric fuel cell bus which was commercialized in 2002, the hybrid electric fuel cell bus, and the hybrid hydrogen internal combustion engine (HHICE) bus which was commercialized in 2004. The configuration of a HHICE bus was illustrated with reference to its engine, control system, energy storage, generator, drive motor, inverter and accessories. Although these vehicles are expensive, the cost is amortized over a large base of hours used and passengers carried. The buses are operated primarily in urban areas where quiet and clean operation is needed the most. ISE has established a joint venture with Thor industries to develop a series of fuel cell buses equipped with a 60 kW PEM fuel cell. A schematic illustrating the energy flow in HHICE bus was also presented. It was shown that regenerative braking recovers the energy of motion. When using regenerative braking, most of the braking energy is saved in the battery. ISE drive systems convert 30 per cent or more of the bus energy to electrical energy to be used in later acceleration. Reduced fuel consumption also reduces the vehicle emissions. Testing of HHICE buses in both summer and winter operating conditions have shown that the range needs to be improved along with engine component reliability and durability. Fuel supply is also a major issue. A comparison with a fuel cell hybrid system was also presented. In the United States, more than 100,000 miles have been logged for the use of hydrogen hybrid buses, fuel cell buses and HHICE buses. The HHICE bus offers low capital cost, familiar technologies, but some NOx. CAT absorber technology offers the possibility of near zero emission capability. The fuel cell bus was found to be more fuel efficient, and can travel nearly twice as far per unit energy as
Advances in simulating non-congruent phase transitions of hyperstoichiometric uranium dioxide fuel
International Nuclear Information System (INIS)
Welland, M.J.; Thompson, W.T.; Lewis, B.J.
2007-01-01
A model is being developed to simulate UO 2 at very high temperatures incorporating the effects of non-congruent phase transitions. In particular, the melting transformation and the possible 'Λ-transition' is being investigated to help support the design and analysis of experimental work being conducted as part of nuclear safety research. This work includes the interpretation of the behaviour of operating CANDU fuel under upset conditions, where centerline melting may potentially occur (particularly if the fuel is oxidized). The model presented here numerically solves a system of coupled nonlinear differential equations as derived from fundamental principles. The results of the model present here compare well against laser flash experiments in recently published literature. (author)
Effects of AC Electric Field on Small Laminar Nonpremixed Flames
Xiong, Yuan
2015-04-01
Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the
International Nuclear Information System (INIS)
Passereini, S.; Feng, B.; Fei, T.; Kim, T.K.; Taiwo, T.A.; Brown, N.R.; Cuadra, A.
2015-01-01
A recent Evaluation and Screening study of nuclear fuel cycle options identified a few groups of options as most promising. One of these most promising Evaluation Groups (EGs) is characterized by the continuous recycling of uranium (U) and transuranics (TRU) with natural uranium feed in both fast and thermal critical reactors. This evaluation group, designated as EG30, is represented by an example fuel cycle option that employs a two-technology, two-stage fuel cycle system. The first stage involves the continuous recycling of co-extracted U/TRU in Sodium-cooled Fast Reactors (SFRs) with metallic fuel and breeding ratio greater than 1. The second stage involves the use of the surplus TRU in Mixed Oxide (MOX) fuel in Pressurized Water Reactors that are MOX-capable (MOX-PWRs). This paper presents and discusses preliminary fuel cycle analysis results from the fuel cycle codes VISION and DYMOND for the transition to this fuel cycle option from the current once-through cycle in the United States (U.S.) that consists of Light Water Reactors (LWRs) that only use conventional UO 2 fuel. The analyses in this paper are applicable for a constant 100 GWe capacity, roughly the size of the U.S. nuclear fleet. Two main strategies for the transition to EG30 were analyzed: 1) deploying both SFRs and MOX-PWRs in parallel or 2) deploying them in series with the SFR fleet first. With an estimated retirement schedule for the existing LWRs, an assumed reactor lifetime of 60 years, and no growth, the nuclear system fully transitions to the new fuel cycle within 100 years for both strategies without SFR fuel shortages. Compared to the once-through cycle, transition to the SFR/MOX-PWR fleet with continuous recycle was shown to offer significant reductions in uranium consumption and waste disposal requirements. In addition, these initial calculations revealed a few notable modeling and strategy questions regarding how recycled resources are allocated, reactors that can switch between
1996-09-01
The use of alternative fuels to power transit buses is steadily increasing. Several fuels, including Liquefied Petroleum Gas (LPG), Compressed Natural Gas (CNG), and Methanol/Ethanol, are already being used in buses. At present, there do not exist co...
International Nuclear Information System (INIS)
Aragones, J.M.; Martinez-Val, J.M.; Corella, M.R.
1977-01-01
Fuel management requires that mass, energy, and reactivity balance be satisfied in each reload cycle. Procedures for selection of alternatives, core-state models, and fuel cost calculations have been developed for both equilibrium and transition cycles. Effective cycle lengths and fuel cycle variables--namely, reload batch size, schedule of incore residence for the fuel, feed enrichments, energy sharing cycle by cycle, and discharge burnup and isotopics--are the variables being considered for fuel management planning with a given energy generation plan, fuel design, recycling strategy, and financial assumptions
Transition of Natural Frequencies of a Fuel Rod during Its Lifetime
International Nuclear Information System (INIS)
Kim, Hyeong Koo; Lee, Kyou Seok; Kim, Jeong Ha; Jeon, Sang Yoon
2009-01-01
The natural frequencies of a Pressurized Water Reactor (PWR) fuel rod are dependent on the geometrical and mechanical properties of fuel rod itself and its supporting conditions provided by spacer grids. By the way, these environmental parameters suffer remarkable change due to the plant operating conditions such as burnup, temperature, system pressure, and so on. It is inevitable, therefore, to be changed the natural frequencies of the fuel rod during its lifetime. In this paper, the transition of natural frequencies of the fuel rod for OPR1000 plants has been investigated considering fuel conditions associated with fuel life time. Basically for this investigation, three analysis models have been proposed representing beginning-of life (BOL) condition, middle-of-life (MOL) condition and end-of-life (EOL) condition including spacer grid supporting conditions. With these models, several modal analyses have been performed and the results have been compared with those of the test which has been carried out for verification of the analysis model. With these analyses and test, the changing vibration behavior of the PLUS7 fuel rod for OPR1000 during its life time has been discussed
AC Calorimetric Design for Dynamic of Biological Materials
Shigeo Imaizumi
2006-01-01
We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...
SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: First Results Report
Energy Technology Data Exchange (ETDEWEB)
Eudy, L.; Chandler, K.
2011-03-01
This report describes operations at SunLine Transit Agency for their newest prototype fuel cell bus and five compressed natural gas (CNG) buses. In May 2010, SunLine began operating its sixth-generation hydrogen fueled bus, an Advanced Technology (AT) fuel cell bus that incorporates the latest design improvements to reduce weight and increase reliability and performance. The agency is collaborating with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) to evaluate the bus in revenue service. This report provides the early data results and implementation experience of the AT fuel cell bus since it was placed in service.
International Nuclear Information System (INIS)
S, Tukiran; MS, Tagor; P, Surian
2003-01-01
The core conversion of RSG-GAS reactor from oxide to silicide core with meat density of 2.96 gU/cc has been done. The core-of RSG-GAS reactor has been operated full core of silicide fuels which is started with the mixed core of oxide-silicide start from core 36. Based on previous work, the calculated core parameter for the cores were obtained and it is needed 9 transition cores (core 36 - 44) to achieve a full-silicide core (core 45). The objective of this work is to acquire the effect of the increment of the number of silicide fuel on the core parameters. Conversion core was achieved by transition cores mixed oxide-silicide fuels. Each transition core is calculated and measured core parameter such as, excess reactivity and shutdown margin. Calculation done by Batan-EQUIL-2D code and measurement of the core parameters was carried out using the method of compensation of couple control rods. The results of calculation and experiment shows that the excess reactivity trends lower with the increment of the number of silicide fuel in the core. However, the shutdown margin is not change with the increment of the number of silicide fuel. Therefore, the transition cores can be operated safely to a full-silicide core
Lamin A/C might be involved in the EMT signalling pathway.
Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu
2018-07-15
We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.
International Nuclear Information System (INIS)
Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.
2004-01-01
Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the
SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: Third Results Reports
Energy Technology Data Exchange (ETDEWEB)
Eudy, L.; Chandler, K.
2012-05-01
This report describes operations at SunLine Transit Agency for their newest prototype fuel cell bus and five compressed natural gas (CNG) buses. In May 2010, SunLine began operating its sixth-generation hydrogen fueled bus, an Advanced Technology (AT) fuel cell bus that incorporates the latest design improvements to reduce weight and increase reliability and performance. The agency is collaborating with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) to evaluate the bus in revenue service. NREL has previously published two reports documenting the operation of the fuel cell bus in service. This report provides a summary of the results with a focus on the bus operation from July 2011 through January 2012.
International Nuclear Information System (INIS)
Gao, Ruxing; Choi, Sungyeol; Il Ko, Won; Kim, Sungki
2017-01-01
In today's profit-driven market, how best to pursue advanced nuclear fuel cycle technologies while maintaining the cost competitiveness of nuclear electricity is of crucial importance to determine the implementation of spent fuel reprocessing and recycling in China. In this study, a comprehensive techno-economic analysis is undertaken to evaluate the economic feasibility of ongoing national projects and the technical compatibility with China's future fuel cycle transition. We investigated the dynamic impacts of technical and economic uncertainties in the lifecycle of a nuclear system. The electricity generation costs associated with four potential fuel cycle transition scenarios were simulated by probabilistic and deterministic approaches and then compared in detail. The results showed that the total cost of a once-through system is lowest compared those of other advanced systems involving reprocessing and recycling. However, thanks to the consequential uncertainties caused by the further progress toward technology maturity, the economic potential of fuel recycling options was proven through a probabilistic uncertainty analysis. Furthermore, it is recommended that a compulsory executive of closed fuel cycle policy would pose some investment risk in the near term, though the execution of a series of R&D initiatives with a flexible roadmap would be valuable in the long run. - Highlights: • Real-time economic performance of the four scenarios of China's nuclear fuel cycle system transition until 2100. • Systematic assessments of techno-economic feasibility for ongoing national reprocessing projects. • Investigation the cost impact on nuclear electricity generation caused by uncertainties through probabilistic analysis. • Recommendation for sustainable implementation of fuel cycle R&D initiative ingrate with flexible roadmap in the long run.
International Nuclear Information System (INIS)
Kawashima, Katsuyuki; Maruyama, Shuhei; Ohki, Shigeo; Mizuno, Tomoyasu
2009-01-01
As part of the Fast Reactor Cycle Technology Development Project (FaCT Project), sodium-cooled fast reactor core design efforts have been made to cope with the TRU fuel composition changes expected during LWR-to-FBR transition period, in which a various kind of TRU fuel compositions are available depending on the characteristics of the LWR spent fuels and a way of recycling them. A 750 MWe mixed-oxide fuel core is firstly defined as a FaCT medium-size reference core and its neutronics characteristics are determined. The core is a high internal conversion type and has an average burnup of 150 GWD/T. The reference TRU fuel composition is assumed to come from the FBR equilibrium state. Compared to the LWR-to-FBR transition period, the TRU fuels in the FBR equilibrium period are multi-recycled through fast reactors and have a different composition. An available TRU fuel composition is determined by fast reactor spent fuel multi-recycling scenarios. Then the FaCT core corresponding to the TRU fuel with different compositions is set according to the TRU fuel composition changes in LWR-to-FBR transition period, and the key core neutronics characteristics are assessed. It is shown that among the core neutronics characteristics, the burnup reactivity and the safety parameters such as sodium void reactivity and Doppler coefficient are significantly influenced by the TRU fuel composition changes. As a result, a general characteristic in the FaCT core design to cope with TRU fuel composition changes is grasped and the design envelopes are identified in terms of the burnup reactivity and the safety parameters. (author)
Flexible fuel cycle system for the transition from LWR to FBR
International Nuclear Information System (INIS)
Fukasawa, Tetsuo; Yamashita, Junichi; Hoshino, Kuniyoshi; Sasahira, Akira; Inoue, Tadashi; Minato, Kazuo; Sato, Seichi
2009-01-01
Japan will deploy commercial fast breeder reactor (FBR) from around 2050 under the suitable conditions for the replacement of light water reactor (LWR) with FBR. The transition scenario from LWR to FBR is investigated in detail and the flexible fuel cycle initiative (FFCI) system has been proposed as a optimum transition system. The FFCI removes ∼95% uranium from LWR spent fuel (SF) in LWR reprocessing and residual material named Recycle Material (RM), which is ∼1/10 volume of original SF and contains ∼50% U, ∼10% Pu and ∼40% other nuclides, is treated in FBR reprocessing to recover Pu and U. If the FBR deployment speed becomes lower, the RM will be stored until the higher speed again. The FFCI has some merits compared with ordinary system that consists of full reprocessing facilities for both LWR and FBR SF during the transition period. The economy is better for FFCI due to the smaller LWR reprocessing facility (no Pu/U recovery and fabrication). The FFCI can supply high Pu concentration RM, which has high proliferation resistance and flexibly respond to FBR introduction rate changes. Volume minimization of LWR SF is possible for FFCI by its conversion to RM. Several features of FFCI were quantitatively evaluated such as Pu mass balance, reprocessing capacities, LWR SF amounts, RM amounts, and proliferation resistance to compare the effectiveness of the FFCI system with other systems. The calculated Pu balance revealed that the FFCI could supply enough but no excess Pu to FBR. These evaluations demonstrated the applicability of FFCI system to the transition period from LWR to FBR cycles. (author)
International Nuclear Information System (INIS)
Gurin, Andrey V.; Alekseev, P.N.
2017-01-01
This paper presents a study of scenarios of transition to a closed fuel cycle in the system of nuclear power, built basing on resource availability requirements at the stage of full life-cycle reactors. Conventionally, there are three main scenarios for the development of nuclear energy: with VVER reactors operating in an open fuel cycle; with VVER reactors operating in a closed fuel cycle; and co-operating VVER and BN, operating in a closed fuel cycle. For the considered scenarios, a quantitative estimation of change in time of material balances were performed, including spent fuel balance, balance of plutonium, reprocessed and depleted uranium, radioactive waste, and the analysis of the fuel component of the cost of electricity.
Energy Technology Data Exchange (ETDEWEB)
Gurin, Andrey V. [National Research Centre ' ' Kurchatov Institute' ' , Moscow (Russian Federation); Alekseev, P.N.
2017-09-15
This paper presents a study of scenarios of transition to a closed fuel cycle in the system of nuclear power, built basing on resource availability requirements at the stage of full life-cycle reactors. Conventionally, there are three main scenarios for the development of nuclear energy: with VVER reactors operating in an open fuel cycle; with VVER reactors operating in a closed fuel cycle; and co-operating VVER and BN, operating in a closed fuel cycle. For the considered scenarios, a quantitative estimation of change in time of material balances were performed, including spent fuel balance, balance of plutonium, reprocessed and depleted uranium, radioactive waste, and the analysis of the fuel component of the cost of electricity.
International Nuclear Information System (INIS)
Hara, Takashi; Mizokami, Shinya; Kudo, Yoshiro; Komura, Seiichi; Nagata, Yoshifumi; Morooka, Shinichi
2003-01-01
Development of rewetting correlation formula was the key to predict fuel-cladding temperature after Boiling Transition (BT). Japanese BWR utilities and vendors performed some tests of rewetting and made two rewetting correlation formulas. The effect on fuel integrity after BT depends on temperature of fuel rod and time of dryout. Main cause of losing fuel integrity during BWR's Anticipated Operational Occurrences (AOO) after BT is embrittlement of the claddings due to oxidation. Ballooning of fuel rod is excepted because its pressure boundary isn't broken. In Japan, the Standards Committee of Atomic Energy Society of Japan (AESJ) is making post BT standard. This standard provides guidelines based on the latest knowledge to judge fuel integrity in case of BT and the validity of reusing the fuel assembly that experienced BT in BWRs. (author)
Closed Nuclear Fuel Cycle Technologies to Meet Near-Term and Transition Period Requirements
International Nuclear Information System (INIS)
Collins, E.D.; Felker, L.K.; Benker, D.E.; Campbell, D.O.
2008-01-01
A scenario that very likely fits conditions in the U.S. nuclear power industry and can meet the goals of cost minimization, waste minimization, and provisions of engineered safeguards for proliferation resistance, including no separated plutonium, to close the fuel cycle with full actinide recycle is evaluated. Processing aged fuels, removed from the reactor for 30 years or more, can provide significant advantages in cost reduction and waste minimization. The UREX+3 separations process is being developed to separate used fuel components for reuse, thus minimizing waste generation and storage in geologic repositories. Near-term use of existing and new thermal spectrum reactors can be used initially for recycle actinide transmutation. A transition period will eventually occur, when economic conditions will allow commercial deployment of fast reactors; during this time, recycled plutonium can be diverted into fast reactor fuel and conversion of depleted uranium into additional fuel material can be considered. (authors)
Closed Nuclear Fuel Cycle Technologies to Meet Near-Term and Transition Period Requirements
Energy Technology Data Exchange (ETDEWEB)
Collins, E.D.; Felker, L.K.; Benker, D.E.; Campbell, D.O. [Oak Ridge National Laboratory, P.O. Box 2008, Oak Ridge, Tennessee, 37831-6152 (United States)
2008-07-01
A scenario that very likely fits conditions in the U.S. nuclear power industry and can meet the goals of cost minimization, waste minimization, and provisions of engineered safeguards for proliferation resistance, including no separated plutonium, to close the fuel cycle with full actinide recycle is evaluated. Processing aged fuels, removed from the reactor for 30 years or more, can provide significant advantages in cost reduction and waste minimization. The UREX+3 separations process is being developed to separate used fuel components for reuse, thus minimizing waste generation and storage in geologic repositories. Near-term use of existing and new thermal spectrum reactors can be used initially for recycle actinide transmutation. A transition period will eventually occur, when economic conditions will allow commercial deployment of fast reactors; during this time, recycled plutonium can be diverted into fast reactor fuel and conversion of depleted uranium into additional fuel material can be considered. (authors)
AC conductivity for a holographic Weyl semimetal
Energy Technology Data Exchange (ETDEWEB)
Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)
2017-03-23
We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.
Cost Probability Analysis of China's Nuclear Fuel Cycle Transition
International Nuclear Information System (INIS)
Gao, R. X.; Ko, W. I.; Lee, S. H.
2015-01-01
The Chinese government has already determined to develop the closed nuclear fuel cycle, its long-term roadmap of spent fuel management has not been decided yet. Currently, it seems that China's booming economy gives abundant financial assurance to develop nuclear programs in full play according to its near-term national plans. However, the viability and sustainability of nuclear power always depends critically on its economics. Therefore, it is necessary to conduct a well focused cost-benefit and objective analysis of China's ongoing nuclear power programs with the future prospects. In this study, we conduct a comparative analysis of electricity generation cost in four reference nuclear fuel cycle transition scenarios by 2050. Direct disposal is assumed to produce the cheapest LCT as low as 62.688 mills/kWh compared to the other options. However, after performing a relative uncertainty study, the results show that the capital cost of reactor is the key cost component which leads to the cost gap
Cost Probability Analysis of China's Nuclear Fuel Cycle Transition
Energy Technology Data Exchange (ETDEWEB)
Gao, R. X. [Univ. of Science and Technology, Daejeon (Korea, Republic of); Ko, W. I.; Lee, S. H. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2015-05-15
The Chinese government has already determined to develop the closed nuclear fuel cycle, its long-term roadmap of spent fuel management has not been decided yet. Currently, it seems that China's booming economy gives abundant financial assurance to develop nuclear programs in full play according to its near-term national plans. However, the viability and sustainability of nuclear power always depends critically on its economics. Therefore, it is necessary to conduct a well focused cost-benefit and objective analysis of China's ongoing nuclear power programs with the future prospects. In this study, we conduct a comparative analysis of electricity generation cost in four reference nuclear fuel cycle transition scenarios by 2050. Direct disposal is assumed to produce the cheapest LCT as low as 62.688 mills/kWh compared to the other options. However, after performing a relative uncertainty study, the results show that the capital cost of reactor is the key cost component which leads to the cost gap.
Directory of Open Access Journals (Sweden)
Duong Minh Bui
2016-03-01
Full Text Available Transient situations of a uni-grounded low-voltage AC microgrid are simulated in this paper, which include different fault tests and operation transition test between the grid-connected and islanded modes of the uni-grounded microgrid. Based on transient simulation results, available fault protection methods are proposed for the main and back-up protection of a uni-grounded AC microgrid. Main contributions of this paper are (i analysing transient responses of a typically uni-grounded lowvoltage AC microgrid from line-to-line, single line-to-ground, three-phase faults and a microgrid operation transition test; and (ii proposing available fault protection methods for uni-grounded AC microgrids, such as non-directional/directional overcurrent protection solutions, under/over voltage protection solutions, differential protection, voltage-restrained overcurrent protection, and other protection principles not based on high fault currents (e.g. total harmonic distortion detection of phase currents and voltages, or protection methods using symmetrical sequence components of current and voltage.
High temperature phase transitions in nuclear fuels of the fourth generation
International Nuclear Information System (INIS)
De Bruycker, F.
2010-01-01
Understanding the behaviour of nuclear materials in extreme conditions is of prime importance for the analysis of the operation limits of nuclear fuels, and prediction of possible nuclear reactor accidents, relevant to the general objectives of nuclear safety research. The main purpose of this thesis is the study of high temperature phase transitions in nuclear materials, with special attention to the candidate fuel materials for the reactors of the 4. Generation. In this framework, material properties need to be investigated at temperatures higher than 2500 K, where equilibrium conditions are difficult to obtain. Laser heating combined with fast pyrometer is the method used at the European Institute for Transuranium Elements (JRC - ITU). It is associated to a novel process used to determine phase transitions, based on the detection, via a suited low-power (mW) probe laser, of changes in surface reflectivity that may accompany solid/liquid phase transitions. Fast thermal cycles, from a few ms up to the second, under almost container-free conditions and control atmosphere narrow the problem of vaporisation and sample interactions usually meet with traditional method. This new experimental approach has led to very interesting results. It confirmed earlier research for material systems known to be stable at high temperature (such as U-C) and allowed a refinement of the corresponding phase diagrams. But it was also feasible to apply this method to materials highly reactive, thus original results are presented on PuO 2 , NpO 2 , UO 2 -PuO 2 and Pu-C systems. (author)
2003-03-01
The use of alternative fuels to power transit buses is steadily increasing. Several fuels, including : Compressed Natural Gas (CNG), Liquefied Natural Gas (LNG), Liquefied Petroleum Gas (LPG), and : Methanol/Ethanol, are already being used. At presen...
CERDEC Fuel Cell Team: Military Transitions for Soldier Fuel Cells
2008-10-27
Fuel Cell (DMFC) (PEO Soldier) Samsung: 20W DMFC (CRADA) General Atomics & Jadoo: 50W Ammonia Borane Fueled PEMFC Current Fuel Cell Team Efforts...Continued Ardica: 20W Wearable PEMFC operating on Chemical Hydrides Spectrum Brands w/ Rayovac: Hydrogen Generators and Alkaline Fuel Cells for AA...100W Ammonia Borane fueled PEMFC Ultralife: 150W sodium borohydride fueled PEMFC Protonex: 250W RMFC and Power Manager (ARO) NanoDynamics: 250W SOFC
AC susceptibility of thin Pb films in intermediate and mixed state
Energy Technology Data Exchange (ETDEWEB)
Janu, Zdenek, E-mail: janu@fzu.cz [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Svindrych, Zdenek [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Trunecek, Otakar [Charles University in Prague, Faculty of Mathematics and Physics, Ke Karlovu 3, CZ-121 16 Prague 2 (Czech Republic); Kus, Peter; Plecenik, Andrej [Komenius University in Bratislava, Faculty of Mathematics, Physics, and Informatics, Mlynska dolina, 842 48 Bratislava 4 (Slovakia)
2011-12-15
Thickness dependent transition in AC susceptibility between intermediate and mixed state in type-I superconducting films. The temperature induced crossover between reversible and irreversible behavior was observed in the thicker film. The temperature dependence of the AC susceptibility in mixed state follows prediction of model based on Bean critical state. The temperature dependence of the harmonics of the complex AC susceptibility in the intermediate state is explained. Thin films of type I superconductors of a thickness comparable or less than a flux penetration length behave like type II superconductors in a mixed state. With decreasing film thickness normal domains carrying a magnetic flux get smaller with smaller number of flux quanta per domain and finally transform into single quantum flux lines, i.e. quantum vortices similar to those found in type II superconductors. We give an evidence of this behavior from the measurements of the nonlinear response of a total magnetic moment to an applied AC magnetic field, directly from the temperature dependence of an AC susceptibility.
Nuclear structure effects in the exotic decay of $^{225}$Ac via $^{14}$C emission
Bonetti, R; Guglielmetti, A; Matheoud, R; Migliorino, C; Pasinetti, A L; Ravn, H L
1993-01-01
By using a $^{225}$Ac source produced at the electromagnetic separator Isolde we collected on our track-recording glass detectors 305 $^{14}$C events from the radioactive decays of $^{225}$Ac and its daughter $^{221}$Fr and obtained, for $^{225}$Ac, a branching ratio B($^{14}$C/$\\alpha$)=(6.0 $\\pm$ 1.3) x 10$^{-12}$. Our result suggests that such a decay from an odd proton nucleus is dominated by transition to the ground or to the first excited state of daughter nucleus.
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Modeling transit bus fuel consumption on the basis of cycle properties.
Delgado, Oscar F; Clark, Nigel N; Thompson, Gregory J
2011-04-01
A method exists to predict heavy-duty vehicle fuel economy and emissions over an "unseen" cycle or during unseen on-road activity on the basis of fuel consumption and emissions data from measured chassis dynamometer test cycles and properties (statistical parameters) of those cycles. No regression is required for the method, which relies solely on the linear association of vehicle performance with cycle properties. This method has been advanced and examined using previously published heavy-duty truck data gathered using the West Virginia University heavy-duty chassis dynamometer with the trucks exercised over limited test cycles. In this study, data were available from a Washington Metropolitan Area Transit Authority emission testing program conducted in 2006. Chassis dynamometer data from two conventional diesel buses, two compressed natural gas buses, and one hybrid diesel bus were evaluated using an expanded driving cycle set of 16 or 17 different driving cycles. Cycle properties and vehicle fuel consumption measurements from three baseline cycles were selected to generate a linear model and then to predict unseen fuel consumption over the remaining 13 or 14 cycles. Average velocity, average positive acceleration, and number of stops per distance were found to be the desired cycle properties for use in the model. The methodology allowed for the prediction of fuel consumption with an average error of 8.5% from vehicles operating on a diverse set of chassis dynamometer cycles on the basis of relatively few experimental measurements. It was found that the data used for prediction should be acquired from a set that must include an idle cycle along with a relatively slow transient cycle and a relatively high speed cycle. The method was also applied to oxides of nitrogen prediction and was found to have less predictive capability than for fuel consumption with an average error of 20.4%.
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
International Nuclear Information System (INIS)
Hekkert, M.P.; Hendriks, F.H.J.F.; Faaij, A.P.C.; Neelis, M.L.
2005-01-01
Road transport produces significant amounts of CO 2 by using crude oil as primary energy source. A reduction of CO 2 emissions can be achieved by implementing alternative fuel chains. This article studies CO 2 emissions and energy efficiencies by means of a well to wheel analysis of alternative automotive fuel chains, using natural gas (NG) as an alternative primary energy source to replace crude oil. The results indicate that NG-based hydrogen applied in fuel cell vehicles (FCVs) lead to largest CO 2 emission reductions (up to 40% compared to current practice). However, large implementation barriers for this option are foreseen, both technically and in terms of network change. Two different transition strategies are discussed to gradually make the transition to these preferred fuel chains. Important transition technologies that are the backbone of these routes are traditional engine technology fuelled by compressed NG and a FCV fuelled by gasoline. The first is preferred in terms of carbon emissions. The results furthermore indicate that an innovation in the conventional chain, the diesel hybrid vehicle, is more efficient than many NG-based chains. This option scores well in terms of carbon emissions and implementation barriers and is a very strong option for the future
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Simulations of the Fuel Economy and Emissions of Hybrid Transit Buses over Planned Local Routes
Energy Technology Data Exchange (ETDEWEB)
Gao, Zhiming [ORNL; LaClair, Tim J [ORNL; Daw, C Stuart [ORNL; Smith, David E [ORNL; Franzese, Oscar [ORNL
2014-01-01
We present simulated fuel economy and emissions city transit buses powered by conventional diesel engines and diesel-hybrid electric powertrains of varying size. Six representative city drive cycles were included in the study. In addition, we included previously published aftertreatment device models for control of CO, HC, NOx, and particulate matter (PM) emissions. Our results reveal that bus hybridization can significantly enhance fuel economy by reducing engine idling time, reducing demands for accessory loads, exploiting regenerative braking, and shifting engine operation to speeds and loads with higher fuel efficiency. Increased hybridization also tends to monotonically reduce engine-out emissions, but trends in the tailpipe (post-aftertreatment) emissions involve more complex interactions that significantly depend on motor size and drive cycle details.
Energy Technology Data Exchange (ETDEWEB)
Eudy, L.; Chandler, K.
2011-10-01
This report describes operations at SunLine Transit Agency for their newest prototype fuel cell bus and five compressed natural gas (CNG) buses. In May 2010, SunLine began operating its sixth-generation hydrogen fueled bus, an Advanced Technology (AT) fuel cell bus that incorporates the latest design improvements to reduce weight and increase reliability and performance. The agency is collaborating with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) to evaluate the bus in revenue service. This is the second results report for the AT fuel cell bus since it was placed in service, and it focuses on the newest data analysis and lessons learned since the previous report. The appendices, referenced in the main report, provide the full background for the evaluation. They will be updated as new information is collected but will contain the original background material from the first report.
A nuclear reactor core fuel reload optimization using artificial ant colony connective networks
International Nuclear Information System (INIS)
Lima, Alan M.M. de; Schirru, Roberto; Carvalho da Silva, Fernando; Medeiros, Jose Antonio Carlos Canedo
2008-01-01
The core of a nuclear Pressurized Water Reactor (PWR) may be reloaded every time the fuel burn-up is such that it is not more possible to maintain the reactor operating at nominal power. The nuclear core fuel reload optimization problem consists in finding a pattern of burned-up and fresh-fuel assemblies that maximize the number of full operational days. This is an NP-Hard problem, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Moreover, the problem is non-linear and its search space is highly discontinuous and multi-modal. Ant Colony System (ACS) is an optimization algorithm based on artificial ants that uses the reinforcement learning technique. The ACS was originally developed to solve the Traveling Salesman Problem (TSP), which is conceptually similar to the nuclear core fuel reload problem. In this work a parallel computational system based on the ACS, called Artificial Ant Colony Networks is introduced to solve the core fuel reload optimization problem
A nuclear reactor core fuel reload optimization using artificial ant colony connective networks
Energy Technology Data Exchange (ETDEWEB)
Lima, Alan M.M. de [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: alanmmlima@yahoo.com.br; Schirru, Roberto [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: schirru@lmp.ufrj.br; Carvalho da Silva, Fernando [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: fernando@con.ufrj.br; Medeiros, Jose Antonio Carlos Canedo [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: canedo@lmp.ufrj.br
2008-09-15
The core of a nuclear Pressurized Water Reactor (PWR) may be reloaded every time the fuel burn-up is such that it is not more possible to maintain the reactor operating at nominal power. The nuclear core fuel reload optimization problem consists in finding a pattern of burned-up and fresh-fuel assemblies that maximize the number of full operational days. This is an NP-Hard problem, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Moreover, the problem is non-linear and its search space is highly discontinuous and multi-modal. Ant Colony System (ACS) is an optimization algorithm based on artificial ants that uses the reinforcement learning technique. The ACS was originally developed to solve the Traveling Salesman Problem (TSP), which is conceptually similar to the nuclear core fuel reload problem. In this work a parallel computational system based on the ACS, called Artificial Ant Colony Networks is introduced to solve the core fuel reload optimization problem.
Energy Technology Data Exchange (ETDEWEB)
Petrovic, B [Institut ' Rudjer Boskovic' , Zagreb (Yugoslavia); Pevec, D [Elektrotehnicki fakultet, Zagreb (Yugoslavia); Smuc, T; Urli, N [Institut ' Rudjer Boskovic' , Zagreb (Yugoslavia)
1989-07-01
Transition cycle fuel management problems are described and illustrated using results and experience attained during core reload design of NPP Krsko. Improved version of computer code package PSU-LEOPARD/Mcrac is successfully applied to NPP Krsko loading pattern design. (author)
International Nuclear Information System (INIS)
Erard, Timothee; Chancel, Lucas; Saujot, Mathieu
2015-01-01
The authors address three main questions: how are structured the network of actors and the tools for the struggle against fuel poverty, what are the specific data challenges faced by the actors and the possible responses, and which lessons can be learned for the governance of energy transition in its whole. After a presentation of the context of fuel poverty (analysis of tools for the struggle against fuel poverty, the use of social-energetic data), this study, based on about forty interviews of various actors and on a workshop, proposes an analysis framework which distinguishes six steps in the definition and implementation of policies of struggle against fuel poverty. After a description of the current status and an identification of required improvements for each step, the authors propose a set of recommendations, draw lessons for urban policies aimed at an ecologic transformation and a modernisation of the social protection system in terms of level of intervention, scope of actions, and ownership and access to data bases. These recommendations more particularly address the definition of fuel poverty, its diagnosis at the national and at the territorial level, a better identification of concerned households, and an assessment of existing arrangements
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
Energy Technology Data Exchange (ETDEWEB)
Rugh, John P [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kekelia, Bidzina [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kreutzer, Cory J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Titov, Eugene V [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-11-28
The U.S. uses 7.6 billion gallons of fuel per year for vehicle air conditioning (A/C), equivalent to 5.7 percent of the total national light-duty vehicle (LDV) fuel use. This equates to 30 gallons/year per vehicle, or 23.5 grams (g) of carbon dioxide (CO2) per mile, for an average U.S. vehicle. A/C is a significant contribution to national fuel use; therefore, technologies that reduce A/C loads may reduce operational costs, A/C fuel use, and CO2 emissions. Since A/C is not operated during standard EPA fuel economy testing protocols, EPA provides off-cycle credits to encourage OEMs to implement advanced A/C technologies that reduce fuel use in the real world. NREL researchers assessed thermal/solar off-cycle credits available in the U.S. Environmental Protection Agency's (EPA's) Final Rule for Model Year 2017 and Later Light-Duty Vehicle Greenhouse Gas Emissions and Corporate Average Fuel Economy. Credits include glazings, solar reflective paint, and passive and active cabin ventilation. Implementing solar control glass reduced CO2 emissions by 2.0 g/mi, and solar reflective paint resulted in a reduction of 0.8 g/mi. Active and passive ventilation strategies only reduced emissions by 0.1 and 0.2 g/mi, respectively. The national-level analysis process is powerful and general; it can be used to determine the impact of a wide range of new vehicle thermal technologies on fuel use, EV range, and CO2 emissions.
A Generalised Fault Protection Structure Proposed for Uni-grounded Low-Voltage AC Microgrids
Bui, Duong Minh; Chen, Shi-Lin; Lien, Keng-Yu; Jiang, Jheng-Lun
2016-04-01
This paper presents three main configurations of uni-grounded low-voltage AC microgrids. Transient situations of a uni-grounded low-voltage (LV) AC microgrid (MG) are simulated through various fault tests and operation transition tests between grid-connected and islanded modes. Based on transient simulation results, available fault protection methods are proposed for main and back-up protection of a uni-grounded AC microgrid. In addition, concept of a generalised fault protection structure of uni-grounded LVAC MGs is mentioned in the paper. As a result, main contributions of the paper are: (i) definition of different uni-grounded LVAC MG configurations; (ii) analysing transient responses of a uni-grounded LVAC microgrid through line-to-line faults, line-to-ground faults, three-phase faults and a microgrid operation transition test, (iii) proposing available fault protection methods for uni-grounded microgrids, such as: non-directional or directional overcurrent protection, under/over voltage protection, differential current protection, voltage-restrained overcurrent protection, and other fault protection principles not based on phase currents and voltages (e.g. total harmonic distortion detection of currents and voltages, using sequence components of current and voltage, 3I0 or 3V0 components), and (iv) developing a generalised fault protection structure with six individual protection zones to be suitable for different uni-grounded AC MG configurations.
Fuel fabrication and post-irradiation examination
Energy Technology Data Exchange (ETDEWEB)
Venter, P J; Aspeling, J C [Atomic Energy Corporation of South Africa Ltd., Pretoria (South Africa)
1990-06-01
This paper provides an overview of the A/c's Bevan and Eldopar facilities for the fabrication of nuclear fuel. It also describes the sophisticated Hot Cell Complex, which is capable of accommodating pressurised water reactor fuel and various other irradiated samples. Some interesting problems and their solutions are discussed. (author)
Fuel fabrication and post-irradiation examination
International Nuclear Information System (INIS)
Venter, P.J.; Aspeling, J.C.
1990-01-01
This paper provides an overview of the A/c's Bevan and Eldopar facilities for the fabrication of nuclear fuel. It also describes the sophisticated Hot Cell Complex, which is capable of accommodating pressurised water reactor fuel and various other irradiated samples. Some interesting problems and their solutions are discussed. (author)
International Nuclear Information System (INIS)
SKELLY, W.A.
1999-01-01
This document describes the approach and process in which the 100-K Area Facilities are to be deactivated and transitioned over to the Environmental Restoration Program after spent nuclear fuel has been removed from the K Basins. It describes the Transition Project's scope and objectives, work breakdown structure, activity planning, estimated cost, and schedule. This report will be utilized as a planning document for project management and control and to communicate details of project content and integration
International Nuclear Information System (INIS)
Ninokata, Hisashi; Sadatomi, Michio; Okawa, Tomio
2003-01-01
In order to establish a key technology to realize advanced BWR fuel designs, a three-year project of the advanced subchannel analysis code development had been started since 2002. The five dominant factors involved in the boiling transitional process in the fuel bundles were focused. They are, (1) inter-subchannel exchanges, (2) influences of obstacles (3) dryout of liquid film, (4) transition of two-phase flow regimes and (5) deposition of droplets. It has been recognized that present physical models or constitutive equations in subchannel formulations need to be improved so that they include geometrical effects in the fuel bundle design more mechanistically and universally. Through reviewing literatures and existent experimental results, underlying elementary processes and geometrical factors that are indispensable for improving subchannel codes were identified. The basic strategy that combines numerical and experimental approaches was proposed aiming at establishment of mechanistic models for the five dominant factors. In this paper, the present status of methodologies for detailed two-phase flow studies has been summarized. According to spatial scales of focused elementary processes, proper numerical approaches were selected. For some promising numerical approaches, preliminary calcitonins were performed for assessing their applicability to investigation of elementary processes involved in the boiling transition. (author)
Modelling and control of solid oxide fuel cell generation system in microgrid
Zhou, Niancheng; Li, Chunyan; Sun, Fangqing; Wang, Qianggang
2017-11-01
Compared with other kinds of fuel cells, solid oxide fuel cell (SOFC) has been widely used in microgrids because of its higher efficiency and longer operation life. The weakness of SOFC lies in its slow response speed when grid disturbance occurs. This paper presents a control strategy that can promote the response speed and limit the fault current impulse for SOFC systems integrated into microgrids. First, the hysteretic control of the bidirectional DC-DC converter, which joins the SOFC and DC bus together, is explored. In addition, an improved droop control with limited current protection is applied in the DC-AC inverter, and the active synchronization control is applied to ensure a smooth transition of the microgrid between the grid-connected mode and the islanded mode. To validate the effectiveness of this control strategy, the control model was built and simulated in PSCAD/EMTDC.
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Secondary fuel delivery system
Parker, David M.; Cai, Weidong; Garan, Daniel W.; Harris, Arthur J.
2010-02-23
A secondary fuel delivery system for delivering a secondary stream of fuel and/or diluent to a secondary combustion zone located in the transition piece of a combustion engine, downstream of the engine primary combustion region is disclosed. The system includes a manifold formed integral to, and surrounding a portion of, the transition piece, a manifold inlet port, and a collection of injection nozzles. A flowsleeve augments fuel/diluent flow velocity and improves the system cooling effectiveness. Passive cooling elements, including effusion cooling holes located within the transition boundary and thermal-stress-dissipating gaps that resist thermal stress accumulation, provide supplemental heat dissipation in key areas. The system delivers a secondary fuel/diluent mixture to a secondary combustion zone located along the length of the transition piece, while reducing the impact of elevated vibration levels found within the transition piece and avoiding the heat dissipation difficulties often associated with traditional vibration reduction methods.
International Nuclear Information System (INIS)
Abdelhamid, Tamer H.; Sabzali, Ahmad J.
2008-01-01
This paper presents a new zero voltage transition (ZVT), power factor corrected three phase ac-ac converter with single phase high frequency (HF) link. It is a two stage converter; the first stage is a boost integrated bridge converter (combination of a 3 ph boost converter and a bridge converter) operated at fixed frequency and that operates in two modes at ZVT for all switches and establishes a 1 ph square wave HF link. The second stage is a bi-directional pulse width modulation (PWM) 3 ph bridge that converts the 1 ph HF link to a 3 ph voltage using a novel switching strategy. The converter modes of operation and key equations are outlined. Simulation of the overall system is conducted using Simulink. The switching strategy and its corresponding control circuit are clearly described. Experimental verification of the simulation is conducted for a prototype of 100 V, 500 W at 10 kHz link frequency
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
International Nuclear Information System (INIS)
Akie, Hiroshi; Nakano, Yoshihiro; Okubo, Tsutomu
2011-01-01
The key concept of Innovative Water Reactor for Flexible Fuel Cycle (FLWR) is a core transition from a high conversion (HC) type to a plutonium breeding (BR) type in a same reactor system only by replacing fuel assemblies. Consequently in this transition phase, there are two types of assemblies in the same core. Due to the differences of the two assembly types, region-wise soft to hard neutron spectra appears and result in a large power peaking. Therefore, power distribution of FLWR in the HC to BR transition phase was studied by performing assembly and core calculations. For the whole core calculation, a new 14-group energy structure is developed to better represent the power distribution obtained with the fine 107-group structure than the 9-group structure in the previous evaluations. Calculations on few assemblies geometries show large local power peakings can be effectively reduced by considering plutonium enrichment distribution in an assembly. In the whole core calculation, there is a power level mismatch between HC and BR assemblies, but overall power distribution flattening is possible by optimizing fuel assemblies loading. Although the fuel loading should be decided also taking into account the void coefficient, transition from HC to BR type FLWR seems feasible without difficulty. (author)
Electrodeformation of multi-bilayer spherical concentric membranes by AC electric fields
Lira-Escobedo, J.; Arauz-Lara, J.; Aranda-Espinoza, H.; Adlerz, K.; Viveros-Mendez, P. X.; Aranda-Espinoza, S.
2017-09-01
It is now well established that external stresses alter the behaviour of cells, where such alterations can be as profound as changes in gene expression. A type of stresses of particular interest are those due to alternating-current (AC) electric fields. The effect of AC fields on cells is still not well understood, in particular it is not clear how these fields affect the cell nucleus and other organelles. Here, we propose that one possible mechanism is through the deformation of the membranes. In order to investigate the effect of AC fields on the morphological changes of the cell organelles, we modelled the cell as two concentric bilayer membranes. This model allows us to obtain the deformations induced by the AC field by balancing the elastic energy and the work done by the Maxwell stresses. Morphological phase diagrams are obtained as a function of the frequency and the electrical properties of the media and membranes. We demonstrate that the organelle shapes can be changed without modifying the shape of the external cell membrane and that the organelle deformation transitions can be used to measure, for example, the conductivity of the nucleus.
Thermal margin model for transition core of KSNP
International Nuclear Information System (INIS)
Nahm, Kee Yil; Lim, Jong Seon; Park, Sung Kew; Chun, Chong Kuk; Hwang, Sun Tack
2004-01-01
The PLUS7 fuel was developed with mixing vane grids for KSNP. For the transition core partly loaded with the PLUS7 fuels, the procedure to set up the optimum thermal margin model of the transition core was suggested by introducing AOPM concept into the screening method which determines the limiting assembly. According to the procedure, the optimum thermal margin model of the first transition core was set up by using a part of nuclear data for the first transition and the homogeneous core with PLUS7 fuels. The generic thermal margin model of PLUS7 fuel was generated with the AOPM of 138%. The overpower penalties on the first transition core were calculated to be 1.0 and 0.98 on the limiting assembly and the generic thermal margin model, respectively. It is not usual case to impose the overpower penalty on reload cores. It is considered that the lack of channel flow due to the difference of pressure drop between PLUS7 and STD fuels results in the decrease of DNBR. The AOPM of the first transition core is evaluated to be about 135% by using the optimum generic thermal margin model which involves the generic thermal margin model and the total overpower penalty. The STD fuel is not included among limiting assembly candidates in the second transition core, because they have much lower pin power than PLUS7 fuels. The reduced number of STD fuels near the limiting assembly candidates the flow from the limiting assembly to increase the thermal margin for the second transition core. It is expected that cycle specific overpower penalties increase the thermal margin for the transition core. Using the procedure to set up the optimum thermal margin model makes sure that the enhanced thermal margin of PLUS7 fuel can be sufficiently applied to not only the homogeneous core but also the transition core
Models of fuel masses transition during second stage of the accident on Chernobyl NPP
International Nuclear Information System (INIS)
Tarapon, A.
2002-01-01
In ISPE NASU of Ukraine are developed mathematical models and software, which allow to research the processes of fuel masses transition during the accident at ChNPP. We found out, that the main reason of accident on ChNPP is the happening in the reactor of crisis of heat exchange of the second sort, instead of the effect positive output of reactivity from displacers of rods of system of emergency protection, as is accepted in official version
Schneider, Steven J. (Inventor)
2001-01-01
A reduced toxicity fuel satellite propulsion system including a reduced toxicity propellant supply for consumption in an axial class thruster and an ACS class thruster. The system includes suitable valves and conduits for supplying the reduced toxicity propellant to the ACS decomposing element of an ACS thruster. The ACS decomposing element is operative to decompose the reduced toxicity propellant into hot propulsive gases. In addition the system includes suitable valves and conduits for supplying the reduced toxicity propellant to an axial decomposing element of the axial thruster. The axial decomposing element is operative to decompose the reduced toxicity propellant into hot gases. The system further includes suitable valves and conduits for supplying a second propellant to a combustion chamber of the axial thruster, whereby the hot gases and the second propellant auto-ignite and begin the combustion process for producing thrust.
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Energy Technology Data Exchange (ETDEWEB)
Hitchcock, David
2012-06-29
The Texas Hydrogen Highway project has showcased a hydrogen fuel cell transit bus and hydrogen fueling infrastructure that was designed and built through previous support from various public and private sector entities. The aim of this project has been to increase awareness among transit agencies and other public entities on these transportation technologies, and to place such technologies into commercial applications, such as a public transit agency. The initial project concept developed in 2004 was to show that a skid-mounted, fully-integrated, factory-built and tested hydrogen fueling station could be used to simplify the design, and lower the cost of fueling infrastructure for fuel cell vehicles. The approach was to design, engineer, build, and test the integrated fueling station at the factory then install it at a site that offered educational and technical resources and provide an opportunity to showcase both the fueling station and advanced hydrogen vehicles. The two primary technology components include: Hydrogen Fueling Station: The hydrogen fueling infrastructure was designed and built by Gas Technology Institute primarily through a funding grant from the Texas Commission on Environmental Quality. It includes hydrogen production, clean-up, compression, storage, and dispensing. The station consists of a steam methane reformer, gas clean-up system, gas compressor and 48 kilograms of hydrogen storage capacity for dispensing at 5000 psig. The station is skid-mounted for easy installation and can be relocated if needed. It includes a dispenser that is designed to provide temperaturecompensated fills using a control algorithm. The total station daily capacity is approximately 50 kilograms. Fuel Cell Bus: The transit passenger bus built by Ebus, a company located in Downey, CA, was commissioned and acquired by GTI prior to this project. It is a fuel cell plug-in hybrid electric vehicle which is ADA compliant, has air conditioning sufficient for Texas operations
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
International Nuclear Information System (INIS)
Watahiki, M.; Murakami, M.; Yoo, S.I.
1997-01-01
We report the temperature and magnetic field dependence of the complex a.c. susceptibility with bias d.c. magnetic fields for melt-processed Nd-Ba-Cu-O superconductor. The onset temperature (T onset ) of the real part of a.c. susceptibility shifted to a lower temperature with increasing d.c. magnetic field. The superconducting transition temperature (T c ) determined by d.c. magnetization measurements did not shift appreciably to a lower-temperature region with increasing d.c. magnetic field. The distinction between T onset and T c indicates that the a.c. susceptibility measurements detect the energy dissipation generated by the motion of flux lines. We have also measured flux profiles and found that there was no appreciable change in flux penetration below and above the peak field, which suggests that the peak effect in Nd-Ba-Cu-O is not due to the phase transition in the flux line lattice. (author)
Directory of Open Access Journals (Sweden)
Juan J. Vidal-Amaro
2018-03-01
Full Text Available Renewable energy sources exploitation acquires special importance for creating low-carbon energy systems. In Mexico a national regulation limits the fossil fuel-based electricity generation to 65%, 60% and 50% by years 2024, 2030 and 2050 respectively. This study evaluates several scenarios of renewables incorporation into the Mexican electricity system to attend those targets as well as a 75% renewables-based electricity share target towards a 100% renewable system. By its size, the Mexican electricity system, with a generation of 260.4 TWh/year (85% based on fossil fuels, can be regarded as an illustrating reference. The impact of increasing amounts of wind, photovoltaic solar, biomass, biogas, geothermal, hydro and concentrating solar power on the system’s capacity to attend demand on a one-hour timescale resolution is investigated utilizing the EnergyPLAN model and the minimum total mix capacity method. Possible excess of electricity production is also assessed. For every target year, a solution is obtained corresponding to the combination resulting in the minimum total generation capacity for the electricity system. A transition strategy to a system with a high share of renewables-based electricity is designed where every transition step corresponds to the optimal energy mix for each of the target years.
International Nuclear Information System (INIS)
Yang, Shipin; Chellali, Ryad; Lu, Xiaohua; Li, Lijuan; Bo, Cuimei
2016-01-01
Accurate models of PEM (proton exchange membrane) fuel cells are of great significance for the analysis and the control for power generation. We present a new semi-empirical model to predict the voltage outputs of PEM fuel cell stacks. We also introduce a new estimation method, called AC-POA (aging and challenging P systems based optimization algorithm) allowing deriving the parameters of the semi-empirical model. In our model, the cathode inlet pressure is selected as an additional factor to modify the expression of concentration over-voltage V con for traditional Amphlett's PEM fuel cell model. In AC-POA, the aging-mechanism inspired object updating rule is merged in existing P system. We validate through experiments the effectiveness of AC-POA and the fitting accuracy of our model. Modeling comparison results show that the predictions of our model are the best in terms of fitting to actual sample data. - Highlights: • Presented a p c -based modificatory semi-empirical model for PEMFC stack. • Introduced a new aging inspired improved parameter estimation algorithm, AC-POA. • Validated the effectiveness of the AC-POA and the new model. • Remodeled the practical PEM fuel cell system.
Energy Technology Data Exchange (ETDEWEB)
Zargari, S.A. [Iran Univ. of Science and Technology, Teheran (Iran, Islamic Republic of); Khan, A.M. [Carleton Univ., Ottawa, ON (Canada). Dept. of Civil and Environmental Engineering
2000-07-01
The interest in rapid bus transit has increased sharply with the realization that modern metropolitan areas rely on public transit to provide for strong economies and communities. As a prevention tool against traffic congestion, deteriorating air quality and rising greenhouse gas emissions, this study of bus fuel consumption was designed to assist in the planning and management of rapid bus transit. The Australian Road Research Board's (ARRB) Road Fuel Consumption Model was used as a starting point. The estimations required were realized with the help of Newtonian Mechanics. The four states of vehicular traffic were examined: acceleration, cruise, deceleration, and idle. The estimated total power required from the engine to overcome resistance forces, to run vehicle accessories and overcome internal engine friction was calculated. The data for the standard and articulated bus was obtained from OC Transpo in Ottawa. The study permitted the authors to conclude that the estimations for the parameters for power requirements and fuel consumption for heavy duty vehicles are appropriate. The methodology for the estimation of fuel consumption on the Transitway, which is part of the rapid bus transit system, proved adequate. In addition, the methodology was useful to estimate fuel savings resulting from demand management strategies with potential for modal shift. 9 refs., 6 tabs.
A nuclear reactor core fuel reload optimization using Artificial-Ant-Colony Connective Networks
International Nuclear Information System (INIS)
Lima, Alan M.M. de; Schirru, Roberto
2005-01-01
A Pressurized Water Reactor core must be reloaded every time the fuel burnup reaches a level when it is not possible to sustain nominal power operation. The nuclear core fuel reload optimization consists in finding a burned-up and fresh-fuel-assembly pattern that maximizes the number of full operational days. This problem is NP-hard, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Besides that, the problem is non-linear and its search space is highly discontinual and multimodal. In this work a parallel computational system based on Ant Colony System (ACS) called Artificial-Ant-Colony Networks is introduced to solve the nuclear reactor core fuel reload optimization problem. ACS is a system based on artificial agents that uses the reinforcement learning technique and was originally developed to solve the Traveling Salesman Problem, which is conceptually similar to the nuclear fuel reload problem. (author)
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
International Nuclear Information System (INIS)
Anon.
2010-01-01
In december 2010 IAEA gave its agreement for the creation of a nuclear fuel bank. This bank will allow IAEA to help member countries that renounce to their own uranium enrichment capacities. This bank located on one or several member countries will belong to IAEA and will be managed by IAEA and its reserve of low enriched uranium will be sufficient to fabricate the fuel for the first load of a 1000 MW PWR. Fund raising has been successful and the running of the bank will have no financial impact on the regular budget of the IAEA. Russia has announced the creation of the first nuclear fuel bank. This bank will be located on the Angarsk site (Siberia) and will be managed by IAEA and will own 120 tonnes of low-enriched uranium fuel (between 2 and 4.95%), this kind of fuel is used in most Russian nuclear power plants. (A.C.)
International Nuclear Information System (INIS)
Kuznietz, M.; Andre, G.; Bouree, F.; Pinto, H.; Ettedgui, H.; Melamud, M.
1993-01-01
The magnetic properties of two U(Ni 1-x Cu x ) 2 Si 2 solid in the vicinity of x = 0.50 (denoted I and II) have been studied by neutron diffraction and ac-susceptibility. Both materials have ThCr 2 Si 2 -type crystallographic structure. AC-susceptibility shows antiferromagnetic transitions at T N 150±5 K in UNiCuSi 2 (I) and 155±5 K in UNiCuSi 2 (II), followed by several transitions with ferrimagnetic (F) character at lower temperatures. Apart from the transitions to AF-I structure at T N =150K and 152K none of the F transitions is observed by neutron diffraction. Short-range magnetic order, involving several consecutive ferromagnetic planes or ferrimagnetic groups of planes in the AF-I phase, detected by ac-susceptibility and not by neutron diffraction in both materials and therefore significant to x ∼ 0.50, is proposed to explain the unusual susceptibility. (Author)
Directory of Open Access Journals (Sweden)
Noroozian
2009-06-01
Full Text Available This paper presents the modeling and simulation of a proton exchange membrane fuel cell (PEMFC generation system for off-grid and on-grid operation and configuration. A fuel cell DG system consists of a fuel cell power plant, a DC/DC converter and a DC/AC inverter. The dynamic model for fuel cell array and its power electronic interfacing are presented also a multi-input single output (MISO DC/DC converter and its control scheme is proposed and analyzed. This DC/DC converter is capable of interfacing fuel cell arrays to the DC/AC inverter. Also the mathematical model of the inverter is obtained by using average technique. Then the novel control strategy of DC/AC inverter for different operating conditions is demonstrated. The simulation results show the effectiveness of the suggested control systems under both on-grid and off-grid operation modes.
Fuel Cycle Concept with Advanced METMET and Composite Fuel in LWRs
International Nuclear Information System (INIS)
Savchenko, A.; Skupov, M.; Vatulin, A.; Glushenkov, A.; Kulakov, G.; Lipkina, K.
2014-01-01
The basic factor that limits the serviceability of fuel elements developing in the framework of RERTR Program (transition from HEU to LEU fuel of research reactors) is interaction between U10Mo fuel and aluminium matrix . Interaction results in extra swelling of fuels, disappearance of a heat conducting matrix, a temperature rise in the fuel centre, penetration porosity, etc. Several methods exist to prevent fuel-matrix interaction. In terms of simplifying fuel element fabrication technology and reducing interaction, doping of fuel is the most optimal version
International Nuclear Information System (INIS)
Butabaev, Yu.S.
1994-01-01
The decay of the deformed 167 Yb, 164 Tm, 225 Ac, 221 Fr nuclei is investigated in this work. For 167 Yb and 164 Tm decays the specters of the conversion electrons were measured. 32 γ-transitions were found for 167 Yb decay, 6 of which were found for the first time. The multipolarities for 9 γ-transitions were found. For 164 Tm decay 23 new γ-transitions were found. The theoretical investigations of the collective states in the nucleus were carried out. Octupole-rotatory line with k=1 - was found in the measurement of conversion electrons specters of the short-life nuclei. Device' nonlinearity was 0,04%. Resolution was Δβρ/βρ 0,11%. Effective light yield was 1-2 %. The decay of 225 Ac and 221 Fr nuclei were investigated. The investigations of α-γ -coincidence, α-γ - rays were carried out. 24 new γ -transitions for 225 Ac and 13 ones for 221 Fr were found. The new levels and their intensities were defined more precisely. Intensity balance calculations were carried out and the full populations of the nuclear levels were calculated. (author). 3 tabs.; 10 figs
Vaz, Sharmila; Parsons, Richard; Falkmer, Torbjörn; Passmore, Anne Elizabeth; Falkmer, Marita
2014-01-01
Students negotiate the transition to secondary school in different ways. While some thrive on the opportunity, others are challenged. A prospective longitudinal design was used to determine the contribution of personal background and school contextual factors on academic competence (AC) and mental health functioning (MHF) of 266 students, 6-months before and after the transition to secondary school. Data from 197 typically developing students and 69 students with a disability were analysed using hierarchical linear regression modelling. Both in primary and secondary school, students with a disability and from socially disadvantaged backgrounds gained poorer scores for AC and MHF than their typically developing and more affluent counterparts. Students who attended independent and mid-range sized primary schools had the highest concurrent AC. Those from independent primary schools had the lowest MHF. The primary school organisational model significantly influenced post-transition AC scores; with students from Kindergarten--Year 7 schools reporting the lowest scores, while those from the Kindergarten--Year 12 structure without middle school having the highest scores. Attending a school which used the Kindergarten--Year 12 with middle school structure was associated with a reduction in AC scores across the transition. Personal background factors accounted for the majority of the variability in post-transition AC and MHF. The contribution of school contextual factors was relatively minor. There is a potential opportunity for schools to provide support to disadvantaged students before the transition to secondary school, as they continue to be at a disadvantage after the transition.
Ex-vessel nuclear fuel transfer system
International Nuclear Information System (INIS)
Wade, E.E.
1978-01-01
A system for transferring fuel assemblies between a fuel transfer area and a fuel storage area while the fuel assemblies remain completely submerged in a continuous body of coolant is described. A fuel transfer area filled with reactor coolant communicating with the reactor vessel below the reactor coolant level provides a transfer area for fuel assemblies in transit to and from the reactor vessel. A positioning mechanism comprising at least one rotatable plug disposed on a fuel transfer tank located outside the reactor vessel cooperates with either the fuel transfer area or the fuel storage area to position a fuel assembly in transit. When in position, a transporting mechanism cooperating with the positioning mechanism lifts or lowers a chosen fuel assembly. The transporting mechanism together with the positioning mechanism are capable of transferring a fuel assembly between the fuel transfer area and the fuel storage area
How can we ensure the energy transition? Comment assurer la transition energetique?
Energy Technology Data Exchange (ETDEWEB)
Rojey, Alexandre
2007-07-01
With a continuously growing energy demand, the present energy model is clearly unsustainable due to the decline of fossil fuel resources and the risks of climate change A transition towards a sustainable model is therefore needed. However, there are no immediate alternatives leading to a sharp reduction in the use of fossil fuels, which are expected to maintain a major role for many years. The energy transition will therefore require a long time period The risks of climate change will require urgent measures and the 'carbon transition' has to be achieved more rapidly than the energy transition itself. A whole set of solutions will be needed in the technical but also economic and regulatory areas, for achieving a successful transition: energy conservation, diversification of energy . sources, reduction of the carbon content of the energy mix, CO{sub 2}, capture and storage. Hybrid options will be favoured. The paper describes the main features of the upcoming transition and the actions which are required. (auth)
A novel wireless power and data transmission AC to DC converter for an implantable device.
Liu, Jhao-Yan; Tang, Kea-Tiong
2013-01-01
This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz.
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
International Nuclear Information System (INIS)
Wickramasinghe, Anoja
2011-01-01
Easy energy access is a trigger for human, social, and economic development. A research project was undertaken in Sri Lanka to broaden the understanding of human dimension of energy access and technologies. A questionnaire survey, covering 2269 households, gathered data on socio-economic contexts and issues influencing a transition towards clean cooking facilities. The findings reveal that the transition is impeded by four factors: the lack of motivation and the pressure for switching over to cleaner facilities, the lack of modern energy technology options, the financial risks, and the lack of financing and other support. The paper describes the delicate two-way interrelation between women earning wages and the transitions to cleaner cooking fuels and technologies. The findings suggest the need for a policy framework involving the stakeholders, financing and standardised technologies. To make a change it is proposed to introduce a national, integrated policy incorporating financing and energy governance. - Highlights: ► Households in Sri Lanka lack access to modern energy technology options for cooking. ► Cooking with fuel wood and residues is the norm in Sri Lanka, particularly in rural households. ► A survey of rural households revealed that most cannot afford to switch to cleaner cooking options. ► Most households have little awareness of the health impacts of biomass cooking. ► Women in regular formal employment are more likely to value cleaner cooking options that save time.
Directory of Open Access Journals (Sweden)
Sharmila Vaz
Full Text Available Students negotiate the transition to secondary school in different ways. While some thrive on the opportunity, others are challenged. A prospective longitudinal design was used to determine the contribution of personal background and school contextual factors on academic competence (AC and mental health functioning (MHF of 266 students, 6-months before and after the transition to secondary school. Data from 197 typically developing students and 69 students with a disability were analysed using hierarchical linear regression modelling. Both in primary and secondary school, students with a disability and from socially disadvantaged backgrounds gained poorer scores for AC and MHF than their typically developing and more affluent counterparts. Students who attended independent and mid-range sized primary schools had the highest concurrent AC. Those from independent primary schools had the lowest MHF. The primary school organisational model significantly influenced post-transition AC scores; with students from Kindergarten--Year 7 schools reporting the lowest scores, while those from the Kindergarten--Year 12 structure without middle school having the highest scores. Attending a school which used the Kindergarten--Year 12 with middle school structure was associated with a reduction in AC scores across the transition. Personal background factors accounted for the majority of the variability in post-transition AC and MHF. The contribution of school contextual factors was relatively minor. There is a potential opportunity for schools to provide support to disadvantaged students before the transition to secondary school, as they continue to be at a disadvantage after the transition.
International Nuclear Information System (INIS)
Anon.
2001-01-01
A French prototype of a fuel cell based on the PEM (proton exchange membrane) technology has been designed by Helion, a branch of Technicatome, this fuel cell delivers 300 kW and will be used in naval applications and terrestrial transport. The main advantages of fuel cell are: 1) no contamination, even if the fuel used is natural gas the quantities of CO 2 and CO emitted are respectively 17 and 75 times as little as the maximal quantities allowed by European regulations, 2) efficiency, the electric yield is up to 60 % and can reach 80 % if we include the recovery of heat, 3) silent, the fuel cell itself does not make noise. The present price of fuel cell is the main reason that hampers its industrial development, this price is in fact strongly dependant on the cost of its different components: catalyzers, membranes, bipolar plates and the hydrogen supply. This article gives the technical characteristics of the Helion's fuel cell. (A.C.)
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS
Directory of Open Access Journals (Sweden)
S. YU. Buryak
2014-05-01
Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.
Energy Technology Data Exchange (ETDEWEB)
NONE
1991-11-01
With no doubt, 1991 has been a good year for Nuclear Energy in Mexico. The record imposed by Laguna Verde Nuclear Power Plant, the first in his type in the world, operating without interruption in its first operating cycle, represents a splendid incentive for we all the nuclear workers. This fact is reflected in the percentage of papers presented in this congress, dealing with several aspects of Laguna Verde Central. This achievement should serve as an impulse for the development of other areas of application of nuclear energy in the country and at the same time be a reflection of the participation of the members of our society with good quality papers. In this Second Congress of Sociedad Nuclear Mexicana A.C., around thirty papers were presented in the technical sessions, in areas as: fuel management, radiation protection, reactor physics, transients analysis, nuclear materials and others. A special section is dedicated to present the experiences of the first fuel reload of Unit 1 in Laguna Verde Nuclear Power Plant,as well as different plenary meetings dedicated to subjects of general interest as advanced reactors, waste disposal and others. It is the wish of all the members of Sociedad Nuclear Mexicana A.C., that this annual meetings will be enriched with the enthusiastic participation of the scholars of nuclear field and that they represent the forum that we all need for the exchange of knowledge and experiences. (Author).
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Transition? What transition? : Changing energy systems in an increasingly carbon constrained world
Mc Cahery, J.A.; Lopez de Silanes, Florencio; de Roode, Alexander
2014-01-01
Energy transitions have been taking place continuously since the Industrial Revolution. These transitions primarily involve national energy mixes. In general, countries keep moving up the energy ladder, meaning that they integrate larger and larger proportions of specialized fuels into their energy
International Nuclear Information System (INIS)
1983-01-01
In preparation of constructing ''Monju'', a prototype fast breeder reactor, PNC has been pushing forward its research and development projects and the ACS was constructed under these projects. The auxiliary cooling system is an important engineered safety feature, and is used for safe removal of heat from the reactor at the shutdown. The ACS serves as a means of testing and assessing the auxiliary cooling system for the ''Monju'' and is designed and manufactured to have one fifth capacity of the Monju. The air heat exchanger and the ACS system was designed to withstand higher temperature range of the conventional design code (MITI-501), and finned tubes were applied for effective heat removal. Preheating system was designed to heat up the whole system over 200 0 C within 20 hours to prevent sodium from freezing. Basic performance of ACS was verified satisfactorily by a series of performance tests, such as start up test, flow rate measurement and preheating test before delivery. The experience from designing and construction of ACS and data obtained by these tests will be very instructive for designing and construction of the ''Monju''. (author)
International Nuclear Information System (INIS)
Anon.
2010-01-01
European Union bio-fuel use for transport reached 12 million tonnes of oil equivalent (mtoe) threshold during 2009. The slowdown in the growth of European consumption deepened again. Bio-fuel used in transport only grew by 18.7% between 2008 and 2009, as against 30.3% between 2007 and 2008 and 41.8% between 2006 and 2007. The bio-fuel incorporation rate in all fuels used by transport in the E.U. is unlikely to pass 4% in 2009. We can note that: -) the proportion of bio-fuel in the German fuels market has plummeted since 2007: from 7.3% in 2007 to 5.5% in 2009; -) France stays on course with an incorporation rate of 6.25% in 2009; -) In Spain the incorporation rate reached 3.4% in 2009 while it was 1.9% in 2008. The European bio-diesel industry has had another tough year. European production only rose by 16.6% in 2009 or by about 9 million tonnes which is well below the previous year-on-year growth rate recorded (35.7%). France is leading the production of bio-ethanol fuels in Europe with an output of 1250 million liters in 2009 while the total European production reached 3700 million litters and the world production 74000 million liters. (A.C.)
Manzano, Susana; Aguado, Encarnación; Martínez, Cecilia; Megías, Zoraida; García, Alicia; Jamilena, Manuel
2016-01-01
Monoecious and andromonoecious cultivars of watermelon are characterised by the production of male and female flower or male and hermaphrodite flowers, respectively. The segregation analysis in the offspring of crosses between monoecious and andromonoecious lines has demonstrated that this trait is controlled by a single gene pair, being the monoecious allele M semi-dominant to the andromonoecious allele A. The two studied F1 hybrids (MA) had a predominantly monoecious phenotype since both produced not only female flowers, but also bisexual flowers with incomplete stamens, and hermaphrodite flowers with pollen. Given that in other cucurbit species andromonoecy is conferred by mutations in the ethylene biosynthesis genes CmACS7, CsACS2 and CpACS27A we have cloned and characterised CitACS4, the watermelon gene showing the highest similarity with the formers. CitACS4 encoded for a type ACS type III enzyme that is predominantly expressed in pistillate flowers of watermelon. In the andromonoecious line we have detected a missense mutation in a very conserved residue of CitACS4 (C364W) that cosegregates with the andromonoecious phenotype in two independent F2 populations, concomitantly with a reduction in ethylene production in the floral buds that will develop as hermaphrodite flowers. The gene does not however co-segregates with other sex expression traits regulated by ethylene in this species, including pistillate flowering transition and the number of pistillate flowers per plant. These data indicate that CitAC4 is likely to be involved in the biosynthesis of the ethylene required for stamen arrest during the development of female flowers. The C364W mutation would reduce the production of ethylene in pistillate floral buds, promoting the conversion of female into hermaphrodite flowers, and therefore of monoecy into andromonoecy.
Solar Electricity and Solar Fuels: Status and Perspectives in the Context of the Energy Transition.
Armaroli, Nicola; Balzani, Vincenzo
2016-01-04
The energy transition from fossil fuels to renewables is already ongoing, but it will be a long and difficult process because the energy system is a gigantic and complex machine. Key renewable energy production data show the remarkable growth of solar electricity technologies and indicate that crystalline silicon photovoltaics (PV) and wind turbines are the workhorses of the first wave of renewable energy deployment on the TW scale around the globe. The other PV alternatives (e.g., copper/indium/gallium/selenide (CIGS) or CdTe), along with other less mature options, are critically analyzed. As far as fuels are concerned, the situation is significantly more complex because making chemicals with sunshine is far more complicated than generating electric current. The prime solar artificial fuel is molecular hydrogen, which is characterized by an excellent combination of chemical and physical properties. The routes to make it from solar energy (photoelectrochemical cells (PEC), dye-sensitized photoelectrochemical cells (DSPEC), PV electrolyzers) and then synthetic liquid fuels are presented, with discussion on economic aspects. The interconversion between electricity and hydrogen, two energy carriers directly produced by sunlight, will be a key tool to distribute renewable energies with the highest flexibility. The discussion takes into account two concepts that are often overlooked: the energy return on investment (EROI) and the limited availability of natural resources-particularly minerals-which are needed to manufacture energy converters and storage devices on a multi-TW scale. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Kim, Jong-Soo; Choe, Gyu-Yeong; Lee, Byoung-Kuk [School of Information and Communication Engineering, Sungkyunkwan University, 300 Cheoncheon-dong, Jangan-gu, Suwon, Gyeonggi-do 440-746 (Korea, Republic of); Kang, Hyun-Soo [R and D Center, Advanced Drive Technology (ADT) Company, 689-26 Geumjeong-dong, Gunpo-si, Gyeonggi-do 435-862 (Korea, Republic of)
2011-05-15
The low frequency current ripple in grid-connected fuel cell systems is generated from dc-ac inverter operation, which generates 60 Hz fundamental component, and gives harmful effects on fuel cell stack itself, such as making cathode surface responses slower, causing an increase of more than 10% in the fuel consumption, creating oxygen starvation, causing a reduction in the operating lifetime, and incurring a nuisance tripping such as overload situation. With these reasons, low frequency current ripple makes fuel cell system unstable and lifetime of fuel cell stack itself short. This paper presents a fast and robust control algorithm to eliminate low frequency current ripple in grid-connected fuel cell systems. Compared with the conventional methods, in the proposed control algorithm, dc link voltage controller is shifted from dc-dc converter to dc-ac inverter, resulting that dc-ac inverter handles dc link voltage control and output current control simultaneously with help of power balancing technique. The results indicate that the proposed algorithm can not only completely eliminate current ripple but also significantly reduce the overshoot or undershoot during transient states without any extra hardware. The validity of the proposed algorithm is verified by computer simulations and also by experiments with a 1 kW laboratory prototype. (author)
In-core fuel management and perspectives
International Nuclear Information System (INIS)
Waeckel, N.
2009-01-01
The management of nuclear fuel inside the core has to take into account the necessity to stop the reactor periodically to renew the fuel partially and to perform maintenance operations. The fuel management strategy determines the cost of the fuel (through the number of assemblies that have been changed and their enrichment rate) and the duration of the campaign till next stop. Fuel management strategies have to conciliate different objectives: -) the safety of the reactor, -) the reliability of the fuel assemblies, -) the optimization of the fuel cost by increasing the discharge burnup. The necessity of spent fuel processing implies a maximal discharge burnup. During the 1990-2000 period, the discharge burnups have been progressively increased through the following fuel management strategies: Garance, Cyclades and Gemmes. During the years 2000-2009, the progressive absorption of the nuclear over-equipment, the opening of the European electricity markets favored power production through the MOX-parity, Alcade and Galice fuel management strategies. The perspective for next decade is to favor production to the prejudice of higher burnups. (A.C.)
Directory of Open Access Journals (Sweden)
Yu. S. Petrusha
2013-01-01
Full Text Available Possible risks pertaining to transition of electric-power industry to market relations have been considered in the paper. The paper presents an integrated ACS for generation and sale of electric power as an improvement of methodology for organizational and technical management. The given system is based on integration of operating Automatic Dispatch Control System (ADCS and developing Automatic Electricity Meter Reading System (AEMRS. The paper proposes to form an inter-branch sector of ACS PLC (Automatic Control System for Prolongation of Life Cycle users which is oriented on provision of development strategy.
High Efficiency Reversible Fuel Cell Power Converter
DEFF Research Database (Denmark)
Pittini, Riccardo
as well as different dc-ac and dc-dc converter topologies are presented and analyzed. A new ac-dc topology for high efficiency data center applications is proposed and an efficiency characterization based on the fuel cell stack I-V characteristic curve is presented. The second part discusses the main...... converter components. Wide bandgap power semiconductors are introduced due to their superior performance in comparison to traditional silicon power devices. The analysis presents a study based on switching loss measurements performed on Si IGBTs, SiC JFETs, SiC MOSFETs and their respective gate drivers...
A Nonlinear Fuel Optimal Reaction Jet Control Law
National Research Council Canada - National Science Library
Breitfeller, Eric
2002-01-01
We derive a nonlinear fuel optimal attitude control system (ACS) that drives the final state to the desired state according to a cost function that weights the final state angular error relative to the angular rate error...
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Transition strategy of the transportation energy and powertrain in China
International Nuclear Information System (INIS)
Wang Hewu; Ouyang Minggao
2007-01-01
The problems of the transportation energy and environment are the major challenges faced globally in the 21st century and are especially serious for China. The future 20 years is the strategic opportunity period of the transition of the transportation energy and powertrain system for China. The greatest characteristics of hydrogen economy lie in its diversity of the primary energy source, the unification of energy carrier and the greening of energy transformation. Development of hydrogen energy transportation powertrain system is suitable for China from the views of the situation of Chinese resources and energy sources, the urban and rural layouts, the superiority of later development and the successful practices of clean cars and electric vehicle development projects. The transition of the transportation energy powertrain system includes three parts: the transition of the energy structure, the transition of the powertrain system and the transition of the fuel infrastructure. The technical pathways of energy powertrain system transition includes expending the use of gaseous fuel to prompt the multiform of the transportation energy and to prepare for the transition of the infrastructure simultaneously, developing and promoting the hybrid technology to solve the current energy and environment problems and to prepare for the transition of powertrain system, and focusing on the research and development and demonstration of fuel cell vehicles and the hydrogen energy technology to prompt the earlier formation of the market of fuel cell vehicles. The goal in the near and medium term of transition is to reduce the fuel consumption by 100 million ton in 2020 by substituting and saving, and the long-term goal is to setup the infrastructure of hydrogen and fuel cell vehicle as the main one replacing the petroleum internal combustion engine vehicle. In order to realize the strategic goals of the transition, the four-phases strategic periods and research and development
Matsuzaki, Yoshio; Tachikawa, Yuya; Somekawa, Takaaki; Hatae, Toru; Matsumoto, Hiroshige; Taniguchi, Shunsuke; Sasaki, Kazunari
2015-07-01
Solid oxide fuel cells (SOFCs) are promising electrochemical devices that enable the highest fuel-to-electricity conversion efficiencies under high operating temperatures. The concept of multi-stage electrochemical oxidation using SOFCs has been proposed and studied over the past several decades for further improving the electrical efficiency. However, the improvement is limited by fuel dilution downstream of the fuel flow. Therefore, evolved technologies are required to achieve considerably higher electrical efficiencies. Here we present an innovative concept for a critically-high fuel-to-electricity conversion efficiency of up to 85% based on the lower heating value (LHV), in which a high-temperature multi-stage electrochemical oxidation is combined with a proton-conducting solid electrolyte. Switching a solid electrolyte material from a conventional oxide-ion conducting material to a proton-conducting material under the high-temperature multi-stage electrochemical oxidation mechanism has proven to be highly advantageous for the electrical efficiency. The DC efficiency of 85% (LHV) corresponds to a net AC efficiency of approximately 76% (LHV), where the net AC efficiency refers to the transmission-end AC efficiency. This evolved concept will yield a considerably higher efficiency with a much smaller generation capacity than the state-of-the-art several tens-of-MW-class most advanced combined cycle (MACC).
Low-temperature heat capacity of small Nb3Sn polycrystals by ac calorimetry
International Nuclear Information System (INIS)
Viswanathan, R.; Johnston, D.C.
1976-01-01
It is shown by an ac calorimetry technique that the multiple heat capacity anomalies which occur below the superconducting transition temperature for small polycrystalline Nb 3 Sn samples are intrinsic to these samples. The recent suggestions that shear stresses can account for these results are analyzed for their validity. The dependence of the occurrence of these multiple anomalies upon the thermal history of the samples was investigated
Jessica E. Halofsky; Stephanie K. Hart; Miles A. Hemstrom; Joshua S. Halofsky; Morris C. Johnson
2014-01-01
Information on the effects of management activities such as fuel reduction treatments and of processes such as vegetation growth and disturbance on fire hazard can help land managers prioritize treatments across a landscape to best meet management goals. State-and-transition models (STMs) allow landscape-scale simulations that incorporate effects of succession,...
Transition to a post-carbon society: Linking environmental justice and just transition discourses
International Nuclear Information System (INIS)
Evans, Geoff; Phelan, Liam
2016-01-01
The Hunter Valley, in New South Wales, Australia, is a globally significant coal mining and exporting region. The Hunter economy's strong basis in fossil fuel production and consumption is challenged by civil society campaigns employing environmental justice discourses. This paper analyses how two civil society campaigns in the Hunter region (‘Stop T4′ and 'Groundswell’) have countered the regional hegemony of fossil fuel interests from an environmental justice perspective. However, the discursive dominance of the 'jobs versus environment’ frame hinders efforts to build solidarity amongst local environmental justice goals on the one hand, and workers and union aspirations for secure, quality jobs on the other. Long-term structural decline of global coal markets adds pressure for economic transition. We argue that campaigns to open up possibilities for transition away from fossil fuel dependency to a post-carbon society can be strengthened by engaging with the 'just transition’ discourses that are typically associated with organised labour. Doing so can create synergy for social change by aligning community and labour movement interests. Inclusive social movement partnerships around this synergy must address structural disadvantage that creates social and economic insecurity if communities are to prevail over the fossil fuel sector's hegemony. - Highlights: • Jobs versus environment. • Environmental justice. • Just transition. • Counter-hegemonic forces.
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Examining the Link Between Public Transit Use and Active Commuting
Directory of Open Access Journals (Sweden)
Melissa Bopp
2015-04-01
Full Text Available Background: An established relationship exists between public transportation (PT use and physical activity. However, there is limited literature that examines the link between PT use and active commuting (AC behavior. This study examines this link to determine if PT users commute more by active modes. Methods: A volunteer, convenience sample of adults (n = 748 completed an online survey about AC/PT patterns, demographic, psychosocial, community and environmental factors. t-test compared differences between PT riders and non-PT riders. Binary logistic regression analyses examined the effect of multiple factors on AC and a full logistic regression model was conducted to examine AC. Results: Non-PT riders (n = 596 reported less AC than PT riders. There were several significant relationships with AC for demographic, interpersonal, worksite, community and environmental factors when considering PT use. The logistic multivariate analysis for included age, number of children and perceived distance to work as negative predictors and PT use, feelings of bad weather and lack of on-street bike lanes as a barrier to AC, perceived behavioral control and spouse AC were positive predictors. Conclusions: This study revealed the complex relationship between AC and PT use. Further research should investigate how AC and public transit use are related.
International Nuclear Information System (INIS)
Petti, David; Herring, J. Stephen
2010-01-01
As described in the Department of Energy Office of Nuclear Energy's Nuclear Energy R and D Roadmap, nuclear energy can play a significant role in supplying energy for a growing economy while reducing both our dependence on foreign energy supplies and emissions from the burning of fossil fuels. The industrial and transportation sectors are responsible for more than half of the greenhouse gas emissions in the U.S., and imported oil supplies 70% of the energy used in the transportation sector. It is therefore important to examine the various ways nuclear energy can facilitate a transition away from fossil fuels to secure environmentally sustainable production and use of energy in the transportation and manufacturing industry sectors. Imperative 3 of the Nuclear Energy R and D Roadmap, entitled 'Enable a Transition Away from Fossil Fuels by Producing Process Heat for use in the Transportation and Industrial Sectors', addresses this need. This document presents an Implementation Plan for R and D efforts related to this imperative. The expanded use of nuclear energy beyond the electrical grid will contribute significantly to overcoming the three inter-linked energy challenges facing U.S. industry: the rising and volatile prices for premium fossil fuels such as oil and natural gas, dependence on foreign sources for these fuels, and the risks of climate change resulting from carbon emissions. Nuclear energy could be used in the industrial and transportation sectors to: (1) Generate high temperature process heat and electricity to serve industrial needs including the production of chemical feedstocks for use in manufacturing premium fuels and fertilizer products, (2) Produce hydrogen for industrial processes and transportation fuels, and (3) Provide clean water for human consumption by desalination and promote wastewater treatment using low-grade nuclear heat as a useful additional benefit. Opening new avenues for nuclear energy will significantly enhance our nation
Television viewing, leisure-time exercise and acute coronary syndrome in transitional Albania.
Burazeri, Genc; Goda, Artan; Kark, Jeremy D
2008-07-01
To assess the association of leisure-time exercise and television (TV) viewing, a sedentary marker, with acute coronary syndrome (ACS) in Albania, a transitional country in Southeast Europe. A population-based case-control study was conducted among Tirana residents in 2003-2006. Information on leisure-time exercise (transformed into kilocalories of energy expenditure) and daily hours of TV viewing was obtained by interviewer-administered questionnaire. 460 non-fatal ACS patients (368 men, 92 women) and 628 coronary heart disease-free controls (413 men, 215 women) were studied. Adjusted for socio-demographic characteristics, conventional coronary risk factors and leisure-time exercise, TV viewing was associated with ACS in women (OR=1.66, 95%CI=1.12-2.46 per hour/day viewing), but not in men (OR=0.93, 95%CI=0.81-1.07; P for sex-interaction=0.02). A low level of leisure-time exercise (adjusted also for TV viewing) was associated with ACS similarly in men and women (pooled sexes OR=2.03, 95%CI=1.29-3.22 for bottom vs top tertile of energy expenditure). Leisure-time inactivity is confirmed as an important risk factor for ACS also in Southeastern Europe. TV viewing may be an informative coronary risk marker in transitional societies, especially in women.
Evaluation Of Oxide And Silicide Mixed Fuels Of The RSG-GAS Core
International Nuclear Information System (INIS)
Tukiran; Sembiring, Tagor Malem; Suparlina, Lily
2000-01-01
Fuel exchange of the RSG-GAS reactor core from uranium oxide to uranium silicide in the same loading, density, and enrichment, that is 250 gr, 2.98 gr/cm 3 , and 19.75%, respectively, will be performed in-step wise. In every cycle of exchange with 5/1 mode, it is needed to evaluate the parameter of reactor core operation. The parameters of the reactor operation observed are criticality mass of fuels, reactivity balance, and fuel reactivity that give effect to the reactor operation. The evaluation was done at beginning of cycle of the first and second transition core with compared between experiment and calculation results. The experiments were performed at transition core I and II, BOC, and low power. At transition core I, there are 2 silicide fuels (RI-224 and R1-225) in the core and then, added five silicide fuels (R1-226, R1-252, R1-263, and R1-264) to the core, so that there are seven silicide fuels in the transition core II. The evaluation was done based on the experiment of criticality, control rod calibration, fuel reactivity of the RSG-GAS transition core. For inserting 2 silicide fuels in the transition core I dan 7 fuels in the transition core II, the operation of RSG-GAS core fulfilled the safety margin and the parameter of reactor operation change is not occur drastically in experiment and calculation results. So that, the reactor was operated during 36 days at 15 MW, 540 MWD at the first transition core. The general result showed that the parameter of reactor operation change is small so that the fuel exchange from uranium oxide to uranium silicide in the next step can be done
National fuel cell bus program : proterra fuel cell hybrid bus report, Columbia demonstration.
2011-10-01
This report summarizes the experience and early results from a fuel cell bus demonstration funded by the Federal Transit Administration (FTA) under the National Fuel Cell Bus Program. A team led by the Center for Transportation and the Environment an...
Magnetic images of the disintegration process of tablets in the human stomach by ac biosusceptometry
International Nuclear Information System (INIS)
Cora, L A; Andreis, U; Romeiro, F G; Americo, M F; Oliveira, R B; Baffa, O; Miranda, J R A
2005-01-01
Oral administration of solid dosage forms is usually preferred in drug therapy. Conventional imaging methods are essential tools to investigate the in vivo performance of these formulations. The non-invasive technique of ac biosusceptometry has been introduced as an alternative in studies focusing on gastrointestinal motility and, more recently, to evaluate the behaviour of magnetic tablets in vivo. The aim of this work was to employ a multisensor ac biosusceptometer system to obtain magnetic images of disintegration of tablets in vitro and in the human stomach. The results showed that the transition between the magnetic marker and the magnetic tracer characterized the onset of disintegration (t 50 ) and occurred in a short time interval (1.1 ± 0.4 min). The multisensor ac biosusceptometer was reliable to monitor and analyse the in vivo performance of magnetic tablets showing accuracy to quantify disintegration through the magnetic images and to characterize the profile of this process
Magnetic images of the disintegration process of tablets in the human stomach by ac biosusceptometry
Energy Technology Data Exchange (ETDEWEB)
Cora, L A [Departamento de Fisica e BioFisica, IBB, UNESP, Botucatu, SP (Brazil); Andreis, U [Departamento de Fisica e BioFisica, IBB, UNESP, Botucatu, SP (Brazil); Romeiro, F G [Departamento de ClInica Medica, FMB, UNESP, Botucatu, SP (Brazil); Americo, M F [Departamento de ClInica Medica, FMRP, USP, Ribeirao Preto, SP (Brazil); Oliveira, R B [Departamento de ClInica Medica, FMRP, USP, Ribeirao Preto, SP (Brazil); Baffa, O [Departamento de Fisica e Matematica, FFCLRP, USP, Ribeirao Preto, SP (Brazil); Miranda, J R A [Departamento de Fisica e BioFisica, IBB, UNESP, Botucatu, SP (Brazil)
2005-12-07
Oral administration of solid dosage forms is usually preferred in drug therapy. Conventional imaging methods are essential tools to investigate the in vivo performance of these formulations. The non-invasive technique of ac biosusceptometry has been introduced as an alternative in studies focusing on gastrointestinal motility and, more recently, to evaluate the behaviour of magnetic tablets in vivo. The aim of this work was to employ a multisensor ac biosusceptometer system to obtain magnetic images of disintegration of tablets in vitro and in the human stomach. The results showed that the transition between the magnetic marker and the magnetic tracer characterized the onset of disintegration (t{sub 50}) and occurred in a short time interval (1.1 {+-} 0.4 min). The multisensor ac biosusceptometer was reliable to monitor and analyse the in vivo performance of magnetic tablets showing accuracy to quantify disintegration through the magnetic images and to characterize the profile of this process.
Magnetic images of the disintegration process of tablets in the human stomach by ac biosusceptometry
Corá, L. A.; Andreis, U.; Romeiro, F. G.; Américo, M. F.; Oliveira, R. B.; Baffa, O.; Miranda, J. R. A.
2005-12-01
Oral administration of solid dosage forms is usually preferred in drug therapy. Conventional imaging methods are essential tools to investigate the in vivo performance of these formulations. The non-invasive technique of ac biosusceptometry has been introduced as an alternative in studies focusing on gastrointestinal motility and, more recently, to evaluate the behaviour of magnetic tablets in vivo. The aim of this work was to employ a multisensor ac biosusceptometer system to obtain magnetic images of disintegration of tablets in vitro and in the human stomach. The results showed that the transition between the magnetic marker and the magnetic tracer characterized the onset of disintegration (t50) and occurred in a short time interval (1.1 ± 0.4 min). The multisensor ac biosusceptometer was reliable to monitor and analyse the in vivo performance of magnetic tablets showing accuracy to quantify disintegration through the magnetic images and to characterize the profile of this process.
Vertical load analysis of cylindrical ACS support structures
International Nuclear Information System (INIS)
Kennedy, J.M.; Belytschko, T.B.
1984-01-01
A new concept in LMFBR design ACS (above-core structures) supports which has generated some interest is to use a single large radius cylinder. The advantages of a single cylinder are reduced cost of fabrication, increased lateral stiffness, which enhances seismic resistance, and easier access to the fuel. However, the performance of these support structures when submitted to vertical loads from the core area may be substantially different, for the buckling and postbuckling behavior of a cylinder differs substantially from that of cylindrical beams. In this paper, a comparative analysis of an old prototypical support by 4 columns is compared with a cylindrical support. It is assumed that the single cylinder replaces the 4 columns in the original design. The dimensions of the two designs are compared
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Energy Technology Data Exchange (ETDEWEB)
Rugh, J.; Chaney, L.; Venson, T.; Ramroth, L.; Rose, M.
2013-04-01
The objective of the study was to assess the impact of Saflex1 S-series Solar Control PVB (polyvinyl butyral) configurations on conventional vehicle fuel economy and electric vehicle (EV) range. The approach included outdoor vehicle thermal soak testing, RadTherm cool-down analysis, and vehicle simulations. Thermal soak tests were conducted at the National Renewable Energy Laboratory's Vehicle Testing and Integration Facility in Golden, Colorado. The test results quantified interior temperature reductions and were used to generate initial conditions for the RadTherm cool-down analysis. The RadTherm model determined the potential reduction in air-conditioning (A/C) capacity, which was used to calculate the A/C load for the vehicle simulations. The vehicle simulation tool identified the potential reduction in fuel consumption or improvement in EV range between a baseline and modified configurations for the city and highway drive cycles. The thermal analysis determined a potential 4.0% reduction in A/C power for the Saflex Solar PVB solar control configuration. The reduction in A/C power improved the vehicle range of EVs and fuel economy of conventional vehicles and plug-in hybrid electric vehicles.
International Nuclear Information System (INIS)
Paret, L.; Touron, E.
2016-01-01
The future fuel cycle plants will have to cope with both the fuel for PWR and the fuel for the new generation of fast reactors. Furthermore, the MOX fuel, that is not recycled in PWR reactors will have the possibility to be recycled in fast reactors of 4. generation. Recycling MOX fuels will imply to handle nuclear fuels with higher concentration of Pu than today. The design of the nuclear fuel for the future fast reactors will be similar to that of the Astrid prototype. In order to simplify the fabrication of UPuO_2 pellets, all the fabrication process will take place in a dedicated glove box. Enhanced reality and virtual reality technologies have been used to optimize the glove-box design in order to have a better recovery of radioactive dust and to ease routine operations and its future dismantling. As a fuel assembly will contain 120 kg of UPuO_2 fuel, it will no longer be possible to mount these assemblies by hand contrary to what was done for Superphenix reactor. A new shielded mounting line has to be designed. Another point is that additive manufacturing for the fabrication of very small parts with a complex design will be broadly used. (A.C.)
International Nuclear Information System (INIS)
Yamashita, Junichi; Fukasawa, Tetsuo; Hoshino, Kuniyoshi; Kawamura, Fumio; Shiina, Kouji; Sasahira, Akira
2005-01-01
A sustainable electricity supply by fast breeder reactors (FBRs) is essential to ensure energy security and prevent global warming. Transition from light water reactors (LWRs) to FBRs and establishment of an FBR cycle are indispensable, which requires plutonium (Pu) for the introduction of FBRs. The authors propose advanced system called 'Flexible Fuel Cycle Initiative (FFCI)' which can respond flexibly the future expected technical and social uncertainties, can hold no surplus Pu, and can achieve an economical FBR cycle. In the new concept of FFCI, 2nd LWR reprocessing which would succeed Rokkasho Reprocessing Plant is a simple facility to carry out only uranium (U) removal and residual 'recycle material' is stored or utilized. According to FBRs introduction status, recycle material is immediately treated in an FBR reprocessing to fabricate FBR fuel or temporarily stored for the utilization in FBRs at necessary timing. FFCI has high flexibility by having several options for future uncertainties by the introduction of recycle material as a buffer material between LWR and FBR cycles. (author)
Directory of Open Access Journals (Sweden)
Ali Reza Ashrafi
2016-09-01
Full Text Available Darafsheh and Assari in [Normal edge-transitive Cayley graphs onnon-abelian groups of order 4p, where p is a prime number,Sci. China Math. {bf 56} (1 (2013 213$-$219.] classified the connected normal edge transitive and$frac{1}{2}-$arc-transitive Cayley graph of groups of order$4p$. In this paper we continue this work by classifying theconnected Cayley graph of groups of order $2pq$, $p > q$ areprimes. As a consequence it is proved that $Cay(G,S$ is a$frac{1}{2}-$edge-transitive Cayley graph of order $2pq$, $p> q$ if and only if $|S|$ is an even integer greater than 2, $S =T cup T^{-1}$ and $T subseteq { cba^{i} | 0 leq i leq p- 1}$ such that $T$ and $T^{-1}$ are orbits of $Aut(G,S$ andbegin{eqnarray*}G &=& langle a, b, c | a^p = b^q = c^2 = e, ac = ca, bc = cb, b^{-1}ab = a^r rangle,G &=& langle a, b, c | a^p = b^q = c^2 = e, c ac = a^{-1}, bc = cb, b^{-1}ab = a^r rangle,end{eqnarray*}where $r^q equiv 1 (mod p$.
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
International Nuclear Information System (INIS)
Ishida, Naoyuki; Utsuno, Hideaki; Kasahara, Fumio
2003-01-01
The Boiling Transition (BT) analysis code TCAPE-INS/B based on the mechanistic methods coupled with subchannel analysis has been developed for the evaluation of the integrity of Boiling Water Reactor (BWR) fuel rod bundles under abnormal operations. Objective of the development is the evaluation of the BT without using empirical BT and rewetting correlations needed for different bundle designs in the current analysis methods. TCAPE-INS/B consisted mainly of the drift-flux model, the film flow model, the cross-flow model, the thermal conductivity model and the heat transfer correlations. These models were validated systematically with the experimental data. The accuracy of the prediction for the steady-state Critical Heat Flux (CHF) and the transient temperature of the fuel rod surface after the occurrence of BT were evaluated on the validations. The calculations for the experiments with the single tube and bundles were carried out for the validations of the models incorporated in the code. The results showed that the steady-state CHF was predicted within about 6% average error. In the transient calculations, BT timing and temperature of the fuel rod surface gradient agreed well with experimental results, but rewetting was predicted lately. So, modeling of heat transfer phenomena during post-BT is under modification. (author)
Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing
International Nuclear Information System (INIS)
Gottardi, L.; Kuur, J. van der; Korte, P. A. J. de; Den Hartog, R.; Dirks, B.; Popescu, M.; Hoevers, H. F. C.; Bruijn, M.; Borderias, M. Parra; Takei, Y.
2009-01-01
We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDM configuration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10 MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370 kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/R N <0.5). The measured energy resolution at 5.89 keV is 2.7 eV for DC bias and 3.7 eV for AC bias, while the baseline resolution is 2.8 eV and 3.3 eV, respectively.
International Nuclear Information System (INIS)
Huang Xueqing; Zhang Senru
1999-01-01
Based on Qinshan II Nuclear Power Plant that is designed and constructed by way of self-reliance, China has developed advanced passive PWR AC-600. The design concept of AC-600 not only takes the real situation of China into consideration, but also follows the developing trend of nuclear power in the world. The design of AC-600 has the following technical characteristics: Advanced reactor: 18-24 month fuel cycle, low neutron leakage, low power density of the core, no any penetration in the RPV below the level of the reactor coolant nozzles; Passive safety systems: passive emergency residual heat removal system, passive-active safety injection system, passive containment cooling system and main control room habitability system; System simplified and the number of components reduced; Digital I and C; Modular construction. AC-600 inherits the proven technology China has mastered and used in Qirtshan 11, and absorbs advanced international design concepts, but it also has a distinctive characteristic of bringing forth new ideas independently. It is suited to Chinese conditions and therefore is expected to become an orientation of nuclear power development by self-reliance in China for the next century. (author)
2014-06-19
product used as a diesel product for ground use (1). Free water contamination (droplets) may appear as fine droplets or slugs of water in the fuel...methods and test procedures for the calibration and use of automatic particle counters. The transition of this technology to the fuel industry is...UNCLASSIFIED 6 UNCLASSIFIED Receipt Vehicle Fuel Tank Fuel Injector Aviation Fuel DEF (AUST) 5695B 18/16/13 Parker 18
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Kim, Minkuk
2012-03-01
The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally by applying AC electric fields at low frequency below 60. Hz together with DC in the single electrode configuration. The blowoff velocity has been measured for varying AC voltage and frequency. A transition frequency between low and high frequency regimes has been identified near 40-50. Hz, where AC electric fields have minimal effect on flame stabilization. In the low frequency regime, the blowoff velocity decreased linearly with AC voltage such that the flames became less stable. This was consistent with the DC result, implying the influence of the ionic wind effect. The variation of blowoff velocity with AC frequency showed a non-monotonic behavior in that the velocity decreased and then increased, exhibiting minimum blowoff velocity near 6-8. Hz. Based on the molecular kinetic theory, the developing degree of ionic wind was derived. By considering the ionic wind effects arising from both positive and negative ions in a flame zone, the bi-ionic wind effect successfully explained the non-monotonic behavior of blowoff velocity with AC frequency in the low frequency regime. © 2011 The Combustion Institute.
Effect of aerosil dispersions on the photoinduced nematic-isotropic transition
Energy Technology Data Exchange (ETDEWEB)
Jayalakshmi, V; Nair, Geetha G; Prasad, S Krishna [Centre for Liquid Crystal Research, Jalahalli, Bangalore 560013 (India)
2007-06-06
We report differential scanning calorimetric (DSC) and dielectric measurements on the nematic-isotropic transition in the bulk and aerosil composites of a liquid-crystal mixture having a photoactive guest azobenzene compound in a non-photoactive host, 4-n-heptyl cyanobiphenyl (7CB). The DSC scans taken at different cooling rates show that, at slower rates, the bulk displays a single peak across the transition, whereas the composites in the soft gel regime exhibit a double-peak profile. Such a double-peak profile, although seen in high-resolution ac calorimetric studies, has been observed for the first time in DSC experiments. The temperature range of the region between the two peaks is comparable to that seen in ac calorimetric experiments and has similar features. This observation is significant since the appearance of the low-temperature peak in ac calorimetric data has been explained to be due to a crossover from the random-dilution to the random-field limits. This work also constitutes the first experiments on the photoisomerization driven isothermal phase transitions in liquid-crystal-aerosil composites. The studies carried out in the absence and presence of a low-magnitude UV radiation not only bring out the standard features now established for such photostimulated phase transitions, but display a few surprises. Notable among them are that (i) the photoinduced shift in the transition temperature is a non-monotonic function of the aerosil composition and appears qualitatively similar to the dependence of the transition temperature itself, and (ii) the thermal anomaly mentioned above characterizing the crossover is also seen in the temperature-dependent as well as the temporal variation of the sample capacitance for a composite in the soft gel regime. We have also evaluated, using the temporal variation of the capacitance, the different response times associated with the UV-on photochemical process as well as the UV-off thermal back-relaxation process; the
AC and DC electrical properties of graphene nanoplatelets reinforced epoxy syntactic foam
Zegeye, Ephraim; Wicker, Scott; Woldesenbet, Eyassu
2018-04-01
Benefits of employing graphene nanopletlates (GNPLs) in composite structures include mechanical as well as multifunctional properties. Understanding the impedance behavior of GNPLs reinforced syntactic foams may open new applications for syntactic foam composites. In this work, GNPLs reinforced syntactic foams were fabricated and tested for DC and AC electrical properties. Four sets of syntactic foam samples containing 0, 0.1, 0.3, and 0.5 vol% of GNPLs were fabricated and tested. Significant increase in conductivity of syntactic foams due to the addition of GNPLs was noted. AC impedance measurements indicated that the GNPLs syntactic foams become frequency dependent as the volume fraction of GNPLs increases. With addition of GNPLs, the characteristic of the syntactic foams are also observed to transition from dominant capacitive to dominant resistive behavior. This work was carried out at Southern University, Mechanical Engineering Department, Baton Rouge, LA 70802, United States of America.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
Dynamic Simulations of Advanced Fuel Cycles
International Nuclear Information System (INIS)
Piet, Steven J.; Dixon, Brent W.; Jacobson, Jacob J.; Matthern, Gretchen E.; Shropshire, David E.
2011-01-01
Years of performing dynamic simulations of advanced nuclear fuel cycle options provide insights into how they could work and how one might transition from the current once-through fuel cycle. This paper summarizes those insights from the context of the 2005 objectives and goals of the U.S. Advanced Fuel Cycle Initiative (AFCI). Our intent is not to compare options, assess options versus those objectives and goals, nor recommend changes to those objectives and goals. Rather, we organize what we have learned from dynamic simulations in the context of the AFCI objectives for waste management, proliferation resistance, uranium utilization, and economics. Thus, we do not merely describe 'lessons learned' from dynamic simulations but attempt to answer the 'so what' question by using this context. The analyses have been performed using the Verifiable Fuel Cycle Simulation of Nuclear Fuel Cycle Dynamics (VISION). We observe that the 2005 objectives and goals do not address many of the inherently dynamic discriminators among advanced fuel cycle options and transitions thereof.
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Coordinated control of three-phase AC and DC type EV–ESSs for efficient hybrid microgrid operations
International Nuclear Information System (INIS)
Rahman, Md Shamiur; Hossain, M.J.; Lu, Junwei
2016-01-01
Highlights: • A coordinated control is proposed for three-phase AC and DC type electric vehicles. • A four-quadrant interlinking converter is designed for hybrid microgrid operations. • Concurrent real irradiation data and commercial load profile are used for testing. • Unbalanced scenario due to single-phase electric vehicle charging is considered. • Improved AC and DC bus voltages and frequency regulations are achieved. - Abstract: This paper presents a three-layered coordinated control to incorporate three-phase (3P) alternating current (AC) and direct current (DC) type electric vehicle energy storage systems (EV–ESSs) for improved hybrid AC/DC microgrid operations. The first layer of the algorithm ensures DC subgrid management by regulating the DC bus voltage and DC side power management. The second and third layer manages AC subgrid by regulating the AC bus voltage and the frequency by managing reactive and active power respectively. The multi-layered coordination is embedded into the microgrid central controller (MGCC) which controls the interlinking controller in between AC and DC microgrid and the interfacing controllers of the participating electric vehicles (EVs) and distributed generation (DG) units. The whole system is designed in MATLAB/SIMULINK® environment resembling the under construction microgrid at Griffith University, Australia. Extensive case studies are performed using real life irradiation data and commercial loads of the campus buildings. Impacts of homogeneous and heterogeneous single-phase EV charging are investigated to observe both balanced and unbalanced scenarios. Synchronization during the transition from the islanded to grid-tied mode is tested considering a contingency situation. From the comparative simulation results it is evident that the proposed controller exhibits effective, reliable and robust performance for all the cases.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Effect of the space charge layer on pre-transition corrosion rate of Zr alloys
International Nuclear Information System (INIS)
Nanikawa, S.; Etoh, Y.
1998-01-01
The pre- and post-transition oxide films formed in steam at 673 K were investigated by an AC impedance method. The results showed that the space charge layer was present in the pre-transition oxide film and it was absent in the post-transition oxide film. The oxidation kinetics was simulated by oxygen diffusion in the space charge layer. Cubic or one-fourth power law was explained by the effect of the space charge layer. Supposing that the space charge layer formed the potential difference through the oxide film by 0.7 V, calculated oxidation kinetics agreed with the experimental one before transition. This potential difference corresponded to the measured value by AC impedance method within the experimental error. Shadow effect could be explained by this simulation supposing the disappearance of the space charge layer due to the formation of a negative electric field by β-rays. (author)
International Nuclear Information System (INIS)
Prince, B.E.; Hadley, S.W.
1983-01-01
This is the second of a two-part report intended as a critical review of certain issues involved with closing the Light Water Reactor (LWR) fuel cycle and establishing the basis for future transition to commercial breeder applications. The report is divided into four main sections consisting of (1) a review of the status of the LWR spent fuel management and storage problem; (2) an analysis of the economic incentives for instituting reprocessing and recycle in LWRs; (3) an analysis of the time-dependent aspects of plutonium economic value particularly as related to the LWR-breeder transition; and (4) an analysis of the time-dependent aspects of plutonium requirements and supply relative to this transition
The nuclear fuel cycle back-end: purposes and outlook
International Nuclear Information System (INIS)
Boullis, B.
2010-01-01
The recycling of spent fuels appears as the only way to get a sustainable nuclear energy. Uranium and plutonium recycling technologies are already implemented in France but they require to be upgraded in order to follow the technical evolutions of reactors. The research topics concerning recycling are: -) the adaptation of recycling technologies to higher burn-ups and to the use of Mox fuels, -) to improve the recycling technologies in terms of waste production, -) to prepare the multi-recycling of spent fuels from fast reactors, and -) to go ahead in the recycling policy by separating minor actinides in order to transmute them. (A.C.)
Disease burden due to biomass cooking-fuel-related household air pollution among women in India.
Sehgal, Meena; Rizwan, Suliankatchi Abdulkader; Krishnan, Anand
2014-01-01
Household air pollution (HAP) due to biomass cooking fuel use is an important risk factor for a range of diseases, especially among adult women who are primary cooks, in India. About 80% of rural households in India use biomass fuel for cooking. The aim of this study is to estimate the attributable cases (AC) for four major diseases/conditions associated with biomass cooking fuel use among adult Indian women. We used the population attributable fraction (PAF) method to calculate the AC of chronic bronchitis, tuberculosis (TB), cataract, and stillbirths due to exposure to biomass cooking fuel. A number of data sources were accessed to obtain population totals and disease prevalence rates. A meta-analysis was conducted to obtain adjusted pooled odds ratios (ORs) for strength of association. Using this, PAF and AC were calculated using a standard formula. Results were presented as number of AC and 95% confidence intervals (CI). The fixed effects pooled OR obtained from the meta-analysis were 2.37 (95% CI: 1.59, 3.54) for chronic bronchitis, 2.33 (1.65, 3.28) for TB, 2.16 (1.42, 3.26) for cataract, and 1.26 (1.12, 1.43) for stillbirths. PAF varied across conditions being maximum (53%) for chronic bronchitis in rural areas and least (1%) for cataract in older age and urban areas. About 2.4 (95% CI: 1.4, 3.1) of 5.6 m cases of chronic bronchitis, 0.3 (0.2, 0.4) of 0.76 m cases of TB, 5.0 (2.8, 6.7) of 51.4 m cases of cataract among adult Indian women and 0.02 (0.01, 0.03) of 0.15 m stillbirths across India are attributable to HAP due to biomass cooking fuel. These estimates should be cautiously interpreted in the light of limitations discussed which relate to exposure assessment, exposure characterization, and age-specific prevalence of disease. HAP due to biomass fuel has diverse and major impacts on women's health in India. Although challenging, incorporating the agenda of universal clean fuel access or cleaner technology within the broader framework of rural
Development of a 200kW multi-fuel type PAFC power plant
Energy Technology Data Exchange (ETDEWEB)
Take, Tetsuo; Kuwata, Yutaka; Adachi, Masahito; Ogata, Tsutomu [NTT Integrated Information & Energy System Labs., Tokyo (Japan)
1996-12-31
Nippon Telegraph and Telephone Corporation (NFT) has been developing a 200 kW multi-fuel type PAFC power plant which can generate AC 200 kW of constant power by switching fuel from pipeline town gas to liquefied propane gas (LPG) and vice versa. This paper describes the outline of the demonstration test plant and test results of its fundamental characteristics.
ac Conductivity of mixed spinel NiAl0.7Cr0.7Fe0.6O4
Indian Academy of Sciences (India)
Abstract. ac Conductivity measurements are carried out across the metal to insulator transition in NiAl0.7Cr0.7Fe0.6O4. The low frequency data is analyzed using Summerfield scaling theory for hopping conductivity. The exponent of the scaling behavior has significantly different values in the conducting and insulating ...
2012-02-10
... 0651-AC75 Transitional Program for Covered Business Method Patents-- Definition of Technological... definition of technological invention that the Board will use in conducting transitional covered business... definition for covered business method patent in proposed Sec. 42.301(a). Additionally, the Office in a...
2016-01-01
An overreliance on foreign oil and the negative impacts of using petroleum fuels on the worlds climate have prompted energy policies that support the diversification of transport fuels and aggressive work to transition to non-petroleum options. Th...
AC measurements on uranium doped high temperature superconductors
International Nuclear Information System (INIS)
Eisterer, M.
1999-11-01
The subject of this thesis is the influence of fission tracks on the superconducting properties of melt textured Y-123. The critical current densities, the irreversibility lines and the transition temperature were determined by means of ac measurements. The corresponding ac techniques are explored in detail. Deviations of the ac signal from the expectations according to the Bean model were explained by the dependence of the shielding currents on the electric field. This explanation is supported by the influence of the ac amplitude and frequency on the critical current density but also by a comparison of the obtained data with other experimental techniques. Y-123 has to be doped with uranium in order to induce fission tracks. Uranium forms normal conducting clusters, which are nearly spherical, with a diameter of about 300 nm. Fission of uranium-235 by thermal neutrons creates two high energy ions with a total energy of about 160 MeV. Each of these fission products induces a linear defect with a diameter of about 10 nm. The length of one fission track is 2-4 μm. At 77 K the critical current density is enhanced by the pinning action of the uranium clusters, compared to undoped samples. With decreasing temperature this influence becomes negligible. The critical current densities are strongly enhanced due to the irradiation. At low magnetic fields we find extremely high values for melt textured materials, e.g. 2.5x10 9 Am -2 at 77 K and 0.25 T or 6x10 10 Am -2 at 5 K. Since the critical current was found to be inverse proportional to the square root of the applied magnetic field it decreases rapidly as the field increases. This behavior is predicted by simple theoretical considerations, but is only valid at low temperatures as well as in low magnetic fields at high temperatures. At high fields the critical current drops more rapidly. The irreversibility lines are only slightly changed by this irradiation technique. Only a small shift to higher fields and temperatures
Kado, Norman Y; Okamoto, Robert A; Kuzmicky, Paul A; Kobayashi, Reiko; Ayala, Alberto; Gebel, Michael E; Rieger, Paul L; Maddox, Christine; Zafonte, Leo
2005-10-01
The number of heavy-duty vehicles using alternative fuels such as compressed natural gas (CNG) and new low-sulfur diesel fuel formulations and equipped with after-treatment devices are projected to increase. However, few peer-reviewed studies have characterized the emissions of particulate matter (PM) and other toxic compounds from these vehicles. In this study, chemical and biological analyses were used to characterize the identifiable toxic air pollutants emitted from both CNG and low-sulfur-diesel-fueled heavy-duty transit buses tested on a chassis dynamometer over three transient driving cycles and a steady-state cruise condition. The CNG bus had no after-treatment, and the diesel bus was tested first equipped with an oxidation catalyst (OC) and then with a catalyzed diesel particulate filter (DPF). Emissions were analyzed for PM, volatile organic compounds (VOCs; determined on-site), polycyclic aromatic hydrocarbons (PAHs), and mutagenic activity. The 2000 model year CNG-fueled vehicle had the highest emissions of 1,3-butadiene, benzene, and carbonyls (e.g., formaldehyde) of the three vehicle configurations tested in this study. The 1998 model year diesel bus equipped with an OC and fueled with low-sulfur diesel had the highest emission rates of PM and PAHs. The highest specific mutagenic activities (revertants/microg PM, or potency) and the highest mutagen emission rates (revertants/mi) were from the CNG bus in strain TA98 tested over the New York Bus (NYB) driving cycle. The 1998 model year diesel bus with DPF had the lowest VOCs, PAH, and mutagenic activity emission. In general, the NYB driving cycle had the highest emission rates (g/mi), and the Urban Dynamometer Driving Schedule (UDDS) had the lowest emission rates for all toxics tested over the three transient test cycles investigated. Also, transient emissions were, in general, higher than steady-state emissions. The emissions of toxic compounds from an in-use CNG transit bus (without an oxidation
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Elements of nuclear reactor fueling theory
International Nuclear Information System (INIS)
Egan, M.R.
1984-01-01
Starting with a review of the simple batch size effect, a more general theory of nuclear fueling is derived to describe the behaviour and physical requirements of operating cycle sequences and fueling strategies having practical use in fuel management. The generalized theory, based on linear reactivity modeling, is analytical and represents the effects of multiple-stream, multiple-depletion-batch fueling configurations in systems employing arbitrary, non-integer batch size strategies, and containing fuel with variable energy generation rates. Reactor operating cycles and cycle sequences are represented with realistic structure that includes the effects of variable cycle energy production, cycle lengths, end-of-cycle operating extensions and manoeuvering allowances. Results of the analytical theory are first applied to the special case of degenerate equilibrium cycle sequences, yielding several fundamental principles related to the selection of refueling strategy. Numerical evaluations of degenerate equilibrium cycle sequences are then performed for a typical PWR core, and accompanying fuel cycle costs are calculated. The impact of design and operational limits as constraints on the performance mappings for this reactor are also studied with respect to achieving improved cost performance from the once-through fuel cycle. The dynamics of transition cycle sequences are then examined using the generalized theory. Proof of the existence of non-degenerate equilibrium cycle sequences is presented when the mechanics of the fixed reload batch size strategy are developed analytically for transition sequences. Finally, an analysis of the fixed reload enrichment strategy demonstrates the potential for convergence of the transition sequence to a fully degenerate equilibrium sequence. (author)
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
International Nuclear Information System (INIS)
Uchikawa, Sadao; Okubo, Tsutomu; Nakano, Yoshihiro
2011-01-01
An advanced LWR with hard neutron spectrum, FLWR, aims at efficient and flexible utilization of nuclear resources by evolving its fuel assembly design keeping the same core configuration. A proposed evolution process of the design toward a sustainable fuel cycle is composed of three stages, the first one based on the LWR fuel cycle infrastructures, the second one for transitioning from the LWR fuel cycle to the FR fuel cycle, and the third one based on the FR fuel cycle infrastructures. For the first stage, a fuel assembly design concept named FLWR/MIX has been developed in which enriched UO 2 fuel rods are arranged in the peripheral region of the assembly, surrounding the MOX fuel rods in the central region. The FLWR/MIX design realizes a breeder type operation under the framework of the LWR-MOX technologies and there experience. A modified FLWR/MIX design with low Pu inventory for the second stage has a potential of high Puf conversion ratio of 1.1 and can contribute to smooth and speedy transition from the LWR fuel cycle to the FR fuel cycle. For the third stage, the FLWR/MIX design is extended into a design with natural UO 2 fuel rods to realize multiple Pu recycling keeping a Puf conversion ratio of around 1.0. (author)
The improvement of performances for PWR fuels
International Nuclear Information System (INIS)
Debes
2001-01-01
UO 2 fuels used in French nuclear power plants are authorized for values of burn-ups up to 52 GWj/t. Constant technological progress concerning pellets, cladding, and the design of the assembly has led to better performance and a broader safety margin. EDF is gathering all the elements to qualify and back its demand to increase the limit burn-up to 65 GWj/t in 2004 and to 70 GWj/t in 2008. For the same amount of energy produced, this policy of higher burn-ups will allow: - a reduction of the number of spent fuel assemblies, - a direct economic spare by using less fuel assemblies, - a reduction of personnel dosimetry because of longer irradiation campaigns, and - less quantity of residual plutonium produced. (A.C.)
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
Wiedenhofer, Dominik; Rovenskaya, Elena; Krausmann, Fridolin; Haas, Willi; Fischer-Kowalski, Marina
2013-04-01
By talking about socio-metabolic transitions, we talk about changes in the energy base of socio-economic systems, leading to fundamental changes in social and environmental relations. This refers to the historical shift from a biomass-based (agrarian) economy to a fossil fuel based (industrial) economy just as much as to a future shift from fossil fuels to renewable energy carriers. In our presentation, • We will first show that this pattern of transition can be identified for most high income industrial countries: the later the transition started, the faster it proceeded, and the turning point to stabilization of metabolic rates in all of them happened in the early 1970ies. Due to the inherent non-linearity of this process, two approaches will be aplied to estimate parameters for the starting point, transition speed and saturation level: firstly a combination of an expontential and a generalized logistic function and secondly a Gompertz function. For both an iterative test procedure is applied to find the global minimum of the residual error for the whole function and all its parameters. This theory-based approach allows us to apply a robust methodology across all cases, thereby yielding results which can be generalized. • Next, we will show that this was not just a "historical" socio-ecological transition, however. Currently, a substantial number of countries comprising more than half of the world's population are following a similar transitional pathway at an ever accelerating pace. Based on empirical data on physical resource use and the above sketched methodology, we can show that these so-called emerging economies are currently in the take-off or acceleration phase of the very same transition. • Apart from these "endogenous" processes of socio-metabolic transition, we will investigate the effect of external shocks and their impact on the dynamics of energy and materials use. The first such shock we will explore is the oil crisis of 1972 that possibly
American fuel cell bus project : first analysis report.
2013-06-01
This report summarizes the experience and early results from the American Fuel Cell Bus Project, a fuel cell electric bus demonstration : funded by the Federal Transit Administration (FTA) under the National Fuel Cell Bus Program. A team led by CALST...
Design of current source DC/DC converter and inverter for 2kW fuel cell application
DEFF Research Database (Denmark)
Andreiciks, A.; Steiks, I.; Krievs, O.
2013-01-01
In order to use hydrogen fuel cell in domestic applications either as main power supply or backup power source, the low DC output voltage of the fuel cell has to be matched to the voltage level and frequency of the utility grid AC voltage. The interfacing power converter systems usually consist...... system is designed for interfacing a 2kW proton exchange membrane (PEM) fuel cell....
The first car fuel of the post-petroleum era
International Nuclear Information System (INIS)
Willot, D.
2006-01-01
French authorities have decided to back the development and the use of ethanol. A program called Flex-fuel-2010 favours the production and a wide use of the E85 fuel for transport in France. It appears that the volume of France's exports in cereals and beet sugar represent, in ethanol equivalent, 70% of our needs in car fuel for private transport. Oil companies and supermarket chains compel themselves to open more than 500 selling spots of E85 fuel throughout France in 2007. In 2007, car manufacturers like Renault and PSA will begin to sell cars running on E85 at a price equivalent to that of current cars. Fiscal incentives are also expected to favour the use of E85. (A.C.)
Alternative Fuel News, Volume 4, Number 3
Energy Technology Data Exchange (ETDEWEB)
Ficker, C.
2000-11-14
This issue of Alternative Fuel News focuses on transit buses and refuse haulers. Many transit agencies and waste management companies are investigating alternatives to traditional diesel buses and refuse haulers.
Practical Observations of the Transit of Venus
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 5. Practical Observations of the Transit of Venus. B S Shyalaja. Classroom Volume 9 Issue 5 May 2004 pp 79-83. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/05/0079-0083 ...
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
International Nuclear Information System (INIS)
1995-07-01
The U.S. Department of Energy (DOE) needs to remove irradiated fuel from the Plutonium-Uranium Extraction (PUREX) Plant and N Reactor at the Hanford Site, Richland, Washington, to stabilize the facilities in preparation for decontamination and decommissioning (D ampersand D) and to reduce the cost of maintaining the facilities prior to D ampersand D. DOE is proposing to transfer approximately 3.9 metric tons (4.3 short tons) of unprocessed irradiated fuel, by rail, from the PUREX Plant in the 200 East Area and the 105 N Reactor (N Reactor) fuel storage basin in the 100 N Area, to the 105-KE and 105-KW fuel storage basins (K Basins) in the 100 K Area. The fuel would be placed in storage at the K Basins, along with fuel presently stored, and would be dispositioned in the same manner as the other existing irradiated fuel inventory stored in the K Basins. The fuel transfer to the K Basins would consolidate storage of fuels irradiated at N Reactor and the Single Pass Reactors. Approximately 2.9 metric tons (3.2 short tons) of single-pass production reactor, aluminum clad (AC) irradiated fuel in four fuel baskets have been placed into four overpack buckets and stored in the PUREX Plant canyon storage basin to await shipment. In addition, about 0.5 metric tons (0.6 short tons) of zircaloy clad (ZC) and a few AC irradiated fuel elements have been recovered from the PUREX dissolver cell floors, placed in wet fuel canisters, and stored on the canyon deck. A small quantity of ZC fuel, in the form of fuel fragments and chips, is suspected to be in the sludge at the bottom of N Reactor's fuel storage basin. As part of the required stabilization activities at N Reactor, this sludge would be removed from the basin and any identifiable pieces of fuel elements would be recovered, placed in open canisters, and stored in lead lined casks in the storage basin to await shipment. A maximum of 0.5 metric tons (0.6 short tons) of fuel pieces is expected to be recovered
International Nuclear Information System (INIS)
Roche, L.; Schmitz, F.
1982-10-01
The observation of micrographic documents from fuel after a CABRI test leads to postulate a specific mode of transient fuel melting during a rapid nuclear power excursion. When reaching the melt threshold, the bands which are characteristic for the solid state are broken statistically over a macroscopic region. The time of maintaining the fuel at the critical enthalpy level between solid and liquid is too short to lead to a phase separation. A significant life-time (approximately 1 second) of this intermediate ''unsolide'' state would have consequences on the variation of physical properties linked to the phase transition solid/liquid: viscosity, specific volume and (for the irradiated fuel) fission gas release [fr
Tracking costs of alternatively fueled buses in Florida : [summary].
2011-01-01
In an effort to address rising fuel costs and environmental concerns, many transit agencies across Florida have introduced alternative fuel technologies to their traditional diesel-powered fleets. Fuel types include biodiesel, compressed natural gas,...
Advanced Nuclear Fuel Cycle Transitions: Optimization, Modeling Choices, and Disruptions
Carlsen, Robert W.
Many nuclear fuel cycle simulators have evolved over time to help understan the nuclear industry/ecosystem at a macroscopic level. Cyclus is one of th first fuel cycle simulators to accommodate larger-scale analysis with it liberal open-source licensing and first-class Linux support. Cyclus also ha features that uniquely enable investigating the effects of modeling choices o fuel cycle simulators and scenarios. This work is divided into thre experiments focusing on optimization, effects of modeling choices, and fue cycle uncertainty. Effective optimization techniques are developed for automatically determinin desirable facility deployment schedules with Cyclus. A novel method fo mapping optimization variables to deployment schedules is developed. Thi allows relationships between reactor types and scenario constraints to b represented implicitly in the variable definitions enabling the usage o optimizers lacking constraint support. It also prevents wasting computationa resources evaluating infeasible deployment schedules. Deployed power capacit over time and deployment of non-reactor facilities are also included a optimization variables There are many fuel cycle simulators built with different combinations o modeling choices. Comparing results between them is often difficult. Cyclus flexibility allows comparing effects of many such modeling choices. Reacto refueling cycle synchronization and inter-facility competition among othe effects are compared in four cases each using combinations of fleet of individually modeled reactors with 1-month or 3-month time steps. There are noticeable differences in results for the different cases. The larges differences occur during periods of constrained reactor fuel availability This and similar work can help improve the quality of fuel cycle analysi generally There is significant uncertainty associated deploying new nuclear technologie such as time-frames for technology availability and the cost of buildin advanced reactors
Feasibility Study of Correcting Circuit Scheme for Automatic Control System of Total Air in Boiler
Directory of Open Access Journals (Sweden)
V. I. Nazarov
2013-01-01
Full Text Available The paper contains results of investigations on dynamic characteristics automatic control system (ACS for total air consumption (TAC in a boiler with corrections for О2 and СО. From transition process point of view the ACS TAC with correction for СО is considered as the most optimum one as with disturbance attack on fuel expenditure so discharging beyond boiler furnace.
Wainwright, Carroll L.
2012-09-01
I present a numerical package (CosmoTransitions) for analyzing finite-temperature cosmological phase transitions driven by single or multiple scalar fields. The package analyzes the different vacua of a theory to determine their critical temperatures (where the vacuum energy levels are degenerate), their supercooling temperatures, and the bubble wall profiles which separate the phases and describe their tunneling dynamics. I introduce a new method of path deformation to find the profiles of both thin- and thick-walled bubbles. CosmoTransitions is freely available for public use.Program summaryProgram Title: CosmoTransitionsCatalogue identifier: AEML_v1_0Program summary URL: http://cpc.cs.qub.ac.uk/summaries/AEML_v1_0.htmlProgram obtainable from: CPC Program Library, Queen's University, Belfast, N. IrelandLicensing provisions: Standard CPC licence, http://cpc.cs.qub.ac.uk/licence/licence.htmlNo. of lines in distributed program, including test data, etc.: 8775No. of bytes in distributed program, including test data, etc.: 621096Distribution format: tar.gzProgramming language: Python.Computer: Developed on a 2009 MacBook Pro. No computer-specific optimization was performed.Operating system: Designed and tested on Mac OS X 10.6.8. Compatible with any OS with Python installed.RAM: Approximately 50 MB, mostly for loading plotting packages.Classification: 1.9, 11.1.External routines: SciPy, NumPy, matplotLibNature of problem: I describe a program to analyze early-Universe finite-temperature phase transitions with multiple scalar fields. The goal is to analyze the phase structure of an input theory, determine the amount of supercooling at each phase transition, and find the bubble-wall profiles of the nucleated bubbles that drive the transitions.Solution method: To find the bubble-wall profile, the program assumes that tunneling happens along a fixed path in field space. This reduces the equations of motion to one dimension, which can then be solved using the overshoot
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Jiang, Shanshan; Zhou, Wei; Niu, Yingjie; Zhu, Zhonghua; Shao, Zongping
2012-10-01
It is generally recognized that the phase transition of a perovskite may be detrimental to the connection between cathode and electrolyte. Moreover, certain phase transitions may induce the formation of poor electronic and ionic conducting phase(s), thereby lowering the electrochemical performance of the cathode. Here, we present a study on the phase transition of a cobalt-free perovskite (SrNb(0.1)Fe(0.9)O(3-δ), SNF) and evaluate its effect on the electrochemical performance of the fuel cell. SNF exists as a primitive perovskite structure with space group P4mm (99) at room temperature. As evidenced by in situ high-temperature X-ray diffraction measurements over the temperature range of 600 to 1000 °C, SNF undergoes a transformation to a tetragonal structure with a space group I4/m (87). This phase transition is accompanied by a moderate change in the volume, allowing a good cathode/electrolyte interface on thermal cycling. According to the electrochemical impedance spectroscopy evaluation, the I4/m phase exhibits positive effects on the cathode's performance, showing the highest oxygen reduction reaction activity of cobalt-free cathodes reported so far. This activity improvement is attributed to enhanced oxygen surface processes. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
AC Electroluminescent Processes in Pr3+-Activated (Ba0.4Ca0.6TiO3 Diphase Polycrystals
Directory of Open Access Journals (Sweden)
Nan Gao
2017-05-01
Full Text Available We investigated the properties of alternating current (AC-driven electroluminescence from (Ba0.4Ca0.6TiO3:Pr3+ diphase polycrystal-based device. The results of crystal phases and micrographs, and the symmetrical dual emissions in one AC cycle, indicate the spontaneous formation of a dielectric/phosphor/dielectric sandwich microstructure in (Ba0.4Ca0.6TiO3:Pr3+. The electroluminescent device emits a red light of 617 nm, which is attributed to the 1D2-3H4 transition of Pr3+ in the phosphor phase. At a fixed AC frequency, the intensity of electroluminescence exhibits a steep enhancement when applying an increased driving electric field that is beyond a threshold. In a fixed driving electric field, the intensity of electroluminescence shows a rapid rise at low frequencies, but reaches saturation at high frequencies. Based on a double-injection model, we discussed systematically the electroluminescent processes in a whole cycle of AC electric field, which matched well with the experimental data. Our investigation is expected to expand our understanding of such a diphase electroluminescent device, thereby promoting their applications in lighting and displays.
Morphology of single inhalable particle inside public transit biodiesel fueled bus.
Shandilya, Kaushik K; Kumar, Ashok
2010-01-01
In an urban-transit bus, fueled by biodiesel in Toledo, Ohio, single inhalable particle samples in October 2008 were collected and detected by scanning electron microscopy and energy dispersive X-ray spectrometry (SEM/EDS). Particle size analysis found bimodal distribution at 0.2 and 0.5 microm. The particle morphology was characterized by 14 different shape clusters: square, pentagon, hexagon, heptagon, octagon, nonagon, decagon, agglomerate, sphere, triangle, oblong, strip, line or stick, and unknown, by quantitative order. The square particles were common in the samples. Round and triangle particles are more, and pentagon, hexagon, heptagon, octagon, nonagon, decagon, strip, line or sticks are less. Agglomerate particles were found in abundance. The surface of most particles was coarse with a fractal edge that can provide a suitable chemical reaction bed in the polluted atmospheric environment. The three sorts of surface patterns of squares were smooth, semi-smooth, and coarse. The three sorts of square surface patterns represented the morphological characteristics of single inhalable particles in the air inside the bus in Toledo. The size and shape distribution results were compared to those obtained for a bus using ultra low sulfur diesel.
Fuzzy Logic Based Control of Power of PEM Fuel Cell System for Residential Application
Directory of Open Access Journals (Sweden)
Khaled MAMMAR
2009-07-01
Full Text Available This paper presents a dynamic model of Fuel cell system for residential power generation. The models proposed include a fuel cell stack model, reformer model and DC/AC inverter model. Furthermore a fuzzy logic (FLC controller is used to control active power of PEM fuel cell system. The controller modifies the hydrogen flow feedback from the terminal load. Simulation results confirmed the high performance capability of the fuzzy logic controller to control power generation.
Intrinsic defect processes and elastic properties of Ti3AC2 (A = Al, Si, Ga, Ge, In, Sn) MAX phases
Christopoulos, S.-R. G.; Filippatos, P. P.; Hadi, M. A.; Kelaidis, N.; Fitzpatrick, M. E.; Chroneos, A.
2018-01-01
Mn+1AXn phases (M = early transition metal; A = group 13-16 element and X = C or N) have a combination of advantageous metallic and ceramic properties, and are being considered for structural applications particularly where high thermal conductivity and operating temperature are the primary drivers: for example in nuclear fuel cladding. Here, we employ density functional theory calculations to investigate the intrinsic defect processes and mechanical behaviour of a range of Ti3AC2 phases (A = Al, Si, Ga, Ge, In, Sn). Based on the intrinsic defect reaction, it is calculated that Ti3SnC2 is the more radiation-tolerant 312 MAX phase considered herein. In this material, the C Frenkel reaction is the lowest energy intrinsic defect mechanism with 5.50 eV. When considering the elastic properties of the aforementioned MAX phases, Ti3SiC2 is the hardest and Ti3SnC2 is the softest. All the MAX phases considered here are non-central force solids and brittle in nature. Ti3SiC2 is elastically more anisotropic and Ti3AlC2 is nearly isotropic.
The AC Stark Effect, Time-Dependent Born-Oppenheimer Approximation, and Franck-Condon Factors
Hagedorn, G A; Jilcott, S W
2005-01-01
We study the quantum mechanics of a simple molecular system that is subject to a laser pulse. We model the laser pulse by a classical oscillatory electric field, and we employ the Born--Oppenheimer approximation for the molecule. We compute transition amplitudes to leading order in the laser strength. These amplitudes contain Franck--Condon factors that we compute explicitly to leading order in the Born--Oppenheimer parameter. We also correct an erroneous calculation in the mathematical literature on the AC Stark effect for molecular systems.
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Fuel choices for fuel-cell vehicles : well-to-wheel energy and emission impacts
International Nuclear Information System (INIS)
Wang, M.
2002-01-01
Because of their high energy efficiencies and low emissions, fuel-cell vehicles (FCVs) are undergoing extensive research and development. While hydrogen will likely be the ultimate fuel to power fuel-cell vehicles, because of current infrastructure constraints, hydrogen-carrying fuels are being investigated as transitional fuel-cell fuels. A complete well-to-wheels (WTW) evaluation of fuel-cell vehicle energy and emission effects that examines (1) energy feedstock recovery and transportation; (2) fuel production, transportation, and distribution; and (3) vehicle operation must be conducted to assist decision makers in selecting the fuel-cell fuels that achieve the greatest energy and emission benefits. A fuel-cycle model developed at Argonne National Laboratory--called the Greenhouse gases, Regulated Emissions, and Energy use in Transportation (GREET) model--was used to evaluate well-to-wheels energy and emission impacts of various fuel-cell fuels. The results show that different fuel-cell fuels can have significantly different energy and greenhouse gas emission effects. Therefore, if fuel-cell vehicles are to achieve the envisioned energy and emission reduction benefits, pathways for producing the fuels that power them must be carefully examined.
Numerical modeling of laboratory-scale surface-to-crown fire transition
Castle, Drew Clayton
Understanding the conditions leading to the transition of fire spread from a surface fuel to an elevated (crown) fuel is critical to effective fire risk assessment and management. Surface fires that successfully transition to crown fires can be very difficult to suppress, potentially leading to damages in the natural and built environments. This is relevant to chaparral shrub lands which are common throughout parts of the Southwest U.S. and represent a significant part of the wildland urban interface. The ability of the Wildland-Urban Interface Fire Dynamic Simulator (WFDS) to model surface-to-crown fire transition was evaluated through comparison to laboratory experiments. The WFDS model is being developed by the U.S. Forest Service (USFS) and the National Institute of Standards and Technology. The experiments were conducted at the USFS Forest Fire Laboratory in Riverside, California. The experiments measured the ignition of chamise (Adenostoma fasciculatum) crown fuel held above a surface fire spreading through excelsior fuel. Cases with different crown fuel bulk densities, crown fuel base heights, and imposed wind speeds were considered. Cold-flow simulations yielded wind speed profiles that closely matched the experimental measurements. Next, fire simulations with only the surface fuel were conducted to verify the rate of spread while factors such as substrate properties were varied. Finally, simulations with both a surface fuel and a crown fuel were completed. Examination of specific surface fire characteristics (rate of spread, flame angle, etc.) and the corresponding experimental surface fire behavior provided a basis for comparison of the factors most responsible for transition from a surface fire to the raised fuel ignition. The rate of spread was determined by tracking the flame in the Smokeview animations using a tool developed for tracking an actual flame in a video. WFDS simulations produced results in both surface fire spread and raised fuel bed
International Nuclear Information System (INIS)
Deng, Haijing; Xu, Hong; Zhang, Xianghong; Sun, Yue; Wang, Ruimin; Brann, Darrell; Yang, Fang
2016-01-01
The epithelial–mesenchymal transition (EMT) is a critical stage during the development of silicosis fibrosis. In the current study, we hypothesized that the anti-fibrotic tetrapeptide, N-acetyl-seryl-aspartyl-lysyl-proline (Ac-SDKP) may exert its anti-fibrotic effects via activation of the TGF-β1/ROCK1 pathway, leading to inhibition of EMT. To address this hypothesis, we first examined the effect of Ac-SDKP upon EMT using an in vivo rat silicosis model, as well as in an in vitro model of TGF-β1-induced EMT. Confocal laser scanning microscopy was used to examine colocalization of surfactant protein A (SP-A), fibroblast specific protein-1 (FSP-1) and α-smooth muscle actin (α-SMA) in vivo. Western blot analysis was used to examine for changes in the protein levels of E-cadherin (E-cad) and SP-A (epithelial cell markers), vimentin (mesenchymal cell marker), α-SMA (active myofibroblast marker), and collagen I and III in both in vivo and in vitro experiments. Secondly, we utilized Western blot analysis and confocal laser scanning microscopy to examine the protein expression of TGF-β1 and ROCK1 in in vivo and in vitro studies. The results revealed that Ac-SDKP treatment prevented increases in the expression of mesenchymal markers as well as TGF-β1, ROCK1, collagen I and III. Furthermore, Ac-SDKP treatment prevented decreases in the expression of epithelial cell markers in both in vivo and in vitro experiments. Based on the results, we conclude that Ac-SDKP inhibits the transition of epithelial cell-myofibroblast in silicosis via activation of the TGF-β1/ROCK1 signaling pathway, which may serve as a novel mechanism by which it exerts its anti-fibrosis properties. - Highlights: • EMT is a critical stage during the development of silicosis fibrosis. • Ac-SDKP inhibits the EMT process in silicosis both in vivo and in vitro. • Ac-SDKP inhibits the EMT process in silicosis via TGF-β1/ROCK1 pathway.
Energy Technology Data Exchange (ETDEWEB)
Deng, Haijing [School of Basic Medical Sciences, North China University of Science and Technology, Tangshan (China); Xu, Hong [Medical Research Center, International Science and Technology Cooperation Base of Geriatric Medicine, North China University of Science and Technology, Tangshan (China); Zhang, Xianghong [Pathology Department, Hebei Medical University, Shi Jiazhuang (China); Sun, Yue; Wang, Ruimin [Medical Research Center, International Science and Technology Cooperation Base of Geriatric Medicine, North China University of Science and Technology, Tangshan (China); Brann, Darrell [Department of Neuroscience and Regenerative Medicine, Medical College of Georgia, Augusta University, Augusta, GA 30912 (United States); Yang, Fang, E-mail: fangyang1978@163.com [Medical Research Center, International Science and Technology Cooperation Base of Geriatric Medicine, North China University of Science and Technology, Tangshan (China)
2016-03-01
The epithelial–mesenchymal transition (EMT) is a critical stage during the development of silicosis fibrosis. In the current study, we hypothesized that the anti-fibrotic tetrapeptide, N-acetyl-seryl-aspartyl-lysyl-proline (Ac-SDKP) may exert its anti-fibrotic effects via activation of the TGF-β1/ROCK1 pathway, leading to inhibition of EMT. To address this hypothesis, we first examined the effect of Ac-SDKP upon EMT using an in vivo rat silicosis model, as well as in an in vitro model of TGF-β1-induced EMT. Confocal laser scanning microscopy was used to examine colocalization of surfactant protein A (SP-A), fibroblast specific protein-1 (FSP-1) and α-smooth muscle actin (α-SMA) in vivo. Western blot analysis was used to examine for changes in the protein levels of E-cadherin (E-cad) and SP-A (epithelial cell markers), vimentin (mesenchymal cell marker), α-SMA (active myofibroblast marker), and collagen I and III in both in vivo and in vitro experiments. Secondly, we utilized Western blot analysis and confocal laser scanning microscopy to examine the protein expression of TGF-β1 and ROCK1 in in vivo and in vitro studies. The results revealed that Ac-SDKP treatment prevented increases in the expression of mesenchymal markers as well as TGF-β1, ROCK1, collagen I and III. Furthermore, Ac-SDKP treatment prevented decreases in the expression of epithelial cell markers in both in vivo and in vitro experiments. Based on the results, we conclude that Ac-SDKP inhibits the transition of epithelial cell-myofibroblast in silicosis via activation of the TGF-β1/ROCK1 signaling pathway, which may serve as a novel mechanism by which it exerts its anti-fibrosis properties. - Highlights: • EMT is a critical stage during the development of silicosis fibrosis. • Ac-SDKP inhibits the EMT process in silicosis both in vivo and in vitro. • Ac-SDKP inhibits the EMT process in silicosis via TGF-β1/ROCK1 pathway.
A New Dynamic Model for Nuclear Fuel Cycle System Analysis
International Nuclear Information System (INIS)
Choi, Sungyeol; Ko, Won Il
2014-01-01
The evaluation of mass flow is a complex process where numerous parameters and their complex interaction are involved. Given that many nuclear power countries have light and heavy water reactors and associated fuel cycle technologies, the mass flow analysis has to consider a dynamic transition from the open fuel cycle to other cycles over decades or a century. Although an equilibrium analysis provides insight concerning the end-states of fuel cycle transitions, it cannot answer when we need specific management options, whether the current plan can deliver these options when needed, and how fast the equilibrium can be achieved. As a pilot application, the government brought several experts together to conduct preliminary evaluations for nuclear fuel cycle options in 2010. According to Table 1, they concluded that the closed nuclear fuel cycle has long-term advantages over the open fuel cycle. However, it is still necessary to assess these options in depth and to optimize transition paths of these long-term options with advanced dynamic fuel cycle models. A dynamic simulation model for nuclear fuel cycle systems was developed and its dynamic mass flow analysis capability was validated against the results of existing models. This model can reflects a complex combination of various fuel cycle processes and reactor types, from once-through to multiple recycling, within a single nuclear fuel cycle system. For the open fuel cycle, the results of the developed model are well matched with the results of other models
Fuel cell development for transportation: Catalyst development
Energy Technology Data Exchange (ETDEWEB)
Doddapaneni, N. [Sandia National Lab., Albuquerque, NM (United States)
1996-04-01
Fuel cells are being considered as alternate power sources for transportation and stationary applications. With proton exchange membrane (PEM) fuel cells the fuel crossover to cathodes causes severe thermal management and cell voltage drop due to oxidation of fuel at the platinized cathodes. The main goal of this project was to design, synthesize, and evaluate stable and inexpensive transition metal macrocyclic catalysts for the reduction of oxygen and be electrochemically inert towards anode fuels such as hydrogen and methanol.
Kinematics and thermodynamics of non-stoichiometric oxidation phase transitions in spent fuel
International Nuclear Information System (INIS)
Stout, R.B.; Kansa, E.J.; Wijesinghe, A.M.
1993-01-01
At low temperatures ( 2 lattice to a U 4 O 9 lattice but with an oxygen-to-uranium (O/U) ratio of ∼2.4. Also, the weight gain time response has a plateau as the O/U approaches 2.4. Part of this response results from a geometrical dependency as a U 4 O 9 oxidation front propagates into grain volumes Of UO 2 It may also be indicative of a metastable, non-stoichiometric U 4 O 9 phase whose existence may inhibit the transition kinetics to the next expected phase Of U 3 O 8 . To gain a mechanistic understanding and to plan future oxidation tests, lattice kinematic and thermodynamic models are developed for lattice deformations and energetics of lattice phase changes (UO 2 → U 4 O 9 → U 3 0 7 → U 3 O 8) that include zeroth order influences on oxidation kinetics due to interstitial oxygen atoms and vacancies plus interstitial and substitutional actinides and fission decay products in spent fuel
Spent fuel pool spray cooling system for the AP1000 {sup registered}
Energy Technology Data Exchange (ETDEWEB)
Vujic, Zoran; Sassen, Felix; Tietsch, Wolfgang [Westinghouse Electric Germany GmbH, Mannheim (Germany)
2013-07-01
The AP1000 {sup registered} plant design features multiple, diverse lines of defense to ensure spent fuel cooling can be maintained for Design Basis Events and Beyond Design Basis Accidents (BDBA). The AP1000 {sup registered} plant lines of defense with respect to Spent Fuel Pool (SFP) cooling are as follows: 1. During normal and abnormal conditions, defense-in-depth and duty systems provide highly reliable SFP cooling, supplied by offsite AC power or the onsite Standby Diesel Generators. 2. For unlikely events with extended loss of AC power (i.e. station black-out) and/or loss of heat sink, spent fuel cooling can be still provided indefinitely by: 2a. Passive systems, requiring minimal or no operator actions, sufficient for at least 72 hours under all possible loading conditions. 2b. After 3 days, several different means are provided to continue SFP cooling using installed plant equipment as well as off-site equipment with built-in connections. 3. Even for BDBA with postulated SFP damage and multiple failures in the passive safety-related systems and in the defense-in-depth active systems, the AP1000 {sup registered} SFP Spray System provides an additional line of defense to prevent spent fuel damage. (orig.)
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Hawaiian hydrogen mass transit system
International Nuclear Information System (INIS)
Russell, G.W.; Russell, A.
1990-01-01
This paper proposes a joint effort between the scientific and business communities; to create, make and have hydrogen fuel become the primary fuel of the future. Hawaii has abundant, unharnessed renewable resources yet imports almost all of its fuel. Initiating hydrogen production and industrial application in conjunction with a prototype pilot project such as this mass transit system would not only accomplish the joining of science and business but give an environmentally safe energy alternative to the state and people of Hawaii and hopefully the world
Economic aspects of Dukovany NPP fuel cycle
International Nuclear Information System (INIS)
Vesely, P.; Borovicka, M.
2001-01-01
The paper discusses some aspects of high burnup program implementation at Dukovany NPP and its influence on the fuel cycle costs. Dukovany internal fuel cycle is originally designed as a three years cycle of the Out-In-In fuel reloading patterns. These reloads are not only uneconomical but they additionally increased the radiation load of the reactor pressure vessel due to high neutron leakage typical for Out-In-In loading pattern. To avoid the high neutron leakage from the core a transition to 4-year fuel cycle is started in 1987. The neutron leakage from the core is sequentially decreased by insertion of older fuel assemblies at the core periphery. Other developments in fuel cycle are: 1) increasing of enrichment in control assemblies (3.6% of U-235); 2) improvement in fuel assembly design (reduce the assembly shroud thickness from 2.1 to 1.6 mm); 3) introduction of Zr spacer grid instead of stainless steel; 4) introduction of new type of assembly with profiled enrichment with average value of 3.82%. Due to increased reactivity of the new assemblies the transition to the partial 5-year fuel cycle is required. Typical fuel loading pattern for 3, 3.5, 4 and 5-year cycles are shown in the presented paper. An evaluation of fuel cost is also discussed by using comparative analysis of different fuel cycle options. The analysis shows that introduction of the high burnup program has decrease relative fuel cycle costs
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Replacing the IRAF/PyRAF Code-base at STScI: The Advanced Camera for Surveys (ACS)
Lucas, Ray A.; Desjardins, Tyler D.; STScI ACS (Advanced Camera for Surveys) Team
2018-06-01
IRAF/PyRAF are no longer viable on the latest hardware often used by HST observers, therefore STScI no longer actively supports IRAF or PyRAF for most purposes. STScI instrument teams are in the process of converting all of our data processing and analysis code from IRAF/PyRAF to Python, including our calibration reference file pipelines and data reduction software. This is exemplified by our latest ACS Data Handbook, version 9.0, which was recently published in February 2018. Examples of IRAF and PyRAF commands have now been replaced by code blocks in Python, with references linked to documentation on how to download and install the latest Python software via Conda and AstroConda. With the temporary exception of the ACS slitless spectroscopy tool aXe, all ACS-related software is now independent of IRAF/PyRAF. A concerted effort has been made across STScI divisions to help the astronomical community transition from IRAF/PyRAF to Python, with tools such as Python Jupyter notebooks being made to give users workable examples. In addition to our code changes, the new ACS data handbook discusses the latest developments in charge transfer efficiency (CTE) correction, bias de-striping, and updates to the creation and format of calibration reference files among other topics.
Worldwide supply of Framatome ANP Fuel
International Nuclear Information System (INIS)
Jouan, J.
2002-01-01
Framatome-ANP is organized according to a matrix structure with 4 business groups and 3 regional divisions. The fuel business group with a workforce of about 4600 people is active in all the trades needed to design and manufacture nuclear fuel. The activity ranges from the production of zirconium alloys to the production of finished fuel assemblies, facilities are located in France, Germany and Usa. Framatome-ANP is the foremost vendor of LWR fuel worldwide with 41 % of the PWR market share and 22 % of the BWR market share. The global operating experience built up is based on more than 150.000 fuel assemblies delivered to 169 reactors in 18 countries. This long history has allowed Framatome-ANP to develop an efficient quality-improvement program based on experience feedback, for instance fuel rod failures induced by debris have been almost completely eliminated with the introduction of anti-debris devices equipping bottom nozzles. Framatome-ANP has developed a large range of engineering services, for instance core design teams can provide the most cost-effective fuel management schemes for cycle lengths from 6 to 24 months. The first technology transfer between China entities and Framatome related to the AFA-2G technology started in 1991 and was completed successfully in 1994. Since this date the Chinese manufacturer has supplied fuel reload for the units of Daya-Bay. (A.C.)
A Comparison of Materials Issues for Cermet and Graphite-Based NTP Fuels
Stewart, Mark E.; Schnitzler, Bruce G.
2013-01-01
This paper compares material issues for cermet and graphite fuel elements. In particular, two issues in NTP fuel element performance are considered here: ductile to brittle transition in relation to crack propagation, and orificing individual coolant channels in fuel elements. Their relevance to fuel element performance is supported by considering material properties, experimental data, and results from multidisciplinary fluid/thermal/structural simulations. Ductile to brittle transition results in a fuel element region prone to brittle fracture under stress, while outside this region, stresses lead to deformation and resilience under stress. Poor coolant distribution between fuel element channels can increase stresses in certain channels. NERVA fuel element experimental results are consistent with this interpretation. An understanding of these mechanisms will help interpret fuel element testing results.
Zhang, Xiaoyuan
2014-07-31
© 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim. Activated carbon (AC) is a low-cost and effective catalyst for oxygen reduction in air cathodes of microbial fuel cells (MFCs), but its performance must be maintained over time. AC was modified by three methods: 1)pyrolysis with iron ethylenediaminetetraacetic acid (AC-Fe), 2)heat treatment (AC-heat), and 3)mixing with carbon black (AC-CB). The maximum power densities after one month with these AC cathodes were 35% higher with AC-Fe (1410±50mW m-2) and AC-heat (1400±20mW m-2), and 16% higher with AC-CB (1210±30mW m-2) than for plain AC (1040±20mW m-2), versus 1270±50mW m-2 for a Pt control. After 16months, the Pt cathodes produced only 250±10mW m-2. However, the AC-heat and AC-CB cathodes still produced 960-970mW m-2, whereas plain AC produced 860±60mW m-2. The performance of the AC cathodes was restored to >85% of the initial maximum power densities by cleaning with a weak acid solution. Based on cost considerations among the AC materials, AC-CB appears to be the best choice for long-term performance.
International Nuclear Information System (INIS)
Shirakawa, Ken-etsu.
1988-01-01
Purpose: To reduce the pressure loss of coolants by fuel assembly spacers. Constitution: Spacers for supporting a fuel assembly are attached by means of a plurality of wires to an outer frame. The outer frame is made of shape memory alloy such that the wires are caused to slacken at normal temperature and the slacking of the wires is eliminated in excess of the transition temperature. Since the wires slacken at the normal temperature, fuel rods can be inserted easily. After the insertion of the fuel rods, when the entire portion or the outer frame is heated by water or gas at a predetermined temperature, the outer frame resumes its previously memorized shape to tighten the wires and, accordingly, the fuel rods can be supported firmly. In this way, since the fuel rods are inserted in the slacken state of the wires and, after the assembling, the outer frame resumes its memorized shape, the assembling work can be conducted efficiently. (Kamimura, M.)
Energy Technology Data Exchange (ETDEWEB)
Lima, Alan M.M. de; Schirru, Roberto [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia. Programa de Engenharia Nuclear]. E-mail: alan@lmp.ufrj.br; schirru@lmp.ufrj.br
2005-07-01
A Pressurized Water Reactor core must be reloaded every time the fuel burnup reaches a level when it is not possible to sustain nominal power operation. The nuclear core fuel reload optimization consists in finding a burned-up and fresh-fuel-assembly pattern that maximizes the number of full operational days. This problem is NP-hard, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Besides that, the problem is non-linear and its search space is highly discontinual and multimodal. In this work a parallel computational system based on Ant Colony System (ACS) called Artificial-Ant-Colony Networks is introduced to solve the nuclear reactor core fuel reload optimization problem. ACS is a system based on artificial agents that uses the reinforcement learning technique and was originally developed to solve the Traveling Salesman Problem, which is conceptually similar to the nuclear fuel reload problem. (author)
Analysis of closed-pool boilup using the TRANSIT-HYDRO code
International Nuclear Information System (INIS)
Graff, D.L.
1983-01-01
The benign termination of the transition phase of a hypothetical LMFBR accident rests on the avoidance of highly energetic recriticalities prior to escape of bottled molten core materials from the active core region. In scenarios where molten fuel is trapped due to axial blockages, the maintenance of subcritical configurations until radial flow paths develop requires stable boil-up of the molten fuel/steel mixture. This paper describes the analysis of an experiment investigating the behavior of closed boiling pools using the two-fluid hydrodynamics module of TRANSIT-HYDRO, a deterministic transition-phase analysis code
Directory of Open Access Journals (Sweden)
1993-01-01
Full Text Available BASES DE L'ECHANGE ENTRE LES SOCIETES NORD-PERUVIENNES ET SUD-EQUATORIENNES : UNE ZONE DE TRANSITION ENTRE 1500 AV. J.C. ET 600 AP. J.C. Cet article est le fruit dune tentative de coopération entre des chercheurs qui travaillent en Équateur et au Pérou, pour relier les deux aires culturelles nettement différenciées, nord-andine et centre-andine, à partir de la définition et de létude dune zone de transition, localisée entre le Río Jubones dans le sud de l'Équateur et le Río Olmos dans le nord du Pérou, entre environ 1500 av. J.C. et 600 ap. J.C. El artículo es resultado de un intento de cooperación entre investigadores que trabajan el Ecuador y el Perú para vincular las dos áreas culturales marcadamente diferenciadas, norandina y centroandina, a partir de la definición y estudio de una zona de transición, localizada entre el río Jubones, al sur de Ecuador y el Río Olmos, al norte de Perú, entre aproximadamente 1500 AC y 600 DC. BASIS OF THE EXCHANGE BETWEEN NORTH PERUVIAN AND SOUTH ECUATORIAN SOCIETIES: A TRANSITIONAL ZONE BETWEEN 1500 B.C. AND 600 A.C. This paper is a collaborative effort by researchers working in Ecuador and Peru, to explore the relationship between two clearly differentiated cultural areas (North and Central Andes on the basis of a definition and study of the prehistory transitional zone located between Río Jubones in Southern Ecuador and Río Olmos in Northern Peru between 1500 B.C. and 600 A.C.
International Nuclear Information System (INIS)
Lajunen, Antti; Lipman, Timothy
2016-01-01
This paper evaluates the lifecycle costs and carbon dioxide emissions of different types of city buses. The simulation models of the different powertrains were developed in the Autonomie vehicle simulation software. The carbon dioxide emissions were calculated both for the bus operation and for the fuel and energy pathways from well to tank. Two different operating environment case scenarios were used for the primary energy sources, which were Finland and California (USA). The fuel and energy pathways were selected appropriately in relation to the operating environment. The lifecycle costs take into account the purchase, operating, maintenance, and possible carbon emission costs. Based on the simulation results, the energy efficiency of city buses can be significantly improved by the alternative powertrain technologies. Hybrid buses have moderately lower carbon dioxide emissions during the service life than diesel buses whereas fully-electric buses have potential to significantly reduce carbon dioxide emissions, by up to 75%. The lifecycle cost analysis indicates that diesel hybrid buses are already competitive with diesel and natural gas buses. The high costs of fuel cell and battery systems are the major challenges for the fuel cell hybrid buses in order to reduce lifecycle costs to more competitive levels. - Highlights: • Alternative powertrains can significantly improve energy efficiency of transit buses. • Operating environment has an important impact on the lifecycle costs of buses. • Diesel hybrid buses are already cost effective solution for public transportation. • The cost of fuel cell technology is the major challenge for fuel cell hybrid buses. • Fully-electric buses have potential to significantly reduce carbon dioxide emissions.
To Evaluate Zero Emission Propulsion and Support Technology for Transit Buses
Energy Technology Data Exchange (ETDEWEB)
Kevin Chandler; Leslie Eudy
2006-11-01
This report provides evaluation results for prototype fuel cell transit buses operating at Santa Clara Valley Transportation Authority (VTA) in San Jose, California, in partnership with the San Mateo County Transit District in San Carlos, California. VTA has been operating three fuel cell transit buses in extra revenue service since February 28, 2005. This report provides descriptions of the equipment used, early experiences, and evaluation results from the operation of the buses and the supporting hydrogen infrastructure from March 2005 through July 2006.
Directory of Open Access Journals (Sweden)
Wei Ren
2016-01-01
Full Text Available Current file storage service models for cloud servers assume that users either belong to single layer with different privileges or cannot authorize privileges iteratively. Thus, the access control is not fine-grained and flexible. Besides, most access control methods at cloud servers mainly rely on computationally intensive cryptographic algorithms and, especially, may not be able to support highly dynamic ad hoc groups with addition and removal of group members. In this paper, we propose a scheme called F2AC, which is a lightweight, fine-grained, and flexible access control scheme for file storage in mobile cloud computing. F2AC can not only achieve iterative authorization, authentication with tailored policies, and access control for dynamically changing accessing groups, but also provide access privilege transition and revocation. A new access control model called directed tree with linked leaf model is proposed for further implementations in data structures and algorithms. The extensive analysis is given for justifying the soundness and completeness of F2AC.
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
A rapid selection strategy for an anodophilic consortium for microbial fuel cells
Wang, Aijie
2010-07-01
A rapid selection method was developed to enrich for a stable and efficient anodophilic consortium (AC) for microbial fuel cells (MFCs). A biofilm sample from a microbial electrolysis cell was serially diluted up to 10-9 in anaerobic phosphate buffer solution and incubated in an Fe(III)-acetate medium, and an Fe(III)-reducing AC was obtained for dilutions up to 10-6. The activity of MFC inoculated with the enrichment AC was compared with those inoculated with original biofilm or activated sludge. The power densities and Coulombic efficiencies of the AC (226 mW/m2, 34%) were higher than those of the original biofilm (209 mW/m2, 23%) and activated sludge (192 mW/m2, 19%). The start-up period of the AC (60 h) was also shorter than those obtained with the other inocula (biofilm, 95 h; activated sludge, 300 h). This indicated that such a strategy is highly efficient for obtaining an anodophilic consortium for improving the performance of an MFC. © 2010 Elsevier Ltd.
Xia, Xue
2013-08-28
Activated carbon (AC) is a cost-effective catalyst for the oxygen reduction reaction (ORR) in air-cathode microbial fuel cells (MFCs). To enhance the catalytic activity of AC cathodes, AC powders were pyrolyzed with iron ethylenediaminetetraacetic acid (FeEDTA) at a weight ratio of FeEDTA:AC = 0.2:1. MFCs with FeEDTA modified AC cathodes and a stainless steel mesh current collector produced a maximum power density of 1580 ± 80 mW/m2, which was 10% higher than that of plain AC cathodes (1440 ± 60 mW/m 2) and comparable to Pt cathodes (1550 ± 10 mW/m2). Further increases in the ratio of FeEDTA:AC resulted in a decrease in performance. The durability of AC-based cathodes was much better than Pt-catalyzed cathodes. After 4.5 months of operation, the maximum power density of Pt cathode MFCs was 50% lower than MFCs with the AC cathodes. Pyridinic nitrogen, quaternary nitrogen and iron species likely contributed to the increased activity of FeEDTA modified AC. These results show that pyrolyzing AC with FeEDTA is a cost-effective and durable way to increase the catalytic activity of AC. © 2013 American Chemical Society.
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
American Fuel Cell Bus Project Evaluation. Second Report
Energy Technology Data Exchange (ETDEWEB)
Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2015-09-01
This report presents results of the American Fuel Cell Bus (AFCB) Project, a demonstration of fuel cell electric buses operating in the Coachella Valley area of California. The prototype AFCB was developed as part of the Federal Transit Administration's (FTA's) National Fuel Cell Bus Program. Through the non-profit consortia CALSTART, a team led by SunLine Transit Agency and BAE Systems developed a new fuel cell electric bus for demonstration. SunLine added two more AFCBs to its fleet in 2014 and another in 2015. FTA and the AFCB project team are collaborating with the U.S. Department of Energy (DOE) and DOE's National Renewable Energy Laboratory to evaluate the buses in revenue service. This report summarizes the performance results for the buses through June 2015.
An, Yanzhao; Vallinayagam, R; Vedharaj, S; Masurier, Jean-Baptiste; Dawood, Alaaeldin; Izadi Najafabadi, Mohammad; Somers, Bart; Johansson, Bengt
2017-01-01
In-cylinder visualization, combustion stratification, and engine-out particulate matter (PM) emissions were investigated in an optical engine fueled with Haltermann straight-run naphtha fuel and corresponding surrogate fuel. The combustion mode was transited from homogeneous charge compression ignition (HCCI) to conventional compression ignition (CI) via partially premixed combustion (PPC). Single injection strategy with the change of start of injection (SOI) from early to late injections was employed. The high-speed color camera was used to capture the in-cylinder combustion images. The combustion stratification was analyzed based on the natural luminosity of the combustion images. The regulated emission of unburned hydrocarbon (UHC), carbon monoxide (CO) and nitrogen oxides (NO) were measured to evaluate the combustion efficiency together with the in-cylinder rate of heat release. Soot mass concentration was measured and linked with the combustion stratification and the integrated red channel intensity of the high-speed images for the soot emissions. The nucleation nanoscale particle number and the particle size distribution were sampled to understand the effect of combustion mode switch.
An, Yanzhao
2017-10-10
In-cylinder visualization, combustion stratification, and engine-out particulate matter (PM) emissions were investigated in an optical engine fueled with Haltermann straight-run naphtha fuel and corresponding surrogate fuel. The combustion mode was transited from homogeneous charge compression ignition (HCCI) to conventional compression ignition (CI) via partially premixed combustion (PPC). Single injection strategy with the change of start of injection (SOI) from early to late injections was employed. The high-speed color camera was used to capture the in-cylinder combustion images. The combustion stratification was analyzed based on the natural luminosity of the combustion images. The regulated emission of unburned hydrocarbon (UHC), carbon monoxide (CO) and nitrogen oxides (NO) were measured to evaluate the combustion efficiency together with the in-cylinder rate of heat release. Soot mass concentration was measured and linked with the combustion stratification and the integrated red channel intensity of the high-speed images for the soot emissions. The nucleation nanoscale particle number and the particle size distribution were sampled to understand the effect of combustion mode switch.
Performance and emissions analysis on using acetone–gasoline fuel blends in spark-ignition engine
Ashraf Elfasakhany
2016-01-01
In this study, new blended fuels were formed by adding 3–10 vol. % of acetone into a regular gasoline. According to the best of the author's knowledge, it is the first time that the influence of acetone blends has been studied in a gasoline-fueled engine. The blended fuels were tested for their energy efficiencies and pollutant emissions using SI (spark-ignition) engine with single-cylinder and 4-stroke. Experimental results showed that the AC3 (3 vol.% acetone + 97 vol.% gasoline) blended fu...
Fossil Fuels, Backstop Technologies, and Imperfect Substitution
van der Meijden, G.C.; Pittel, Karen; van der Ploeg, Frederick; Withagen, Cees
2014-01-01
This chapter studies the transition from fossil fuels to backstop technologies in a general equilibrium model in which growth is driven by research and development. The analysis generalizes the existing literature by allowing for imperfect substitution between fossil fuels and the new energy
Influence of fuel ratios on auto combustion synthesis of barium ferrite ...
Indian Academy of Sciences (India)
Unknown
Influence of fuel ratios on auto combustion synthesis of barium ferrite nano particles. D BAHADUR*, S RAJAKUMAR and ANKIT KUMAR. Department of Metallurgical Engineering and Materials Science, Indian Institute of Technology,. Mumbai 400 076 e-mail: dhirenb@iitb.ac.in. Abstract. Single-domain barium ferrite nano ...
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
International Nuclear Information System (INIS)
Wu Zongxin; Jing Xingqing
2001-01-01
The 10 MW high temperature cooled reactor (HTR-10) built in Tsinghua University is a pebble bed type of HTGR. The continuous recharge and multiple-pass of spherical fuel elements are used for fuel management. The initiative stage of core is composed of the mix of spherical fuel elements and graphite elements. The equilibrium stage of core is composed of identical spherical fuel elements. The fuel management during the transition from the initiative stage to the equilibrium stage is a key issue for HTR-10 physical design. A fuel management strategy is proposed based on self-adjustment of core reactivity. The neutron physical code is used to simulate the process of fuel management. The results show that the graphite elements, the recharging fuel elements below the burn-up allowance, and the discharging fuel elements over the burn-up allowance could be identified by burn-up measurement. The maximum of burn-up fuel elements could be controlled below the burn-up limit
Nuclear fuels with high burnup: safety requirements
International Nuclear Information System (INIS)
Phuc Tran Dai
2016-01-01
Vietnam authorities foresees to build 3 reactors from Russian design (VVER AES 2006) by 2030. In order to prepare the preliminary report on safety analysis the Vietnamese Agency for Radioprotection and Safety has launched an investigation on the behaviour of nuclear fuels at high burnups (up to 60 GWj/tU) that will be those of the new plants. This study deals mainly with the behaviour of the fuel assemblies in case of loss of coolant (LOCA). It appears that for an average burnup of 50 GWj/tU and for the advanced design of the fuel assembly (cladding and materials) safety requirements are fulfilled. For an average burnup of 60 GWj/tU, a list of issues remains to be assessed, among which the impact of clad bursting or the hydrogen embrittlement of the advanced zirconium alloys. (A.C.)
International Nuclear Information System (INIS)
Inagaki, Toru; Nishiwaki, Futoshi; Kanou, Jirou; Yamasaki, Satoru; Hosoi, Kei; Miyazawa, Takashi; Yamada, Masaharu; Komada, Norikazu
2006-01-01
The Kansai Electric Power Co., Inc. (KEPCO) and Mitsubishi Materials Corporation (MMC) have been jointly developing intermediate-temperature solid oxide fuel cells (SOFCs). The operation temperatures between 600 and 800 o C were set as the target, which enable SOFC to use less expensive metallic separators for cell-stacking and to carry out internal reforming of hydrocarbon fuels. The electrolyte-supported planar-type cells were fabricated using highly conductive lanthanum gallate-based electrolyte, La(Sr)Ga(Mg,Co)O 3-δ , Ni-(CeO 2 ) 1-x (SmO 1.5 ) x cermet anode, and Sm(Sr)CoO 3-δ cathode. The 1 kW-class power generation modules were fabricated using a seal-less stack of the cells and metallic separators. The 1 kW-class prototype power generation system with the module was developed with the high performance cell, which showed the thermally self-sustainability. The system included an SOFC module, a dc-ac inverter, a desulfurizer, and a heat recovery unit. It provided stable ac power output of 1 kW with the electrical efficiency of 45% LHV based on ac output by using city gas as a fuel, which was considered to be excellent for such a small power generation system. And the hot water of 90 o C was obtained using high temperature off-gas from SOFC
Energy Technology Data Exchange (ETDEWEB)
Inagaki, Toru [Kansai Electric Power Co. Inc., Energy Use R and D Center, 11-20 Nakoji 3-chome, Amagasaki, Hyogo 661-0974 (Japan)]. E-mail: inagaki@rdd.kepco.co.jp; Nishiwaki, Futoshi [Kansai Electric Power Co. Inc., Energy Use R and D Center, 11-20 Nakoji 3-chome, Amagasaki, Hyogo 661-0974 (Japan); Kanou, Jirou [Kansai Electric Power Co. Inc., Energy Use R and D Center, 11-20 Nakoji 3-chome, Amagasaki, Hyogo 661-0974 (Japan); Yamasaki, Satoru [Kansai Electric Power Co. Inc., Energy Use R and D Center, 11-20 Nakoji 3-chome, Amagasaki, Hyogo 661-0974 (Japan); Hosoi, Kei [Mitsubishi Materials Corporation, Central Research Institute, 1002-14 Mukohyama, Naka-machi, Naka-gun, Ibaraki 311-0102 (Japan); Miyazawa, Takashi [Mitsubishi Materials Corporation, Central Research Institute, 1002-14 Mukohyama, Naka-machi, Naka-gun, Ibaraki 311-0102 (Japan); Yamada, Masaharu [Mitsubishi Materials Corporation, Central Research Institute, 1002-14 Mukohyama, Naka-machi, Naka-gun, Ibaraki 311-0102 (Japan); Komada, Norikazu [Mitsubishi Materials Corporation, Central Research Institute, 1002-14 Mukohyama, Naka-machi, Naka-gun, Ibaraki 311-0102 (Japan)
2006-02-09
The Kansai Electric Power Co., Inc. (KEPCO) and Mitsubishi Materials Corporation (MMC) have been jointly developing intermediate-temperature solid oxide fuel cells (SOFCs). The operation temperatures between 600 and 800 {sup o}C were set as the target, which enable SOFC to use less expensive metallic separators for cell-stacking and to carry out internal reforming of hydrocarbon fuels. The electrolyte-supported planar-type cells were fabricated using highly conductive lanthanum gallate-based electrolyte, La(Sr)Ga(Mg,Co)O{sub 3-{delta}}, Ni-(CeO{sub 2}){sub 1-x}(SmO{sub 1.5}) {sub x} cermet anode, and Sm(Sr)CoO{sub 3-{delta}} cathode. The 1 kW-class power generation modules were fabricated using a seal-less stack of the cells and metallic separators. The 1 kW-class prototype power generation system with the module was developed with the high performance cell, which showed the thermally self-sustainability. The system included an SOFC module, a dc-ac inverter, a desulfurizer, and a heat recovery unit. It provided stable ac power output of 1 kW with the electrical efficiency of 45% LHV based on ac output by using city gas as a fuel, which was considered to be excellent for such a small power generation system. And the hot water of 90 {sup o}C was obtained using high temperature off-gas from SOFC.
Surface area considerations for corroding N reactor fuel
International Nuclear Information System (INIS)
Johnson, A.B. Jr.; Pitner, A.L.
1996-06-01
The N Reactor fuel is corroding at sites where the Zircaloy cladding was damaged when the fuel was discharged from the reactor. Corroding areas are clearly visible on the fuel stored in open cans in the K East Basin. There is a need to estimate the area of the corroding uranium to analyze aspects of fuel behavior as it is transitioned. from current wet storage to dry storage. In this report, the factors that contribute to open-quotes trueclose quotes surface area are analyzed in terms of what is currently known about the N Reactor fuel. Using observations from a visual examinations of the fuel in the K East wet storage facility, a value for the corroding geometric area is estimated. Based on observations of corroding uranium and surface roughness values for other metals, a surface roughness factor is also estimated and applied to the corroding K East fuel to provide an estimated open-quotes trueclose quotes surface area. While the estimated area may be modified as additional data become available from fuel characterization studies, the estimate provides a basis to assess effects of exposed uranium metal surfaces on fuel behavior in operations involved in transitioning from wet to dry storage, during shipment and staging, conditioning, and dry interim storage
Hydrogen fuel cell power system
International Nuclear Information System (INIS)
Lam, A.W.
2004-01-01
'Full text:' Batteries are typically a necessary and prime component of any DC power system, providing a source of on-demand stored energy with proven reliability. The integration of batteries and basic fuel cells for mobile and stationary utility applications poses a new challenge. For high value applications, the specification and operating requirements for this hybrid module differ from conventional requirements as the module must withstand extreme weather conditions and provide extreme reliability. As an electric utility company, BCHydro has embarked in the development and application of a Hydrogen Fuel Cell Power Supply (HFCPS) for field trial. A Proton Exchange Membrane (PEM)- type fuel cell including power electronic modules are mounted in a standard 19-inch rack that provides 48V, 24V, 12V DC and 120V AC outputs. The hydrogen supply consists of hydrogen bottles and regulating devices to provide a continuous fuel source to the power modules. Many tests and evaluations have been done to ensure the HFCPS package is robust and suitable for electric utility grade operation. A field trial demonstrating this standalone system addressed reliability, durability, and installation concerns as well as developed the overall system operating procedures. (author)
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
Lessons Learned From Dynamic Simulations of Advanced Fuel Cycles
International Nuclear Information System (INIS)
Piet, Steven J.; Dixon, Brent W.; Jacobson, Jacob J.; Matthern, Gretchen E.; Shropshire, David E.
2009-01-01
Years of performing dynamic simulations of advanced nuclear fuel cycle options provide insights into how they could work and how one might transition from the current once-through fuel cycle. This paper summarizes those insights from the context of the 2005 objectives and goals of the Advanced Fuel Cycle Initiative (AFCI). Our intent is not to compare options, assess options versus those objectives and goals, nor recommend changes to those objectives and goals. Rather, we organize what we have learned from dynamic simulations in the context of the AFCI objectives for waste management, proliferation resistance, uranium utilization, and economics. Thus, we do not merely describe 'lessons learned' from dynamic simulations but attempt to answer the 'so what' question by using this context. The analyses have been performed using the Verifiable Fuel Cycle Simulation of Nuclear Fuel Cycle Dynamics (VISION). We observe that the 2005 objectives and goals do not address many of the inherently dynamic discriminators among advanced fuel cycle options and transitions thereof
Hysteresis and transition in swirling nonpremixed flames
Tummers, M.J.; Hübner, A.W.; van Veen, E.H.; Hanjalic, K.; van der Meer, Theodorus H.
2009-01-01
Strongly swirling nonpremixed flames are known to exhibit a hysteresis when transiting from an attached long, sooty, yellow flame to a short lifted blue flame, and vice versa. The upward transition (by increasing the air and fuel flow rates) corresponds to a vortex breakdown, i.e. an abrupt change
Apparatus and method for controlling the secondary injection of fuel
Martin, Scott M.; Cai, Weidong; Harris, Jr., Arthur J.
2013-03-05
A combustor (28) for a gas turbine engine is provided comprising a primary combustion chamber (30) for combusting a first fuel to form a combustion flow stream (50) and a transition piece (32) located downstream from the primary combustion chamber (30). The transition piece (32) comprises a plurality of injectors (66) located around a circumference of the transition piece (32) for injecting a second fuel into the combustion flow stream (50). The injectors (66) are effective to create a radial temperature profile (74) at an exit (58) of the transition piece (32) having a reduced coefficient of variation relative to a radial temperature profile (64) at an inlet (54) of the transition piece (32). Methods for controlling the temperature profile of a secondary injection are also provided.
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Colon transit scintigraphy by 67 Ga citrate for idiopathic constitution
International Nuclear Information System (INIS)
Neshandar Asll, I.; Ehsani, M.J.; Javadi, H.
2005-01-01
Background/objective: segmental colonic transit studies are important in patients with severe constipation. This study is the first Iranian preliminary survey of colonic transit scintigraphy using 67 Ga -citrate as a new method in constipated patients with normal radiographic and colonoscopic evaluations. Patients and methods: thirteen patients with idiopathic constipation underwent colon transit scintigraphy. After oral administration of 6-7 MBq Ga-citrates, serial abdominal images were taken up to 72 hours. Pattern classification wa s performed visually according to the distribution of radioactivity, Scintigraphic parameters such as geometric mean center of seq mental retention of tracer, as well as mean ac activity profiles and colonic tracer half-clearance time were calculated Results: Three patterns of colonic transit scintigraphy were recognized. Nine patients had the normal pattern, i.e. excellent propagation of ac activity. Three patients had the colonic inertia pattern with marked retention of activity in the transverse colon and splenic flexure at 48 hours, One patient had significant retention of activity in the recto sigmoid at 72 hours, defined as functional recto sigmoid obstruction . No significant difference was seen in GMC24h between the normal pattern and colonic inertia (P4.053), but GMC48h and GMC72h markedly differed between the two groups (P50.0 16 and 0.025 respectively). 'The mean half clearance time of the two groups was di different (P4.017). Our results are well compatible with scintigraphic diagnostic criteria in different patterns of colonic transit defined by other studies with different radiotracer. Conclusion: oral 67 Ga -citrate colon transit scintigraphy is a feasible method to evaluate idiopathic constipation and seems to be a suitable surrogate for radio-opaque markers. Keywords: oral 67 Ga -citrate, colonic transit study, idiopathic constipation, scintigraphy
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Controlling the transition of an HTGR into equilibrium
International Nuclear Information System (INIS)
Sarychev, V.A.; Dudkin, A.N.; Teuchert, E.
1992-01-01
This paper presents one of the possible methods for controlling a high-temperature reactor in establishing equilibrium burnup conditions, which is based on using a standard fuel element of one kind, and also boron absorbing spheres for compensating the changes in reactivity. Analogous combinations were used in deriving conclusions on the equilibrium regime of the THTR-300. An alternative control method proposes to compensate the change in the reactivity by changing the reactor power. The following basic problems are examined: (1) the possibility of having a transition period for operating the reactor at 100% power at the very beginning; (2) planning reloadings with the use of fuel and absorber elements of one kind; and (3) improving the safety and efficiency characteristics of the reactor during the transition period. The following basic conditions were kept in mind during the investigation: (1) using boron absorber elements as additional absorbers; (2) diluting fuel elements with graphite spheres (dummy elements) to maintain the core volume; (3) using standard fuel elements with 10% enrichment; and (4) a tenfold circulation of fuel elements through the core
Directory of Open Access Journals (Sweden)
Johanna K. Dombrovskis
2014-12-01
Full Text Available Transition metal ion-chelating ordered mesoporous carbon (TM-OMC materials were recently shown to be efficient polymer electrolyte membrane fuel cell (PEMFC catalysts. The structure and properties of these catalysts are largely different from conventional catalyst materials, thus rendering membrane electrode assembly (MEA preparation parameters developed for conventional catalysts not useful for applications of TM-OMC catalysts. This necessitates development of a methodology to incorporate TM-OMC catalysts in the MEA. Here, an efficient method for MEA preparation using TM-OMC catalyst materials for PEMFC is developed including effects of catalyst/ionomer loading and catalyst/ionomer-mixing and application procedures. An optimized protocol for MEA preparation using TM-OMC catalysts is described.
International Nuclear Information System (INIS)
Khazrouni, S.
1985-06-01
Using α-particle and γ-ray spectroscopy, it has been possible to establish the high spin pattern in 215 Fr and propose a decay scheme up to I π = (47/2 + ) containing six isomeric states. These results are interpreted using the recent version of the deformed Woods-Saxon model and the Strutinsky normalisation technique. A similar study in 219 Ac has revealed the existence of two quasi-bands each formed of states of alternating parity and connected by strong E1 transitions. This data for 219 Ac fits better with the stable octupole deformation model, mainly because of the high-spin parity doublets observed for the first time, than with the α-cluster model [fr
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Dynamic Systems Analysis Report for Nuclear Fuel Recycle
Energy Technology Data Exchange (ETDEWEB)
Brent Dixon; Sonny Kim; David Shropshire; Steven Piet; Gretchen Matthern; Bill Halsey
2008-12-01
This report examines the time-dependent dynamics of transitioning from the current United States (U.S.) nuclear fuel cycle where used nuclear fuel is disposed in a repository to a closed fuel cycle where the used fuel is recycled and only fission products and waste are disposed. The report is intended to help inform policy developers, decision makers, and program managers of system-level options and constraints as they guide the formulation and implementation of advanced fuel cycle development and demonstration efforts and move toward deployment of nuclear fuel recycling infrastructure.
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
Energy Transition Initiative: Islands Playbook (Book)
Energy Technology Data Exchange (ETDEWEB)
2015-01-01
The Island Energy Playbook (the Playbook) provides an action-oriented guide to successfully initiating, planning, and completing a transition to an energy system that primarily relies on local resources to eliminate a dependence on one or two imported fuels. It is intended to serve as a readily available framework that any community can adapt to organize its own energy transition effort.
Power Electronic Transformer based Three-Phase PWM AC Drives
Basu, Kaushik
A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
International Nuclear Information System (INIS)
Kobayashi, Hiroaki; Ohta, Hirokazu; Inoue, Tadashi
2009-01-01
Plutonium fissile (Puf) amounts to balance supply and demand during transition period were evaluated with different parameters. Estimated total Puf demand in transitional period was sensitive to deployment speed of FBR. Because FBRs will be deployed as replacements of old LWRs for keeping total capacity, deployment history of existing LWRs should be taken into consideration. According to the estimation, LWR fuel burnup and utilized capacity are not big issue. Because certain amount of LWR spent fuel will remain in early phase of transitional period, there is enough time for preparing Puf supply. On the other hand, FBR fuel cycle time (SF cooling time + fuel fabrication time) have large impact on Puf supply. Fuel cycle technologies including transportation for applying to short cooling spent fuels should be developed. (author)
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Biodiesel fuel management best practices for transit
2007-11-27
Public transportation systems play a key role throughout the country not only in providing vital services to citizens but also in the environmental quality of our communities. Transit systems nationwide are seeking out new technologies in order to in...
The training for nuclear fuel handling at EDF
International Nuclear Information System (INIS)
Marion, J.P.
1999-01-01
The handling of fuel assemblies in a nuclear power plant presents 3 types of work: the taking delivery of fresh fuel, the refueling and the disposal of spent fuel. These operations are realized by teams made up of 3 handling operators and a supervisor. The refueling is made by 3*8-hour teams. These handling operations are important for the nuclear safety, a mishandling can damage the fuel cladding which is the first containment barrier, so a training center (CETIC) has been created. This center was founded in 1986 by EDF and Framatome, the purpose was to validate maintenance procedures, to test handling equipment and to train the teams which work on site. Various training programmes have been set up and a system of qualification degrees has been organized. The CETIC is fitted up with equipment that are full-sized mockups of real installations. Fuel assemblies don't react in a similar way to the different mechanical and neutronic stresses they undergo while they are in the core, they get deformed and the handling operations become more delicate. The mockup fuel assemblies are quite deformed to train the teams and prepare them to face any real situation. (A.C.)
Nuclear fuel pellet loading machine
International Nuclear Information System (INIS)
Dazen, J.R.; Denero, J.V.
1976-01-01
A nuclear fuel pellet loading machine is described including an inclined rack mounted on a base and having parallel spaced grooves on its upper surface arranged to support fuel rods. A fuel pellet tray is adapted to be placed on a table spaced from the rack, the tray having columns of fuel pellets which are in alignment with the open ends of fuel rods located in the rack grooves. A transition plate is mounted between the fuel rod rack and the fuel pellet tray to receive and guide the pellets into the open ends of the fuel rods. The pellets are pushed into the fuel rods by a number of mechanical fingers mounted on a motor operated block which is moved along the pellet tray length by a drive screw driven by the motor. To facilitate movement of the pellets in the fuel rods the rack is mounted on a number of spaced vibrators which vibrate the fuel rods during fuel pellet insertion. A pellet sensing device movable into an end of each fuel rod indicates to an operator when each rod has been charged with the correct number of pellets
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
The household energy transition in India and China
International Nuclear Information System (INIS)
Pachauri, Shonali; Jiang, Leiwen
2008-01-01
Both India and China are countries in energy transition. This paper compares the household energy transitions in these nations through the analysis of both aggregate statistics and nationally representative household surveys. The two countries differ sharply in several respects. Residential energy consumption in China is twice that in India, in aggregate terms. In addition, Chinese households have almost universal access to electricity, while in India almost half of rural households and 10% of urban households still lack access. On aggregate, urban households in China also derive a larger share of their total energy from liquid fuels and grids (77%) as compared to urban Indian households (65%). Yet, at every income level, Indians derive a slightly larger fraction of their total household energy needs from liquid and grid sources of energy than Chinese with comparable incomes. Despite these differences, trends in energy use and the factors influencing a transition to modern energy in both nations are similar. Compared with rural households, urban households in both nations consume a disproportionately large share of commercial energy and are much further along in the transition to modern energy. However, total energy consumption in rural households exceeds that in urban households, because of a continued dependence on inefficient solid fuels, which contribute to over 85% of rural household energy needs in both countries. In addition to urbanisation, key drivers of the transition in both nations include income, energy prices, energy access and local fuel availability. (author)
Enhanced Activated Carbon Cathode Performance for Microbial Fuel Cell by Blending Carbon Black
Zhang, Xiaoyuan; Xia, Xue; Ivanov, Ivan; Huang, Xia; Logan, Bruce E.
2014-01-01
Activated carbon (AC) is a useful and environmentally sustainable catalyst for oxygen reduction in air-cathode microbial fuel cells (MFCs), but there is great interest in improving its performance and longevity. To enhance the performance of AC cathodes, carbon black (CB) was added into AC at CB:AC ratios of 0, 2, 5, 10, and 15 wt % to increase electrical conductivity and facilitate electron transfer. AC cathodes were then evaluated in both MFCs and electrochemical cells and compared to reactors with cathodes made with Pt. Maximum power densities of MFCs were increased by 9-16% with CB compared to the plain AC in the first week. The optimal CB:AC ratio was 10% based on both MFC polarization tests and three electrode electrochemical tests. The maximum power density of the 10% CB cathode was initially 1560 ± 40 mW/m2 and decreased by only 7% after 5 months of operation compared to a 61% decrease for the control (Pt catalyst, 570 ± 30 mW/m2 after 5 months). The catalytic activities of Pt and AC (plain or with 10% CB) were further examined in rotating disk electrode (RDE) tests that minimized mass transfer limitations. The RDE tests showed that the limiting current of the AC with 10% CB was improved by up to 21% primarily due to a decrease in charge transfer resistance (25%). These results show that blending CB in AC is a simple and effective strategy to enhance AC cathode performance in MFCs and that further improvement in performance could be obtained by reducing mass transfer limitations. © 2014 American Chemical Society.
Enhanced Activated Carbon Cathode Performance for Microbial Fuel Cell by Blending Carbon Black
Zhang, Xiaoyuan
2014-02-04
Activated carbon (AC) is a useful and environmentally sustainable catalyst for oxygen reduction in air-cathode microbial fuel cells (MFCs), but there is great interest in improving its performance and longevity. To enhance the performance of AC cathodes, carbon black (CB) was added into AC at CB:AC ratios of 0, 2, 5, 10, and 15 wt % to increase electrical conductivity and facilitate electron transfer. AC cathodes were then evaluated in both MFCs and electrochemical cells and compared to reactors with cathodes made with Pt. Maximum power densities of MFCs were increased by 9-16% with CB compared to the plain AC in the first week. The optimal CB:AC ratio was 10% based on both MFC polarization tests and three electrode electrochemical tests. The maximum power density of the 10% CB cathode was initially 1560 ± 40 mW/m2 and decreased by only 7% after 5 months of operation compared to a 61% decrease for the control (Pt catalyst, 570 ± 30 mW/m2 after 5 months). The catalytic activities of Pt and AC (plain or with 10% CB) were further examined in rotating disk electrode (RDE) tests that minimized mass transfer limitations. The RDE tests showed that the limiting current of the AC with 10% CB was improved by up to 21% primarily due to a decrease in charge transfer resistance (25%). These results show that blending CB in AC is a simple and effective strategy to enhance AC cathode performance in MFCs and that further improvement in performance could be obtained by reducing mass transfer limitations. © 2014 American Chemical Society.
International Nuclear Information System (INIS)
Vasilchenko, I.; Lushin, V.; Ananev, U.; Baranov, A.; Kukushkin, U.
2009-01-01
The problem of increasing the power of units at NPPs with WWER-440 is of current importance. There are all the necessary prerequisites for the above-stated problem as a result of updating the design of fuel assemblies and codes. The decrease of power peaking factor in the core is achieved by using profiled fuel assemblies, fuel-integrated burning absorber, FAs with modernized docking unit, modern codes, which allows decreasing conservatism of RP safety substantiation. A wide range of experimental studies of fuel behaviour has been performed which has reached burn-up of (50-60) MW·day/kgU in transition and emergency conditions, post-reactor studies of fuel assemblies, fuel rods and fuel pellets with a 5-year operating period have been performed, which prove high reliability of fuel, presence of a large margin in the fuel pillar, which helps reactor operation at increased power. The results of the work performed on introduction of 5-6 fuel cycles show that the ultimate fuel state on operability in WWER-440 reactors is far from being achieved. Neutron-physical and thermal-hydraulic characteristics of the cores of working power units with RP V-213 are such that actual (design and measured) power peaking factors on fuel assemblies and fuel rods, as a rule, are smaller than the maximum design values. This factor is a real reserve for power forcing. There is experience of operating Units 1, 2, 4 of the Kola NPP and Unit 2 of the Rovno NPP at increased power. Units of the Loviisa NPP are operated at 109 % power. During transfer to work at increased power it is reasonable to use fuel assemblies with increased height of the fuel pillar, which allows decreasing medium linear power distribution. Further development of the 2-nd generation fuel assembly design and consequent transition to working fuel assemblies of the 3-rd generation provides significant improvement of fuel consumption under the conditions of WWER-440 reactors operation with more continuous fuel cycles and
The California experience : lessons learned and prospects for the future
Energy Technology Data Exchange (ETDEWEB)
Levin, J. [AC Transit, Oakland, CA (United States)
2007-07-01
AC Transit operates 650 hydrogen-powered mass transit buses that serve 1.5 million people in 13 cities in California. This presentation discussed the impact of the buses on public health, quality of life and cost savings. Hydrogen has been touted as a diversified and renewable energy supply that can provide energy independence and reduction in global warming. Mass transit systems have proven to be well suited for testing the limits of hydrogen-powered vehicles primarily because of the centralized fueling and maintenance structure. AC Transit began ZEbus testing in November 1999 and became involved in the California Fuel Cell Partnership in 2000. The NeBus test was performed in 2000, followed by the ISE/UTC Thor Bus in 2003/2004. The governor's inauguration of the zero emission buses was in January 2007. The lessons learned from the California experience were: (1) motivation must be for the right reason, (2) a champion is required, (3) community and political support is required, (4) capital investment is required, (5) a strong management team is required, (6) partners must be chosen wisely, (7) the end user or customer must be allowed to drive the design, (8) inform the public about plans, (9) evaluation is essential to industry-wide application, (10) all resources must be considered for outreach and education, (11) optimism is required to surpass challenges, (12) the technology should be promoted for future generations. The presentation concluded with comments on market value of hydrogen and fuel cell vehicles, their fuel efficiency, reliability and durability. tabs., figs.
FTA fuel cell bus program : research accomplishments through 2011.
2012-03-01
Prepared by the Federal Transit Administration (FTA) Office of Research, Demonstration, and Innovation (TRI), this report summarizes the accomplishments of fuel-cell-transit-bus-related research and demonstrations projects supported by FTA through 20...
A Viable Electrode Material for Use in Microbial Fuel Cells for Tropical Regions
Directory of Open Access Journals (Sweden)
Felix Offei
2016-01-01
Full Text Available Electrode materials are critical for microbial fuel cells (MFC since they influence the construction and operational costs. This study introduces a simple and efficient electrode material in the form of palm kernel shell activated carbon (AC obtained in tropical regions. The novel introduction of this material is also targeted at introducing an inexpensive and durable electrode material, which can be produced in rural communities to improve the viability of MFCs. The maximum voltage and power density obtained (under 1000 Ω load using an H-shaped MFC with AC as both anode and cathode electrode material was 0.66 V and 1.74 W/m3, respectively. The power generated by AC was as high as 86% of the value obtained with the extensively used carbon paper. Scanning electron microscopy and Denaturing Gradient Gel Electrophoresis (DGGE analysis of AC anode biofilms confirmed that electrogenic bacteria were present on the electrode surface for substrate oxidation and the formation of nanowires.
Research at the service of energy transition - Hydrogen and fuel cells
International Nuclear Information System (INIS)
Bodineau, Luc; Antoine, Loic; Tonnet, Nicolas; Theobald, Olivier; Tappero, Denis
2018-03-01
This brochure brings together 22 hydrogen-energy and fuel cell projects selected and supported by the French agency of environment and energy management (Ademe) since 2012 through its call for research projects TITEC (industrial tests and transfers in real conditions) and Sustainable Energy: 1 - BHYKE: electric-hydrogen bike experiment; 2 - CHYMENE: innovative hydrogen compressor for mobile applications; 3 - COMBIPOL 3: bipolar plates assembly technology and gasketing process for PEMFC; 4 - CRONOS: high temperature SOFC for domestic micro-cogeneration; 5 - EPILOG: natural gas fuel cell on the way to commercialization; 6 - EXALAME: polyfunctional catalytic complexes for membranes-electrodes assembly without Nafion for PEMFC; 7 - HYCABIOME: H 2 and CO 2 conversion by biological methanation; 8 - HYLOAD: hydrogen-fueled airport vehicle experiment with on-site supply chain; 9 - HYSPSC: Pressurized hydrogen without Compressor; 10 - HYWAY: hydrogen mobility cluster demonstrator (electric-powered Kangoo cars fleet with range extender) at Lyon and Grenoble; 11 - MHYEL: Pre-industrialization of composite hybrid Membranes for PEM electrolyzer; 12 - NAVHYBUS: Design and experimentation of an electric-hydrogen river shuttle for passengers transportation at Nantes; 13 - PACMONT: fuel cells integration and adaptation for high mountain and polar applications; 14 - PREMHYOME: fabrication process of hybrid membranes for PEMFC; 15 - PRODIG: lifetime prediction and warranty for fuel cell systems; 16 - REHYDRO: fuel cell integration in the circular economy principle; 17 - SPHYNX and Co: optimizing renewable energy integration and self-consumption in buildings; 18 - THEMIS: design and experimentation of an autonomous on-site power supply system; 19 - VABHYOGAZ: biogas valorization through renewable hydrogen generation, design and experimentation of a 5 Nm 3 /h demonstrator at a waste disposal site; 20 - VALORPAC: Integration and experimentation of a high-temperature SOFC system that use
AP1000{sup R} nuclear power plant safety overview for spent fuel cooling
Energy Technology Data Exchange (ETDEWEB)
Gorgemans, J.; Mulhollem, L.; Glavin, J.; Pfister, A.; Conway, L.; Schulz, T.; Oriani, L.; Cummins, E.; Winters, J. [Westinghouse Electric Company LLC, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)
2012-07-01
The AP1000{sup R} plant is an 1100-MWe class pressurized water reactor with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance, safety and costs. The AP1000 design uses passive features to mitigate design basis accidents. The passive safety systems are designed to function without safety-grade support systems such as AC power, component cooling water, service water or HVAC. Furthermore, these passive features 'fail safe' during a non-LOCA event such that DC power and instrumentation are not required. The AP1000 also has simple, active, defense-in-depth systems to support normal plant operations. These active systems provide the first level of defense against more probable events and they provide investment protection, reduce the demands on the passive features and support the probabilistic risk assessment. The AP1000 passive safety approach allows the plant to achieve and maintain safe shutdown in case of an accident for 72 hours without operator action, meeting the expectations provided in the U.S. Utility Requirement Document and the European Utility Requirements for passive plants. Limited operator actions are required to maintain safe conditions in the spent fuel pool via passive means. In line with the AP1000 approach to safety described above, the AP1000 plant design features multiple, diverse lines of defense to ensure spent fuel cooling can be maintained for design-basis events and beyond design-basis accidents. During normal and abnormal conditions, defense-in-depth and other systems provide highly reliable spent fuel pool cooling. They rely on off-site AC power or the on-site standby diesel generators. For unlikely design basis events with an extended loss of AC power (i.e., station blackout) or loss of heat sink or both, spent fuel cooling can still be provided indefinitely: - Passive systems, requiring minimal or no operator actions, are sufficient for at least 72 hours under all
Chen, Guang
2013-09-01
High-performance microbial fuel cell (MFC) air cathodes were constructed using a combination of inexpensive materials for the oxygen reduction cathode catalyst and the electrode separator. A poly(vinyl alcohol) (PVA)-based electrode separator enabled high coulombic efficiencies (CEs) in MFCs with activated carbon (AC) cathodes without significantly decreasing power output. MFCs with AC cathodes and PVA separators had CEs (43%-89%) about twice those of AC cathodes lacking a separator (17%-55%) or cathodes made with platinum supported on carbon catalyst (Pt/C) and carbon cloth (CE of 20%-50%). Similar maximum power densities were observed for AC-cathode MFCs with (840 ± 42 mW/m2) or without (860 ± 10 mW/m2) the PVA separator after 18 cycles (36 days). Compared to MFCs with Pt-based cathodes, the cost of the AC-based cathodes with PVA separators was substantially reduced. These results demonstrated that AC-based cathodes with PVA separators are an inexpensive alternative to expensive Pt-based cathodes for construction of larger-scale MFC reactors. © 2013 Elsevier B.V. All rights reserved.
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
Transition from quasiperiodicity to chaos in a Josephson-junction analog
International Nuclear Information System (INIS)
He, D.; Yeh, W.J.; Kao, Y.H.
1984-01-01
Experimental observations of the transition from quasiperiodicity to chaos are carried out with an electronic Josephson-junction simulator driven by two independent ac sources. A Poincare section shows an invariant ellipse when the frequency ratio of the two input currents is very close to the reciprocal of the golden mean. The system enters a chaotic state at high input-current amplitudes characterized by a breakdown of the smooth ellipse at the onset of transition. Two convergence ratios are experimentally determined, showing good agreement with calculated values obtained by circle map studies
Fuel cycle: the transition between the third and the fourth generation of reactors
International Nuclear Information System (INIS)
2008-01-01
Many challenges arrive today for the french research and development on the fuel cycle: promote the industrial technologies, improve the world increase of the nuclear and adapt the fuel cycle technologies to the future reactors. In this framework the report presents after a recall on the fuel cycle, the researches on the fuel, the optimization of the recycling, the wastes management, the simulation and Phenix an experimentation tool for the fuel. (A.L.B.)
Transition from HEU to LEU fuel in Romania's 14-MW TRIGA reactor
International Nuclear Information System (INIS)
Bretscher, M.M.; Snelgrove, J.L.
1995-01-01
The 14-MW TRIGA steady state reactor (SSR) located in Pitesti, Romania, first went critical in the fall of 1979. Initially, the core configuration for full power operation used 29 fuel clusters each containing a 5 x 5 square array of HEU U (10 wt% - ZrH - Er 2.8 wt%) fuel-moderator rods (1.295 cm o.d.) clad in Incoloy. With a total inventory of 35 HEU fuel clusters, burnup, considerations required a gradual expansion of the core from 29 to 32 and finally to 35 clusters before the reactor was shut down because of insufficient excess reactivity. At this time each of the original 29 fuel clusters had an average 235 U burnup in the range from 50 to 62%. Because of the U.S. policy regarding the export of highly enriched uranium, fresh HEU TRIGA replacement fuel is not available. After a number of safety-related measurements, the SSR is expected to resume full power operation in the near future using a mixed core containing five LEU TRIGA clusters of the same geometry as the original fuel but with fuel-moderator rods containing 45 wt% U (19.7% 235 U enrichment) and 1.1 wt% Er. Rods for 14 additional LEU fuel clusters will be fabricated by General Atomics. In support of the SSR mixed core operation numerous neutronic calculations have been performed. This paper presents some of the results of those calculations. (author)
Yasin, Sk. Mohammad; Srinivas, V.; Kasiviswanathan, S.; Vagadia, Megha; Nigam, A. K.
2018-04-01
In the present study magnetic and electrical transport properties of transition metal substituted Co-Ga alloys (near critical cobalt concentration) have been investigated. Analysis of temperature and field dependence of dc magnetization and ac susceptibility (ACS) data suggests an evidence of reentrant spin glass (RSG) phase in Co55.5TM3Ga41.5 (TM = Co, Cr, Fe, Cu). The magnetic transition temperatures (TC and Tf) are found to depend on the nature of TM element substitution with the exchange coupling strength Co-Fe > Co-Co > Co-Cu > Co-Cr. From magnetization dynamics precise transition temperatures for the glassy phases are estimated. It is found that characteristic relaxation times are higher than that of spin glasses with minimal spin-cluster formation. The RSG behavior has been further supported by the temperature dependence of magnetotransport studies. From the magnetic field and substitution effects it has been established that the magnetic and electrical transport properties are correlated in this system.
Examining hydrogen transitions.
Energy Technology Data Exchange (ETDEWEB)
Plotkin, S. E.; Energy Systems
2007-03-01
This report describes the results of an effort to identify key analytic issues associated with modeling a transition to hydrogen as a fuel for light duty vehicles, and using insights gained from this effort to suggest ways to improve ongoing modeling efforts. The study reported on here examined multiple hydrogen scenarios reported in the literature, identified modeling issues associated with those scenario analyses, and examined three DOE-sponsored hydrogen transition models in the context of those modeling issues. The three hydrogen transition models are HyTrans (contractor: Oak Ridge National Laboratory), MARKAL/DOE* (Brookhaven National Laboratory), and NEMS-H2 (OnLocation, Inc). The goals of these models are (1) to help DOE improve its R&D effort by identifying key technology and other roadblocks to a transition and testing its technical program goals to determine whether they are likely to lead to the market success of hydrogen technologies, (2) to evaluate alternative policies to promote a transition, and (3) to estimate the costs and benefits of alternative pathways to hydrogen development.
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Fact Sheet: Alternative Low-Sulfur Diesel Fuel Transition Program for Alaska
This fact sheet summarizes EPA's final rule modifying the diesel fuel regulations to apply an effective date of 6-1-2010 for 15 ppm sulfur requirements for highway, nonroad, locomotive and marine diesel fuel produced/imported for, distributed
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
Experience with the RE fuel transition at the Studsvik R2 reactor
International Nuclear Information System (INIS)
Pazsit, I.; Saltvedt, K.
1991-01-01
Irradiation of 7 LEU fuel elements is underway in the Studsvik R2 reactor. Four of these have 490 g U-235, and three 320 g U-235 loading, and the enrichment is 19.7% for all of them. The irradiation of LEU fuel started in 1987. The heavier elements have burnup figures 67% (CERCA), 50% (B and W), 47% (NUKEM) and 19% (B and W). One of the lighter elements has reached a burnup of 65%. To support the whole-core conversion process, reactor physical calculations were performed to see if a one-step conversion is possible with a suitable fuel management strategy such that all HEU fuel is burned up. The calculations show that it is possible to perform such a conversion with fuel elements containing 400 g U-235. (orig.)
A resonant ultrasound spectroscopy study of the phase transitions in Na0.75CoO2
Keppens, Veerle; Sergienko, Ivan; Jin, Rongying
2005-03-01
The layered transition metal oxides NaxCoO2 have attracted much interest in the past few years. Crystals with the x˜0.75 composition undergo an order-disorder transition near 340 K, a spin-density-wave transition near 22 K and other subtle transitions at intermediate temperatures. These phase transitions, likely related to a rearrangement of the Na atoms among the available sites, have been mapped out using resonant ultrasound spectroscopy. The results are modeled within the Landau theory for second order phase transitions. [Oak Ridge National Laboratory is managed by UT-Battelle, LLC, for the U.S. Dept. of Energy under contract DE-AC05-00OR22725
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Connecticut nutmeg fuel cell bus project : first analysis report.
2012-07-01
This report summarizes the experience and early results from a fuel cell bus demonstration funded by the Federal Transit Administra-tion (FTA) under the National Fuel Cell Bus Program (NFCBP). A team led by the Northeast Advanced Vehicle Consortium a...
Mixed core conversion study with HEU and LEU fuels
International Nuclear Information System (INIS)
Matos, J.E.; Freese, K.E.
1984-01-01
The results of a mixed core study are presented for gradual replacement of HEU fuel with LEU fuel using the IAEA generic 10 MW reactor as an example. The key parameters show that the transition can be accomplished safely and economically
Boiling transition phenomenon in BWR fuel assemblies effect of fuel spacer shape on critical power
International Nuclear Information System (INIS)
Yamamoto, Yasushi; Morooka, Shin-ichi; Mitsutake, Toru; Yokobori, Seiichi; Kimura, Jiro.
1996-01-01
A thorough understanding of the thermal-hydraulic phenomena near fuel spacer is necessary for the accurate prediction of the critical power of BWR fuel assemblies, and is thus essential for effective developments of a new BWR fuel assembly. The main purpose of this study is to develop an accurate method for predicting the effect of spacer shapes on critical power. Tests have been conducted under actual BWR operating conditions, using an annulus flow channel consisting of a heated rod and circular-tube channel, and BWR simulated 4x4 rod bundles with heater rods unheated just upsteam of spacer. The effect of spacer shapes on critical power was predicted analytically based on the droplet deposition rate estimation. The droplet deposition rate for different spacer shapes was calculated using a single-phase flow model. The prediction results were compared with the test results for the annulus flow channel using ring-type spacers. Analytical results of critical power agreed with measured critical power from point of the effects of changes in the rod-spacer clearance and the spacer thickness on critical power. (author)
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
A Numerical Simulation Of The Pulse Sequence Reconstruction in AC Biased TESs With a β Source
International Nuclear Information System (INIS)
Ferrari, Lorenza; Vaccarone, Renzo
2009-01-01
We study the response of micro-calorimeters based on Ir/Au TESs biased by an AC voltage in the MHz range to the power input generated by beta emission in a Re source thermally connected to the calorimeter itself. The micro-calorimeter is assumed to work at -80 mK, and the energy pulses corresponding to the beta emission have an energy distributed between zero and 2.58 KeV. In this numerical simulation the TES is inserted in a RLC resonating circuit, with a low quality factor. The thermal conductivities between the source and the calorimeter and that from the calorimeter to the heat sink are non-linear. The superconducting to normal transition of the TES is described by a realistic non-linear model. The AC current at the carrier frequency, modulated by the changing resistance of the TES, is demodulated and the output is filtered. The resulting signal is analyzed to deduce the attainable time resolution and the linearity of the response.
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
Czech Academy of Sciences Publication Activity Database
Nejman, L.; Wood, R.; Wright, D.; Lisá, Lenka; Nerudová, Z.; Neruda, P.; Přichystal, A.; Svoboda, Jiří
2017-01-01
Roč. 108, JUL 2017 (2017), s. 131-146 ISSN 0047-2484 Institutional support: RVO:67985831 ; RVO:68081758 Keywords : Middle-Upper Paleolithic transition * chronology * AMH * Neanderthal * Pod Hradem Cave * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology; AC - Archeology, Anthropology, Ethnology (ARUB-Q) OBOR OECD: Environmental sciences (social aspects to be 5.7); Archaeology (ARUB-Q) Impact factor: 3.932, year: 2016
Directory of Open Access Journals (Sweden)
D. J. Vega-Nieva
2018-04-01
Full Text Available Understanding the linkage between accumulated fuel dryness and temporal fire occurrence risk is key for improving decision-making in forest fire management, especially under growing conditions of vegetation stress associated with climate change. This study addresses the development of models to predict the number of 10-day observed Moderate-Resolution Imaging Spectroradiometer (MODIS active fire hotspots—expressed as a Fire Hotspot Density index (FHD—from an Accumulated Fuel Dryness Index (AcFDI, for 17 main vegetation types and regions in Mexico, for the period 2011–2015. The AcFDI was calculated by applying vegetation-specific thresholds for fire occurrence to a satellite-based fuel dryness index (FDI, which was developed after the structure of the Fire Potential Index (FPI. Linear and non-linear models were tested for the prediction of FHD from FDI and AcFDI. Non-linear quantile regression models gave the best results for predicting FHD using AcFDI, together with auto-regression from previously observed hotspot density values. The predictions of 10-day observed FHD values were reasonably good with R2 values of 0.5 to 0.7 suggesting the potential to be used as an operational tool for predicting the expected number of fire hotspots by vegetation type and region in Mexico. The presented modeling strategy could be replicated for any fire danger index in any region, based on information from MODIS or other remote sensors.
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
National Option of China's Nuclear Energy Systems for Spent Fuel Management
Energy Technology Data Exchange (ETDEWEB)
Gao, R.X. [University of Science and Technology, Daejeon (Korea, Republic of); Ko, W. I.; Lee, S. H. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2015-10-15
Along with safety concerns, these long standing environmental challenges are the major factors influencing the public acceptance of nuclear power. Although nuclear power plays an important role in reducing carbon emissions from energy generation, this could not fully prove it as a sustainable energy source unless we find a consensus approach to treat the nuclear wastes. There are currently no countries that have completed a whole nuclear fuel cycle, and the relative comparison of the reprocessing spent fuel options versus direct disposal option is always a controversial issue. Without exception, nowadays, China is implementing many R and D projects on spent fuel management to find a long-term solution for nuclear fuel cycle system transition, such as deep geological repositories for High Level Waste (HLW), Pu Reduction by Solvent Extraction (PUREX) technology, and fast reactor recycling Mixed U-Pu Oxide (MOX) fuels, etc. This paper integrates the current nation's projects of back-end fuel cycle, analyzes the consequences of potential successes, failures and delays in the project development to future nuclear fuel cycle transition up to 2100. We compared the dynamic results of four scenarios and then assessed relative impact on spent fuel management. The result revealed that the fuel cycle transition of reprocessing and recycling of spent fuel would bring advantages to overall nuclear systems by reducing high level waste inventory, saving natural uranium resources, and reducing plutonium management risk.
Directory of Open Access Journals (Sweden)
Peniel Jean Gildo
2018-01-01
Full Text Available Recent technological advancements respond to the call to minimize/eliminate emissions to the atmosphere. However, on the average, fuel oils which is one of the major raw materials, is found to increase in sulfur concentration due to a phenomenon called thermal maturation. As such, a deeper desulfurization process is needed to obtain low/ultra-low sulfur fuel oils. In the present study, the ultrasound assisted oxidative desulfurization (UAOD processes using the H2O2 and HPW-AC oxidizing system applied to simulated fuel (~2800 ppm sulfur in the form of dibenzothiophene, benzothiophene, and thiophene dissolved in toluene, were optimized. After the pre-saturation of the HPW-AC with the simulated fuel, H2O2 was added just before the reaction was commenced under ultrasonic irradiation. After the application of both 2k-factorial design of experiment for screening and Face-Centered Design of Experiment for optimization, it was found that 25.52 wt% of H2O2 concentration, 983.9 mg of catalyst dose, 9.52 mL aqueous phase per 10 mL of the organic phase and 76.36 minutes of ultrasonication time would render 94.74% oxidation of the sulfur compounds in the simulated fuel. After the application of the optimized parameters to kerosene and employing a 4-cycle extraction using acetonitrile, 99% of the original sulfur content were removed from the kerosene using the UAOD optimized parameters. The desulfurization process resulted in a low-sulfur kerosene which retained its basic fuel properties such as density, viscosity and calorific value.
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
International Nuclear Information System (INIS)
Barrett, A.J.; Marquino, W.
2013-01-01
U.S. federal regulations require light water cooled nuclear power plants to cope with Station Blackout for a predetermined amount of time based on design factors for the plant. U.S. regulations define Station Blackout (SBO) as a loss of the offsite electric power system concurrent with turbine trip and unavailability of the onsite emergency AC power system. According to U.S. regulations, typically the coping period for an SBO is 4 hours and can be as long as 16 hours for currently operating BWR plants. Being able to cope with an SBO and loss of all AC power is required by international regulators as well. The U.S. licensing basis for the ESBWR is a coping period of 72 hours for an SBO based on U.S. NRC requirements for passive safety plants. In the event of an extended SBO (viz., greater than 72 hours), the ESBWR response shows that the design is able to cope with the event for at least 7 days without AC electrical power or operator action. ESBWR is a Generation III+ reactor design with an array of passive safety systems. The ESBWR primary success path for mitigation of an SBO event is the Isolation Condenser System (ICS). The ICS is a passive, closed loop, safety system that initiates automatically on a loss of power. Upon Station Blackout or loss of all AC power, the ICS begins removing decay heat from the Reactor Pressure Vessel (RPV) by (i) condensing the steam into water in heat exchangers located in pools of water above the containment, and (ii) transferring the decay heat to the atmosphere. The condensed water is then returned by gravity to cool the reactor again. The ICS alone is capable of maintaining the ESBWR in a safe shutdown condition after an SBO for an extended period. The fuel remains covered throughout the SBO event. The ICS is able to remove decay heat from the RPV for at least 7 days and maintains the reactor in a safe shutdown condition. The water level in the RPV remains well above the top of active fuel for the duration of the SBO event
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
Xiong, Yuan; Chung, Suk-Ho; Cha, Min
2016-01-01
Dynamical and electrical responses of a small coflow diffusion flame were investigated by applying a high-voltage alternating current (AC), to a fuel jet nozzle. High-speed imaging and electrical diagnostics were adopted to capture flame dynamics and electrical signals, such as voltage (V ), frequency (f ) and current (I ). In the V -f domain of 0-5kV and 0-5kHz, AC-driven instabilities, resulting in various flame modes such as an oscillation, pinch-off and spinning of flames were identified. Characteristic frequency of each mode was determined and a visualization of near-nozzle flow structures suggested a close causality of initial counter-rotating vortices (inner and outer toroidal vortices - ITV and OTV), to the other observed flame. An axisymmetric ITV shedding was identified within oscillating and pinch-off modes, while asymmetric ITV shedding was identified with the spinning mode. Integrated electric power over several AC periods correlated well with variation in the flame surface area for these instabilities, demonstrating that measured electric power is a potential indicator of combustion instabilities in electric-field-assisted combustion.
Xiong, Yuan
2016-06-24
Dynamical and electrical responses of a small coflow diffusion flame were investigated by applying a high-voltage alternating current (AC), to a fuel jet nozzle. High-speed imaging and electrical diagnostics were adopted to capture flame dynamics and electrical signals, such as voltage (V ), frequency (f ) and current (I ). In the V -f domain of 0-5kV and 0-5kHz, AC-driven instabilities, resulting in various flame modes such as an oscillation, pinch-off and spinning of flames were identified. Characteristic frequency of each mode was determined and a visualization of near-nozzle flow structures suggested a close causality of initial counter-rotating vortices (inner and outer toroidal vortices - ITV and OTV), to the other observed flame. An axisymmetric ITV shedding was identified within oscillating and pinch-off modes, while asymmetric ITV shedding was identified with the spinning mode. Integrated electric power over several AC periods correlated well with variation in the flame surface area for these instabilities, demonstrating that measured electric power is a potential indicator of combustion instabilities in electric-field-assisted combustion.
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
Estimate of Fuel Consumption and GHG Emission Impact on an Automated Mobility District: Preprint
Energy Technology Data Exchange (ETDEWEB)
Chen, Yuche; Young, Stanley; Gonder, Jeff; Qi, Xuewei
2015-12-11
This study estimates the range of fuel and emissions impact of an automated-vehicle (AV) based transit system that services campus-based developments, termed an automated mobility district (AMD). The study develops a framework to quantify the fuel consumption and greenhouse gas (GHG) emission impacts of a transit system comprised of AVs, taking into consideration average vehicle fleet composition, fuel consumption/GHG emission of vehicles within specific speed bins, and the average occupancy of passenger vehicles and transit vehicles. The framework is exercised using a previous mobility analysis of a personal rapid transit (PRT) system, a system which shares many attributes with envisioned AV-based transit systems. Total fuel consumption and GHG emissions with and without an AMD are estimated, providing a range of potential system impacts on sustainability. The results of a previous case study based of a proposed implementation of PRT on the Kansas State University (KSU) campus in Manhattan, Kansas, serves as the basis to estimate personal miles traveled supplanted by an AMD at varying levels of service. The results show that an AMD has the potential to reduce total system fuel consumption and GHG emissions, but the amount is largely dependent on operating and ridership assumptions. The study points to the need to better understand ride-sharing scenarios and calls for future research on sustainability benefits of an AMD system at both vehicle and system levels.
Some conditions and prospects of transition to closed fuel cycle in Russia
International Nuclear Information System (INIS)
Lependin, A.V.; Oussanov, V.I.; Lependina, E.V.; Ioughai, S.V.
2001-01-01
Nuclear policy of Russia is based on the necessity of closure of nuclear fuel cycle. But at the same time schedule of such a going is not defined. In this study some conditions and possible time-frames of going the nuclear fuel cycle of Russia to closure are discussed. Naturally, the main condition is revival of Russian economy wherein nuclear power will turn to be necessary in a number of Russian regions. But the question is whether closure of nuclear cycle strategy will be implemented in the near future or nuclear power will develop based on open fuel cycle over a long period of time? at present economic circumstances in Russia has formed in such a way that economics of current projects is not favourable to going to closure of cycle due to high capital investment cost and low fuel component of costs, due to low cost of natural uranium. Ecological analysis performed within the framework of external cost model also does not suggest that closed cycle has essential advantages at present, but also in sight. The authors have considered a model including not only external costs but also total resources expenditures with long-term power development. In the framework of such a method it can be demonstrated that closed fuel cycle has some important advantages taking into account not only tasks of immediate future, but power development strategy for the period of 30-50 years. Under conditions of nuclear capacities increase (to 30-50 GW) limitation of cheap uranium resources available in Russia will assume a new significance. Approach of prices at the back-end stages of nuclear fuel cycle to West Europe level also will favour to going to a closed fuel cycle. More severe ecological requirements answering to a sustainable development concept also will make a contribution. Closure of fuel cycle can be significantly accelerated in the case of implementation of weapon plutonium utilization program. The factors mentioned above facilitate evenly to going to a closed nuclear fuel
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
High-Resolution X-Ray Study of a Smectic-A-Smectic-C Phase Transition
DEFF Research Database (Denmark)
Safinya, C. R.; Kaplan, M.; Als-Nielsen, Jens Aage
1980-01-01
We report measurements of the tilt angle Φ and the planar spacing dC near the second-order SmC-SmA transition in 4-n-pentyl-phenylthiol-4′-n-octyloxybenzoate (8S̅ 5). We find that the ratio Φ/invcos(dC/dA) is constant (1.2 ± 0.1) through the C phase, supporting a simple molecular-tilt model...... for the transition. For 5×10-3>1-T/Tc>3×10-5, Φ exhibits mean-field behavior. A simple Ginzburg-criterion argument indicates that the true critical region should be unobservably small for most A-C transitions....
Fuel-to-cladding heat transfer coefficient into reactor fuel element
International Nuclear Information System (INIS)
Lassmann, K.
1979-01-01
Models describing the fuel-to-cladding heat transfer coefficient in a reactor fuel element are reviewed critically. A new model is developed with contributions from solid, fluid and radiation heat transfer components. It provides a consistent description of the transition from an open gap to the contact case. Model parameters are easily available and highly independent of different combinations of material surfaces. There are no restrictions for fast transients. The model parameters are fitted to 388 data points under reactor conditions. For model verification another 274 data points of steel-steel and aluminium-aluminium interfaces, respectively, were used. The fluid component takes into account peak-to-peak surface roughnesses and, approximatively, also the wavelengths of surface roughnesses. For minor surface roughnesses normally prevailing in reactor fuel elements the model asymptotically yields Ross' and Stoute's model for the open gap, which is thus confirmed. Experimental contact data can be interpreted in very different ways. The new model differs greatly from Ross' and Stoute's contact term and results in better correlation coefficients. The numerical algorithm provides an adequate representation for calculating the fuel-to-cladding heat transfer coefficient in large fuel element structural analysis computer systems. (orig.) [de
Janus particle microshuttle: 1D directional self-propulsion modulated by AC electrical field
Directory of Open Access Journals (Sweden)
Jiliang Chen
2014-03-01
Full Text Available A catalytic Janus particle is capable of gaining energy from the surrounding fuel solution to drive itself to move continuously, which has an important impact in different fields, especially the field of micro-systems. However, the randomness of self-propulsion at the microscale restricts its use in practice. Achieving a directed self-propelled movement would greatly promote the application of the Janus particle. We proved experimentally that an AC electric field was an effective way to suppress Brownian motion and control the direction of self-propelled movement. The self-propulsion and dielectrophoretic response of a 2μm Janus particle were observed and the related basic data were collected. Interdigital electrodes, 20 μm in width, were energized in pulsed style to modulate the self-propulsion, which resulted in a shuttle-style motion in which a single Janus particle moved to and fro inside the strip electrode. The change of direction depends on its unique position: the catalyst side is always pointed outward and the orientation angle relative to the electrode is about 60°. Numerical simulation also proved that this position is reasonable. The present study could be beneficial with regard to self-propulsion and AC electrokinetics of the Janus particle.
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
Energy Technology Data Exchange (ETDEWEB)
Durrett, Timothy; Ohlrogge, John; Pollard, Michael
2016-05-03
The present invention relates to novel diacylglycerol acyltransferase genes and proteins, and methods of their use. In particular, the invention describes genes encoding proteins having diacylglycerol acetyltransferase activity, specifically for transferring an acetyl group to a diacylglycerol substrate to form acetyl-Triacylglycerols (ac-TAGS), for example, a 3-acetyl-1,2-diacyl-sn-glycerol. The present invention encompasses both native and recombinant wild-type forms of the transferase, as well as mutants and variant forms. The present invention also relates to methods of using novel diacylglycerol acyltransferase genes and proteins, including their expression in transgenic organisms at commercially viable levels, for increasing production of 3-acetyl-1,2-diacyl-sn-glycerols in plant oils and altering the composition of oils produced by microorganisms, such as yeast, by increasing ac-TAG production. Additionally, oils produced by methods of the present inventions comprising genes and proteins are contemplated for use as biodiesel fuel, in polymer production and as naturally produced food oils with reduced calories.
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
Performance and emissions analysis on using acetone–gasoline fuel blends in spark-ignition engine
Directory of Open Access Journals (Sweden)
Ashraf Elfasakhany
2016-09-01
Full Text Available In this study, new blended fuels were formed by adding 3–10 vol. % of acetone into a regular gasoline. According to the best of the author's knowledge, it is the first time that the influence of acetone blends has been studied in a gasoline-fueled engine. The blended fuels were tested for their energy efficiencies and pollutant emissions using SI (spark-ignition engine with single-cylinder and 4-stroke. Experimental results showed that the AC3 (3 vol.% acetone + 97 vol.% gasoline blended fuel has an advantage over the neat gasoline in exhaust gases temperature, in-cylinder pressure, brake power, torque and volumetric efficiency by about 0.8%, 2.3%, 1.3%, 0.45% and 0.9%, respectively. As the acetone content increases in the blends, as the engine performance improved where the best performance obtained in this study at the blended fuel of AC10. In particular, exhaust gases temperature, in-cylinder pressure, brake power, torque and volumetric efficiency increase by about 5%, 10.5%, 5.2%, 2.1% and 3.2%, respectively, compared to neat gasoline. In addition, the use of acetone with gasoline fuel reduces exhaust emissions averagely by about 43% for carbon monoxide, 32% for carbon dioxide and 33% for the unburnt hydrocarbons. The enhanced engine performance and pollutant emissions are attributed to the higher oxygen content, slight leaning effect, lower knock tendency and high flame speeds of acetone, compared to the neat gasoline. Finally the mechanism of acetone combustion in gasoline-fueled engines is proposed in this work; two main pathways for acetone combustion are highlighted; furthermore, the CO, CO2 and UHC (unburnt hydrocarbons mechanisms of formation and oxidation are acknowledged. Such acetone mechanism is employed for further understanding acetone combustion in spark-ignition engines.
Special aspects of implementing advanced fuel cycles at Kalinin NPP
International Nuclear Information System (INIS)
Tsvetkov, A.
2015-01-01
The presentation showed the experience of different TVSA modifications usage at Kalinin NPP. The strategy of 18 month fuel cycles implementation at uprated power (104%) was also presented. The transition and equilibrium fuel loadings features were discussed. The implementation of burn-up measurement installation MKS-01 was presented, in order to solve the spent nuclear fuel handling and transportation issues due to the increased fuel enrichment and heavy metal mass
Transit of solids through the human colon: Regional quantification in the unprepared bowel
International Nuclear Information System (INIS)
Proano, M.; Camilleri, M.; Phillips, S.F.; Brown, M.L.; Thomforde, G.M.
1990-01-01
We used a noninvasive method to label the solid phase of contents in the unprepared human colon. 111 In-labeled Amberlite pellets (0.5-1.8 mm diam) were placed in a gelatin capsule that was then coated with a pH-sensitive polymer (methacrylate). In vitro, the capsules disintegrated in simulated small bowel contents within 1-2 h; when ingested by healthy subjects, capsules released radiolabel in the distal ileum or proximal colon in 13 of 15 subjects. Transit of 111 In-pellets through the unprepared colon could then be quantitated radioscintigraphically. Segmental transit was defined in the ascending (AC), transverse (TC), descending (DC), and rectosigmoid (RS) colon. Radioactivity was also quantitated in stools. At 12 h, radioactivity was most obvious in the AC (59 +/- 11%, mean +/- SE) and the TC (21 +/- 6%); at 24 h, counts were distributed equally between AC, TC, and stools (P greater than 0.05); by 48 h, 56 +/- 11% counts had been excreted, although 30 +/- 10% remained in the TC. At 24 and 48 h, the amount in DC or RS was lower (P less than 0.05) than in the TC or in stools. Emptying of the AC was characterized by an initial lag period, when no counts emptied into the TC, followed by a period of emptying that was approximately linear. Thus this simple approach is able to label contents in the healthy human colon. The ascending and transverse colon appear to be sites of storage of solid residue, whereas the left colon and rectosigmoid function mainly as conduits
Model and algorithm for bi-fuel vehicle routing problem to reduce GHG emissions.
Abdoli, Behroz; MirHassani, Seyed Ali; Hooshmand, Farnaz
2017-09-01
Because of the harmful effects of greenhouse gas (GHG) emitted by petroleum-based fuels, the adoption of alternative green fuels such as biodiesel and compressed natural gas (CNG) is an inevitable trend in the transportation sector. However, the transition to alternative fuel vehicle (AFV) fleets is not easy and, particularly at the beginning of the transition period, drivers may be forced to travel long distances to reach alternative fueling stations (AFSs). In this paper, the utilization of bi-fuel vehicles is proposed as an operational approach. We present a mathematical model to address vehicle routing problem (VRP) with bi-fuel vehicles and show that the utilization of bi-fuel vehicles can lead to a significant reduction in GHG emissions. Moreover, a simulated annealing algorithm is adopted to solve large instances of this problem. The performance of the proposed algorithm is evaluated on some random instances.
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
Surface roughness effect on the metallic bipolar plates of a proton exchange membrane fuel cell
International Nuclear Information System (INIS)
Lin, Chien-Hung
2013-01-01
Highlights: ► Various degrees of roughness are caused by the sandblasting method. ► An improper surface modification depletes the PEMFC performance severely. ► The AC impedance are used to assess the fuel gas transfer effect. ► The Warburg resistance form in the coarse flow channel surface. - Abstract: Proton exchange membrane fuel cells (PEMFCs) is a promising candidate as energy systems. However, the stability and lifetime of cells are still important issues. The effect of surface roughness on metallic bipolar plate is discussed in this paper. Various roughness on the bulk surface are obtained by the sandblasting method. The grain sizes of sand are selected as 50, 100 and 200 μm. The Ac impedance experiment results show that the bipolar plate roughness and carbon paper porosity are well matched when the surface roughness is within 1–2 μm. Superior condition decreases the contact resistance loss in the fuel cell. The high frequency resistance of the coarse surface was larger than that of the substrate by around 5 mΩ. Furthermore, a new arc was formed at the low frequency region. Hence, the unmatch roughness condition of the bipolar plate significantly increases the contact resistance and mass transfer resistance. This paper develops a sequential approach to study an optimum surface roughness by combining the whole performance (I–V) curve and AC impedance result. It benefits us to quantify the contact and mass transfer resistance exists in the PEMFC. The proposed surface treatment improves the surface effect and promotes the implement of potential metallic bipolar plate in near future
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
DEFF Research Database (Denmark)
2010-01-01
The solid oxide fuel cell comprising a metallic support material, an active anode layer consisting of a good hydrocarbon cracking catalyst, an electrolyte layer, an active cathode layer, and a transition layer consisting of preferably a mixture of LSM and a ferrite to the cathode current collector...
International Nuclear Information System (INIS)
Pany, Premananda; Singh, R.K.; Tripathi, R.K.
2016-01-01
Highlights: • Load current sharing in FC and battery fed dc drive. • Active current sharing control using LabVIEW. • Detail hardware implementation. • Controller performance is verified through MATLAB simulation and experimental results. - Abstract: In order to reduce the stress on fuel cell based hybrid source fed electric drive system the controller design is made through active current sharing (ACS) technique. The effectiveness of the proposed ACS technique is tested on a dc drive system fed from fuel cell and battery energy sources which enables both load current sharing and source power management. High efficiency and reliability of the hybrid system can be achieved by proper energy conversion and management of power to meet the load demand in terms of required voltage and current. To overcome the slow dynamics feature of FC, a battery bank of adequate power capacity has to be incorporated as FC voltage drops heavily during fast load demand. The controller allows fuel cell to operate in normal load region and draw the excess power from battery. In order to demonstrate the performance of the drive using ACS control strategy different modes of operation of the hybrid source with the static and dynamic behavior of the control system is verified through simulation and experimental results. This control scheme is implemented digitally in LabVIEW with PCI 6251 DAQ I/O interface card. The efficacy of the controller performance is demonstrated in system changing condition supplemented by experimental validation.
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-03-01
This report summarizes work performed under U.S. Department of Energy, Morgantown Energy Technology Center (DOE/METC) Contract DE-AC-90MC27168 for September 1990 through March 1995. Energy Research Corporation (ERC), with support from DOE, EPRI, and utilities, has been developing a carbonate fuel cell technology. ERC`s design is a unique direct fuel cell (DFC) which does not need an external fuel reformer. An alliance was formed with a representative group of utilities and, with their input, a commercial entry product was chosen. The first 2 MW demonstration unit was planned and construction begun at Santa Clara, CA. A conceptual design of a 10OMW-Class dual fuel power plant was developed; economics of natural gas versus coal gas use were analyzed. A facility was set up to manufacture 2 MW/yr of carbonate fuel cell stacks. A 100kW-Class subscale power plant was built and several stacks were tested. This power plant has achieved an efficiency of {approximately}50% (LHV) from pipeline natural gas to direct current electricity conversion. Over 6,000 hours of operation including 5,000 cumulative hours of stack operation were demonstrated. One stack was operated on natural gas at 130 kW, which is the highest carbonate fuel cell power produced to date, at 74% fuel utilization, with excellent performance distribution across the stack. In parallel, carbonate fuel cell performance has been improved, component materials have been proven stable with lifetimes projected to 40,000 hours. Matrix strength, electrolyte distribution, and cell decay rate have been improved. Major progress has been achieved in lowering stack cost.
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Power generation using an activated carbon and metal mesh cathode in a microbial fuel cell
Zhang, Fang
2009-11-01
An inexpensive activated carbon (AC) air cathode was developed as an alternative to a platinum-catalyzed electrode for oxygen reduction in a microbial fuel cell (MFC). AC was cold-pressed with a polytetrafluoroethylene (PTFE) binder to form the cathode around a Ni mesh current collector. This cathode construction avoided the need for carbon cloth or a metal catalyst, and produced a cathode with high activity for oxygen reduction at typical MFC current densities. Tests with the AC cathode produced a maximum power density of 1220 mW/m2 (normalized to cathode projected surface area; 36 W/m3 based on liquid volume) compared to 1060 mW/m2 obtained by Pt catalyzed carbon cloth cathode. The Coulombic efficiency ranged from 15% to 55%. These findings show that AC is a cost-effective material for achieving useful rates of oxygen reduction in air cathode MFCs. © 2009 Elsevier B.V. All rights reserved.
An ac susceptibility study in capped Ni/Ni(OH)2 core-shell nanoassemblies: dual peak observations
International Nuclear Information System (INIS)
Godsell, Jeffrey F; Roy, Saibal; Bala, Tanushree; Ryan, Kevin M.
2011-01-01
In this study, the ac susceptibility (χ' and χ'') variation with temperature (10-100 K) for oleic acid (OA) capped Ni/Ni(OH) 2 core-shell nanoparticle assemblies are reported at frequencies varying from 0.1 to 1000 Hz. Nanoparticle assemblies, with two average particle diameters of ∼34 nm and ∼14 nm, were synthesized using a wet chemical synthesis approach. Two peaks in the ac susceptibility versus temperature curves are clearly discernable for each of the samples. The first, occurring at ∼22 K was attributed to the paramagnetic/antiferromagnetic transition of the Ni(OH) 2 present in the shell. The second higher temperature peak was attributed to the superparamagnetic blocking of the pure Ni situated at the core of the nanoparticles. The higher temperature peaks in both the χ' and χ'' curves were observed to increase with increasing frequency. Thus the Neel and the blocking temperatures for such core-shell nanoassemblies were clearly identified from the ac analysis, whereas they were not discernible (superimposed) even from very low dc (FC/ZFC) field measurements. Interparticle interactions within the assemblies were studied through the fitting of phenomenological laws to the experimental datasets. It is observed that even with an OA capping layer, larger Ni/Ni(OH) 2 nanoparticles experience a greater degree of sub-capping layer oxidation thus producing lower magnetic interaction strengths.
Advanced DC/AC inverters applications in renewable energy
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
Spent Nuclear Fuel (SNF) Removal Campaign Plan
International Nuclear Information System (INIS)
PAJUNEN, A.L.
2000-01-01
The overall operation of the Spent Nuclear Fuel Project will include fuel removal, sludge removal, debris removal, and deactivation transition activities. Figure 1-1 provides an overview of the current baseline operating schedule for project sub-systems, indicating that a majority of fuel removal activities are performed over an approximately three-and-one-half year time period. The purpose of this document is to describe the strategy for operating the fuel removal process systems. The campaign plan scope includes: (1) identifying a fuel selection sequence during fuel removal activities, (2) identifying MCOs that are subjected to extra testing (process validation) and monitoring, and (3) discussion of initial MCO loading and monitoring in the Canister Storage Building (CSB). The campaign plan is intended to integrate fuel selection requirements for handling special groups of fuel within the basin (e.g., single pass reactor fuel), process validation activities identified for process systems, and monitoring activities during storage
A New Green Power Inverter for Fuel Cells
DEFF Research Database (Denmark)
Andersen, Gert Karmisholt; Klumpner, Christian; Kjær, Søren Bækhøj
2002-01-01
This paper presents a new grid connected inverter for fuel cells. It consists of a two stage power conversion topology. Since the fuel cell operates with a low voltage in a wide voltage range (25 V-45 V) this volt- age must be transformed to around 350-400 V in order to invert this dc power into ac...... power to the grid. The proposed converter consists of an isolated dc-dc converter cascaded with a single phase H-bridge inverter. The dc-dc converter is a current-fed push-pull converter. A new dedicated voltage mode startup procedure has been developed in order to limit the inrush current during...... startup. The inverter is controlled as a power factor controller with resistor emulation.Experimental results of converter efficiency, grid performance and fuel cell response are shown for a 1 kW prototype. The proposed converter exhibits a high efficiency in a wide power range (higher than 92...
A single-phase embedded Z-source DC-AC inverter.
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
Modeling Fuel Choice among Households in Northern Cameroon
Directory of Open Access Journals (Sweden)
Jean Hugues Nlom
2015-07-01
Full Text Available The present study aims to explore economic and socio-demographic factors that influence a household’s probability to switch from firewood to cleaner fuels (kerosene and LPG in northern Cameroon. The paper employs an ordered probit model to construct cooking patterns and fuel choices. Three main cooking sources are considered: firewood, kerosene, and liquefied petroleum gas. Utilized data are derived from a national survey conducted in 2004 by the Cameroonian National Institute of Statistics. The study analyzes the data related to the Sudano-Sahelian agro-ecological zone, which is one of the most affected by land degradation and decertification. While results indicate that there is a potential for a transition from traditional to cleaner fuels in the studied region, this transition is still in its earlier stage. The research demonstrates that firewood and kerosene prices, age of household heads, educational level of household heads and willingness to have a gas cylinder, as well as type of dwelling have a statistically significant impact on fuel-switching decisions.
Global Nuclear Fuel launches GNF{sub 3} and NSF: The most reliable BWR fuel just got better
Energy Technology Data Exchange (ETDEWEB)
Cantonwine, P.; Schneider, R.; Hunt, B.
2015-11-01
Bases on evolutionary design changes and advanced technology developed by Global Nuclear Fuel (GNF), the GNF3 fuel assembly is designed to offer customers with improved fuel economics, increased performance and flexibility in operation while maintaining the superior reliability of GNF2, the most reliable design in GNFs history. In addition to improved fuel utilization and performance, GNF3 is designed and manufactured to be more resistant to debris capture, to eliminate channel control blade interference concerns, and to exhibit to best available corrosion resistance of any boiling water reactor fuel. While delivering fuel cycle savings and reliability benefits with GNF3, GNF maintains a similar licensing and operating basis to GNF2, thereby minimizing fuel transition risks. GNF3 is available in lead use assembly quantities to customers today. Eight GNF3 lead use assemblies are in operation at two utilities in the USA GNF3 is scheduled to be available for full reloads in 2018. (Author)
Lineshape-asymmetry elimination in weak atomic transitions driven by an intense standing wave field
Antypas, Dionysios; Fabricant, Anne; Budker, Dmitry
2018-05-01
Owing to the ac-Stark effect, the lineshape of a weak optical transition in an atomic beam can become significantly distorted, when driven by an intense standing wave field. We use an Yb atomic beam to study the lineshape of the 6s2 1S0 -> 5d6s 3D1 transition, which is excited with light circulating in a Fabry-Perot resonator. We demonstrate two methods to avoid the distortion of the transition profile. Of these, one relies on the operation of the resonator in multiple longitudinal modes, and the other in multiple transverse modes.
International Nuclear Information System (INIS)
Ramírez, Juan Gabriel; Basaran, Ali C; De la Venta, J; Pereiro, Juan; Schuller, Ivan K
2014-01-01
This article introduces magnetic field modulated microwave spectroscopy (MFMMS) as a unique and high-sensitivity technique for use in the search for new superconductors. MFMMS measures reflected microwave power as a function of temperature. The modulation induced by the external ac magnetic field enables the use of phase locked detection with the consequent sensitivity enhancement. The MFMMS signal across several prototypical structural, magnetic, and electronic transitions is investigated. A literature review on microwave absorption across superconducting transitions is included. We show that MFMMS can be used to detect superconducting transitions selectively with very high sensitivity. (report on progress)
Zarkevich, Nikolai A.; Johnson, Duane D.
2015-03-01
Materials under pressure may exhibit critical electronic and structural transitions that affect equation of states, as known for superconductors and the magneto-structural transformations of iron with both geophysical and planetary implications. While experiments often use constant-pressure (diamond-anvil cell, DAC) measurements, many theoretical results address a constant-volume transitions, which avoid issues with magnetic collapse but cannot be directly compared to experiment. We establish a modified solid-state nudge elastic band (MSS-NEB) method to handle magnetic systems that may exhibit moment (and volume) collapse during transformation. We apply it to the pressure-induced transformation in iron between the low-pressure body-centered cubic (bcc) and the high-pressure hexagonal close-packed (hcp) phases, find the bcc-hcp equilibrium coexistence pressure and a transitional pathway, and compare to shock and DAC experiments. We use methods developed with support by the U.S. Department of Energy (DE-FG02-03ER46026 and DE-AC02-07CH11358). Ames Laboratory is operated for the DOE by Iowa State University under contract DE-AC02-07CH11358.
Transition phase in LMFBR hypothetical accidents
International Nuclear Information System (INIS)
Ostensen, R.W.; Henninger, R.J.; Jackson, J.F.
1976-01-01
Mechanistic analyses of transient-under-cooling accidents have led in some cases to a mild initiating phase instead of a direct hydrodynamic disassembly of the core. The fuel is then trapped in the core by the strong mechanical surroundings and blockages formed by refrozen cladding steel and/or fuel. The formation of fuel blockages has been verified experimentally. The bottled-up core will boil on fission and decay heat, with steel as the working fluid. Boil-up in a churn turbulent flow regime may prevent recriticality due to fuel recompaction. Ultimate fuel removal from the core is probably by a two-phase blow-down after permanent leakage paths are opened. However, a vigorous recriticality can not be precluded. Reactors with void coefficients larger than that in CRBR are more likely to disassemble in the initiating phase, so the transition phase may be unique to small cores
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
A mixed core conversion study with HEU and LEU fuels
International Nuclear Information System (INIS)
Matos, J.E.; Freese, K.E.
1985-01-01
The results of a mixed core study are presented for gradual replacement of HEU fuel with LEU fuel using the IAEA generic 10 MW reactor as an example. The key parameters show that the transition can be accomplished safely and economically. (author)
Slightly enriched uranium fuel for a PHWR
International Nuclear Information System (INIS)
Notari, C.; Marajofsky, A.
1997-01-01
An improved fuel element design for a PHWR using slightly enriched uranium fuel is presented. It maintains the general geometric disposition of the currently used in the argentine NPP's reactors, replacing the outer ring of rods by rods containing annular pellets. Power density reduction is achieved with modest burnup losses and the void volume in the pellets can be used to balance these two opposite effects. The results show that with this new design, the fuel can be operated at higher powers without violating thermohydraulic limits and this means an improvement in fuel management flexibility, particularly in the transition from natural uranium to slightly enriched uranium cycle. (author)
TECHNOLOGICAL CHANGE during the ENERGY TRANSITION
van der Meijden, Gerard; Smulders, Sjak
2018-01-01
The energy transition from fossil fuels to alternative energy sources has important consequences for technological change and resource extraction. We examine these consequences by incorporating a nonrenewable resource and an alternative energy source in a market economy model of endogenous growth
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
Energy Technology Data Exchange (ETDEWEB)
NREL
2000-03-27
This issue of Alternative Fuel News contains information on the upcoming Clean Cities Conference to be held May 7--10, 2000 in San Diego, California. Highlighted in this issue is the success of the Clean Cities Program in creating clean corridors that permit fleets that serve multiple cities to purchase AFVs with confidence, knowing that fueling convenience and supply will not be a problem. Also look for articles on electric vehicles, transit buses; state and fuel provider enforcement; the Salt Lake and Greater Long Island Clean Cities coalitions, HEVs and fuel cells are a big hit at auto shows; DOE awards alternative fuel grants to 33 National Parks; and the Energy Policy Act (EPAct) Section 506 report.
Modeling of the thermo-mechanical behaviour of the PWR fuel
International Nuclear Information System (INIS)
Mailhe, P.
2014-01-01
This article reviews the various physical phenomena that take place in an irradiated fuel rod and presents the development of the thermo-mechanical codes able to simulate them. Though technically simple the fuel rod is the place where appear 4 types of process: thermal, gas behaviour, mechanical and corrosion that combine involving 5 elements: the fuel pellet, the fuel clad, the fuel-clad gap, the inside volume and the coolant. For instance the pellet is the place where the following mechanical processes took place: thermal dilatation, elastic deformation, creep deformation, densification, solid swelling, gaseous swelling and cracking. The first industrial code simulating the behaviour of the fuel rod was COCCINEL, it was developed by AREVA teams from the American PAD code that was included in the Westinghouse license. Today the GALILEO code has replaced the COPERNIC code that was developed in the beginning of the 2000 years. GALILEO is a synthesis of the state of the art of the different models used in the codes validated for PWR and BWR. GALILEO has been validated on more than 1500 fuel rods concerning PWR, BWR and specific reactors like Siloe, Osiris, HFR, Halden, Studsvik, BR2/3,...) and also for extended burn-ups. (A.C.)
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
Magnetic ordering and spin-reorientation transitions in TbCo3B2
International Nuclear Information System (INIS)
Dubman, Moshe; Caspi, El'ad N.; Ettedgui, Hanania; Keller, Lukas; Melamud, Mordechai; Shaked, Hagai
2005-01-01
The magnetic structure of the compound TbCo 3 B 2 has been studied in the temperature range 1.5 K≤T≤300 K by means of neutron powder diffraction, magnetization, magnetic ac susceptibility, and heat capacity measurements. The compound is of hexagonal symmetry and is paramagnetic at 300 K, undergoes a magnetic Co-Co ordering transition at ∼170 K, and a second magnetic Tb-Tb ordering transition at ∼30 K. The latter induces a spin-reorientation transition, in which the magnetic axis rotates from the c axis toward the basal plane. Below this transition a symmetry decrease (γ magnetostriction) sets in, leading to an orthorhombic distortion of the crystal lattice. The crystal and magnetic structures and interactions and their evolution with temperature are discussed using a microscopic physical model
On the origin of the double superconducting transition in overdoped YBa2Cu3O x
International Nuclear Information System (INIS)
Lortz, R.; Tomita, T.; Wang, Y.; Junod, A.; Schilling, J.S.; Masui, T.; Tajima, S.
2006-01-01
The superconducting transition in a single overdoped, detwinned YBa 2 Cu 3 O x (YBCO) crystal is studied using four different probes. Whereas the AC and DC magnetic susceptibilities find a dominant transition at 88 K with a smaller effect near 92 K, the specific heat and electrical resistivity reveal only a single transition at 88 K and 92 K, respectively. Under hydrostatic pressures to 0.60 GPa these two transitions shift in opposite directions, their separation increasing. The present experiments clearly show that the bulk transition lies at 88 K and originates from fully oxygenated YBCO; the 92 K transition likely arises from filamentary superconductivity in a minority optimally doped phase (<1%) of YBCO located at or near the crystal surface
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
Tracking costs of alternatively fueled buses in Florida - phase II.
2013-04-01
The goal of this project is to continue collecting and reporting the data on the performance and costs of alternatively fueled public transit vehicles in the state in a consistent manner in order to keep the Bus Fuels Fleet Evaluation Tool (BuFFeT) c...
Characterization of the 309 building fuel transfer pit and storage basin
International Nuclear Information System (INIS)
Hale, N.S.
1998-01-01
This document identifies radiological, chemical and physical conditions inside the Fuel Transfer Pit and Fuel Storage Basins. These spaces are located inside the Plutonium Recycle Test Reactor structure (309 Building.) The fuel handling and storage feature of the PRTR were primarily located in these spaces. The conditions were assessed as part of overall 309 Building transition
El-Bashir, S. M.; Alwadai, N. M.; AlZayed, N.
2018-02-01
Polymer nanocomposite films were prepared by doping fullerene C60 in polymer blend composed of polymethacrylate/polyvinyl acetate blends (PMMA/PVAc) using solution cast technique. The films were characterized by differential scanning calorimeter (DSC), Transmission electron microscope (TEM), DC/AC electrical conductivity and dielectric measurements in the frequency range (100 Hz- 1 MHz). The glass transition temperature, Tg, was increased by increasing the concentration of fullerene C60; this property reflects the increase of thermal stability by increasing the nanofiller content. The DC and AC electrical conductivities were enhanced by increasing C60 concentration due to the electron hopping or tunneling between filled and empty localized states above Tg. The relaxation time was determined from the αβ -relaxations and found to be attenuated by increasing the temperature as a typical behavior of amorphous polymers. The calculated values of thermodynamic parameters revealed the increase of molecular stability by increasing the doping concentration; this feature supports the application of PMMA/PVAc/C60 nanocomposite films in a wide scale of solar energy conversion applications such as luminescent down-shifting (LDS) coatings for photovoltaic cells.
Lohani, S.; Heilman, P.; deSteiguer, J. E.; Guertin, D. P.; Wissler, C.; McClaran, M. P.
2014-12-01
Quantifying ecosystem services is a crucial topic for land management decision making. However, market prices are usually not able to capture all the ecosystem services and disservices. Ecosystem services from rangelands, that cover 70% of the world's land area, are even less well-understood since knowledge of rangelands is limited. This study generated a management framework for rangelands that uses remote sensing to generate state and transition models (STMs) for a large area and a linear programming (LP) model that uses ecosystem services to evaluate natural and/or management induced transitions as described in the STM. The LP optimization model determines the best management plan for a plot of semi-arid land in the Empire Ranch in southeastern Arizona. The model allocated land among management activities (do nothing, grazing, fire, and brush removal) to optimize net benefits and determined the impact of monetizing environmental services and disservices on net benefits, acreage allocation and production output. The ecosystem services under study were forage production (AUM/ac/yr), sediment (lbs/ac/yr), water runoff (inches/yr), soil loss (lbs/ac/yr) and recreation (thousands of number of visitors/ac/yr). The optimization model was run for three different scenarios - private rancher, public rancher including environmental services and excluding disservices, and public rancher including both services and disservices. The net benefit was the highest for the public rancher excluding the disservices. A result from the study is a constrained optimization model that incorporates ecosystem services to analyze investments on conservation and management activities. Rangeland managers can use this model to understand and explain, not prescribe, the tradeoffs of management investments.
Technological Change during the Energy Transition
van der Meijden, G.C.; Smulders, J.A.
2014-01-01
The energy transition from fossil fuels to alternative energy sources has important consequences for technological change and resource extraction. We examine these consequences by incorporating a non-renewable resource and an alternative energy source in a market economy model of endogenous growth
Technological Change During the Energy Transition
van der Meijden, G.C.; Smulders, Sjak A.
2014-01-01
The energy transition from fossil fuels to alternative energy sources has important consequences for technological change and resource extraction. We examine these consequences by incorporating a non-renewable resource and an alternative energy source in a market economy model of endogenous growth
7 CFR 1737.31 - Area Coverage Survey (ACS).
2010-01-01
... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...
Pressure dependence of the superconducting transition temperature of Rb3C60 up to 20 kbar
International Nuclear Information System (INIS)
Bud'ko, S.L.; Meng, R.L.; Chu, C.W.; Hor, P.H.
1991-01-01
AC susceptibility measurements of Rb 3 C 60 under hydrostatic pressure up to 20 kbar are reported. The superconducting transition temperature (T c ) decreases linearly under pressure with the pressure derivative dT c /dP = -0.78 K degrees/kbar
Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers
Directory of Open Access Journals (Sweden)
Abdul Sattar Larik
2011-01-01
Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.
Natural Resource Canada`s fuel cell R and D program
Energy Technology Data Exchange (ETDEWEB)
Hammerli, M; Beck, N R [Natural Resources Canada, Ottawa, ON (Canada)
1998-05-01
The rationale for focusing fuel cell technology on the Ballard Proton exchange Membrane (PEM) system is provided. As well, research into other fuel cell types supported by Natural Resources Canada are discussed. Fuel cells are electrochemical devices that convert a fuel and an oxidant directly into electricity. Five fuel cell technologies use hydrogen as the fuel: (1) the alkaline fuel cell (AFC), (2) the proton exchange membrane fuel cell (PEMFC), (3) the phosphoric acid fuel cell (PAFC), (4) the molten carbonate fuel cell (MCFC), and (5) the solid oxide fuel cell (SOFC). The PEMFC is suitable for transportation applications because it does not contain a liquid electrolyte and it operates at about 80 degrees C. Trials on municipal bus systems are currently underway in Vancouver and Chicago. PEMFC stacks are supplied by Ballard Power Systems of Burnaby, BC, a recognized world leader in PEMFC technology. Daimler-Benz is demonstrating the methanol reformer on its NECAR-3, powered with a Ballard PEMFC. Ballard is also designing and producing two prototype fuel cell engines for the Ford Motor Company which will integrate them into its P2000 prototype vehicle platform. The Ballard technology is also suitable for distributed power generation up to about five MW, as well as for cogeneration, when fuelled with natural gas. Stuart Energy Systems (SES) has developed an advanced UNICELL-CLUSTER{sup T}M, which permits a direct coupling of the PV array to the electrolyser, a project which demonstrates the use of solar-electrolytic hydrogen production. SES is also designing a refuelling system for the BC Transit System in Vancouver for refuelling their three Zero Emission urban transit buses powered by Ballard fuel cell engines.
New techniques for the characterization of refuse-derived fuels and solid recovered fuels.
Rotter, Vera Susanne; Lehmann, Annekatrin; Marzi, Thomas; Möhle, Edda; Schingnitz, Daniel; Hoffmann, Gaston
2011-02-01
Solid recovered fuel (SRF) today refers to a waste-derived fuel meeting defined quality specifications, in terms of both origin (produced from non-hazardous waste) and levels of certain fuel properties. Refuse-derived fuel (RDF) nowadays is more used for unspecified waste after a basic processing to increase the calorific value and therefore this term usually refers to the segregated, high calorific fraction of municipal solid waste (MSW), commercial or industrial wastes. In comparison with conventional fuels, both types of secondary fuel show waste of inherently varying quality and an increased level of waste-specific contaminants.The transition from RDF to SRF in the emerging national and European market requires a quality assurance system with defined quality parameters and analytical methods to ensure reliable fuel characterization. However, due to the quality requirements for RDF and SRF, the current standardized analysis methods often do not meet these practical demands. Fast test methods, which minimize personnel, financial and time efforts and which are applicable for producers as well as users can be an important supporting tool for RDF- and SRF-characterization. Currently, a fast test system based on incineration and correlation analyses which enable the determination of relevant fuel parameters is under development. Fast test methods are not aimed at replacing current standardized test methods, but have to be considered as practical supporting tools for the characterization of RDF and SRF.
Fuel management at Washington State Ferries
International Nuclear Information System (INIS)
Brodeur, P.; Olds, J.
2008-01-01
This presentation discussed Washington State Ferry (WSF) operations and provided details of a biodiesel research and demonstration project. Washington has the largest ferry system in the United States, with a total of 28 vessels that operate on 10 routes through 20 terminals. Routes vary by transit times, navigational challenges, and the proximity to population centres. WSF fuel and emissions management initiatives include exhaust emission studies, clean fuel initiatives, machinery upgrades, fuel conservation initiatives, and biodiesel testing. The organization is also using waste heat recovery and a positive restraint system. The WSF biodiesel pilot program was conducted using soy-derived fuels with a purifier disk stack. The program is in agreement with recent legislation requiring that 2 per cent of annual diesel fuel sales are from biodiesel fuels, and state legislation requiring that state agencies use a minimum of 20 per cent biodiesel blends in diesel-powered vessels and vehicles. Details of project partnerships were included. tabs., figs
Importance of Attenuation Correction (AC) for Small Animal PET Imaging
DEFF Research Database (Denmark)
El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær
2012-01-01
was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...
THE ACS NEARBY GALAXY SURVEY TREASURY
International Nuclear Information System (INIS)
Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.
2009-01-01
The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
The impact of the household decision environment on fuel choice behavior
van der Kroon, B.; Brouwer, R.; van Beukering, P.J.H.
2014-01-01
Consumer preferences for fuels and alternative cookstove technologies in Kenya are examined, focusing on household internal and external determinants driving choice behavior in a choice experiment. The potential for a transition towards cleaner and more efficient fuels and technologies is assessed
Analysis of DC/DC Converter Efficiency for Energy Storage System Based on Bidirectional Fuel Cells
DEFF Research Database (Denmark)
Pittini, Riccardo; Zhang, Zhe; Andersen, Michael A. E.
2013-01-01
interface to the grid. In power electronics, the converter efficiency is characterized at fixed operating voltage for various output power. This type of characterization is not suitable for fuel cells, since as the power from the fuel cell increases, the cell voltage decreases. This paper analyses how......Renewable energy sources are fluctuating depending on the availability of the energy source. For this reason, energy storage is becoming more important and bidirectional fuel cells represent an attractive technology. Fuel cells require highcurrent low-voltage dc-dc or dc-ac converters as power...... the fuel cell I-V characteristics influences the power electronics converter efficiency and their consequence on the overall system. A loaddependent efficiency curve is presented based on experimental results from a 6 kW dc-dc converter prototype including the most suitable control strategy which maximizes...
Experimental Characterization and Modeling of PEM Fuel Cells
DEFF Research Database (Denmark)
Jespersen, Jesper Lebæk
fundamental knowledge of the transport and electrochemical processes of PEM fuel cells and to provide methods for obtaining high quality data for PEM fuel cell simulation model validation. In this thesis three different areas of experimental characterization techniques was investigated, they include: Stack...... for obtaining very detailed data of the manifold flow. Moreover, the tools complement each other well, as high quality validation data can be obtained from PIV measurements to verify CFD models. AC Impedance Spectroscopy was used to thoroughly characterize a HTPEM single cell. The measurement method...... was furthermore transferred onto a Labview platform, which signiffcantly improves the exibility and lowers the cost of using this method. This technique is expected to bea very important future tool, used both for material characterization, celldiagnostic, system optimization and as a control input parameter...
Scaling and universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, Jeppe
2000-01-01
Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...
Linear variable differential transformer and its uses for in-core fuel rod behavior measurements
International Nuclear Information System (INIS)
Wolf, J.R.
1979-01-01
The linear variable differential transformer (LVDT) is an electromechanical transducer which produces an ac voltage proportional to the displacement of a movable ferromagnetic core. When the core is connected to the cladding of a nuclear fuel rod, it is capable of producing extremely accurate measurements of fuel rod elongation caused by thermal expansion. The LVDT is used in the Thermal Fuels Behavior Program at the U.S. Idaho National Engineering Laboratory (INEL) for measurements of nuclear fuel rod elongation and as an indication of critical heat flux and the occurrence of departure from nucleate boiling. These types of measurements provide important information about the behavior of nuclear fuel rods under normal and abnormal operating conditions. The objective of the paper is to provide a complete account of recent advances made in LVDT design and experimental data from in-core nuclear reactor tests which use the LVDT
Directory of Open Access Journals (Sweden)
Mukherjee Sunil K
2010-06-01
Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.
International Nuclear Information System (INIS)
Lemarchand, F.
2007-01-01
Today there is an unrelenting trend for bio-fuels but some scientists question their utility. Some surveys show that the environmental balance sheet for bio-fuels is strongly positive for instance it is assessed that the production of 1 MJ of ethanol from beet roots of wheat requires only 0.49 MJ of fossil energy, interesting figure when compared to the 1.14 MJ of fossil energy needed to produce 1 MJ of gasoline. Other studies are less optimistic, all depends strongly on the basic data used and on the approach followed. Some scientists wonder whether all the pollutants generated in the transformation processes are well taken into account. In fact the environment benefit of the first generation of bio-fuels is mild because scientists do not know how to use efficiently the wood-cellulose by-products of plants. There is a notably exception to that, it is the sugar cane in Brazil, this plant has a good energy conversion rate and its by-products are completely and efficiently used in industry. A way to valorize cellulose by-products is to transform them in ethanol and hydrogen through the use of mushroom enzymes. (A.C.)
Preliminary study on AC superconducting machines
International Nuclear Information System (INIS)
Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.
1988-01-01
This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed
Fast Neutron Emission Tomography of Used Nuclear Fuel Assemblies
Hausladen, Paul; Iyengar, Anagha; Fabris, Lorenzo; Yang, Jinan; Hu, Jianwei; Blackston, Matthew
2017-09-01
Oak Ridge National Laboratory is developing a new capability to perform passive fast neutron emission tomography of spent nuclear fuel assemblies for the purpose of verifying their integrity for international safeguards applications. Most of the world's plutonium is contained in spent nuclear fuel, so it is desirable to detect the diversion of irradiated fuel rods from an assembly prior to its transfer to ``difficult to access'' storage, such as a dry cask or permanent repository, where re-verification is practically impossible. Nuclear fuel assemblies typically consist of an array of fuel rods that, depending on exposure in the reactor and consequent ingrowth of 244Cm, are spontaneous sources of as many as 109 neutrons s-1. Neutron emission tomography uses collimation to isolate neutron activity along ``lines of response'' through the assembly and, by combining many collimated views through the object, mathematically extracts the neutron emission from each fuel rod. This technique, by combining the use of fast neutrons -which can penetrate the entire fuel assembly -and computed tomography, is capable of detecting vacancies or substitutions of individual fuel rods. This paper will report on the physics design and component testing of the imaging system. This material is based upon work supported by the U.S. Department of Energy, Office of Defense Nuclear Nonproliferation Research and Development within the National Nuclear Security Administration, under Contract Number DE-AC05-00OR22725.
DEFF Research Database (Denmark)
Li, Chendan; Savaghebi, Mehdi; Guerrero, Josep M.
2016-01-01
on the power rating of the power converters. With various primary source for the distributed generator (DG), factors that are closely related to the operation cost, such as fuel cost of the generators and losses should be taken into account in order to improve the efficiency of the whole system. In this paper......, a multiagent-based distributed method is proposed to minimize the operation cost in AC microgrids. In the microgrid, each DG is acting as an agent which regulates the power individually using a novel power regulation method based on frequency scheduling. An optimal power command is obtained through carefully...... designed consensus algorithm by using sparse communication links only among neighbouring agents. Experimental results for different cases verified that the proposed control strategy can effectively reduce the operation cost....
21 CFR 880.5500 - AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...
Vehicle technologies, fuel-economy policies, and fuel-consumption rates of Chinese vehicles
International Nuclear Information System (INIS)
Huo Hong; He Kebin; Wang, Michael; Yao Zhiliang
2012-01-01
One of the principal ways to reduce transport-related energy use is to reduce fuel-consumption rates of motor vehicles (usually measured in liters of fuel per 100 km). Since 2004, China has implemented policies to improve vehicle technologies and lower the fuel-consumption rates of individual vehicles. Policy evaluation requires accurate and adequate information on vehicle fuel-consumption rates. However, such information, especially for Chinese vehicles under real-world operating conditions, is rarely available from official sources in China. For each vehicle type we first review the vehicle technologies and fuel-economy policies currently in place in China and their impacts. We then derive real-world (or on-road) fuel-consumption rates on the basis of information collected from various sources. We estimate that the real-world fuel-consumption rates of vehicles in China sold in 2009 are 9 L/100 km for light-duty passenger vehicles, 11.4 L/100 km for light-duty trucks, 22 L/100 km for inter-city transport buses, 40 L/100 km for urban transit buses, and 24.9 L/100 km for heavy-duty trucks. These results aid in understanding the levels of fuel consumption of existing Chinese vehicle fleets and the effectiveness of policies in reducing on-road fuel consumption, which can help in designing and evaluating future vehicle energy-efficiency policies. - Highlights: ► Vehicle fuel-consumption rate (VFCR) data are rarely available in China. ► We review the fuel-economy policies currently in place in China and their impacts. ► We derive real-world VFCRs on the basis of information collected from various sources. ► Results aid in understanding the fuel consumption levels of Chinese vehicle fleets. ► Results help in designing and evaluating future vehicle energy-efficiency policies.
Economic assessment of nuclear power plant operation with regard to effective use of nuclear fuel
International Nuclear Information System (INIS)
Svec, P.; Raninec, S.; Mizov, J.
1988-01-01
The essential preconditions are discussed for the better utilization of fuel in nuclear power plants. The MORNAP program which models the operation of the reactor is used for assessing the consequences of various fuel utilization strategies on technical and economic parameters of WWER-440 nuclear power plant operation. Some results of model calculation are given for the third and fourth units of the Jaslovske Bohunice nuclear power plant. The calculations have served for the economic assessment of the transition of part of the nuclear fuel from a three-campaign to a four-campaign cycle. This transition reduces fuel costs by 1.7%. The implementation of this strategy on a larger scale is expected to save 7 to 9% of fuel costs. (Z.M.). 2 tabs., 7 refs
An improved soft switched PWM interleaved boost AC-DC converter
International Nuclear Information System (INIS)
Genc, Naci; Iskender, Ires
2011-01-01
In this paper, an improved soft switched two cell interleaved boost AC/DC converter with high power factor is proposed and investigated. A new auxiliary circuit is designed and added to two cell interleaved boost converter to reduce the switching losses. The proposed auxiliary circuit is implemented using only one auxiliary switch and a minimum number of passive components without an important increase in the cost and complexity of the converter. The main advantage of this auxiliary circuit is that it not only provides zero-voltage-transition (ZVT) for the main switches but also provides soft switching for the auxiliary switch and diodes. Though all semiconductor devices operate under soft switching, they do not have any additional voltage and current stresses. The proposed converter operates successfully in soft switching operation mode for a wide range of input voltage level and the load. In addition, it has advantages such as fewer structure complications, lower cost and ease of control. In the study, the transition modes for describing the behavior of the proposed converter in one switching period are described. A prototype with 600 W output power, 50 kHz/cell switching frequency, input line voltage of 110-220 V rms and an output voltage of 400 V dc has been implemented. Analysis, design and the control circuitry are also presented in the paper.
AFA 2G and AFA 3G fuel rod performance analysis
International Nuclear Information System (INIS)
Lu Huaquan; Liu Tong; Jiao Yongjun; Pang Hua
2002-01-01
For 18-months fuel cycle strategy in GNPJVC DAYA BAY unit 1/2, by means of COCCINEL, the fuel rod performance for AFA 3G and AFA 2G in transition cycle is analyzed. The design criteria which should be respected in fuel rod design are included and the design methodology is introduced. All the criteria mentioned are verified and met
Cooperative Frequency Control for Autonomous AC Microgrids
DEFF Research Database (Denmark)
Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.
2015-01-01
Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
Potential impact of transition to a low-carbon transport system in Iceland
International Nuclear Information System (INIS)
Shafiei, Ehsan; Davidsdottir, Brynhildur; Leaver, Jonathan; Stefansson, Hlynur; Asgeirsson, Eyjolfur Ingi
2014-01-01
This paper develops a system dynamics model of Iceland's energy sector (UniSyD I S) that is based on the UniSyD N Z model of New Zealand's energy economy. The model focuses on the energy supply sector with endogenous representation of road transport energy demand. Equilibrium interactions are performed across electricity, hydrogen, biofuels, and road transport sectors. Possible transition paths toward a low-carbon transport in Iceland are explored with implications for fuel demand, greenhouse gas (GHG) emissions and associated costs. The consumer sector simulates the long-term evolution of light and heavy-duty vehicles through a vehicle choice algorithm that accounts for social influences and consumer preferences. Through different scenarios, the influences of four fundamental driving factors are examined. The factors are oil price, carbon tax, fuel supply-push, and government incentives. The results show that changes in travel demand, vehicle technologies, fuel types, and efficiency improvements can support feasible transition paths to achieve sufficient reduction in GHG for both 4 °C and 2 °C climate scenarios of the Nordic Energy Technology Perspectives study. Initial investment in supply infrastructure for alternative fuels will not only mitigate GHG emissions, but also could provide long-term economic benefits through fuel cost saving for consumers and reduced fuel import costs for government. - Highlights: • UniSyD I S is an energy system model with endogenous road transport energy demand. • Possible transition paths to low-carbon road transport system in Iceland are explored. • Vehicle choice sector accounts for social influences and consumers’ preferences. • Supply-push costs can be offset by mitigation benefits and fuel cost savings
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
AC power flow importance measures considering multi-element failures
International Nuclear Information System (INIS)
Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling
2017-01-01
Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.
Effect of Gas Fueling Location on H-mode Access in NSTX
International Nuclear Information System (INIS)
Maingi, R.; Bell, M.; Bell, R.; Biewer, T.; Bush, C.; Chang, C.S.; Gates, D.; Kaye, S.; Kugel, H.; LeBlanc, B.; Maqueda, R.; Menard, J.; Mueller, D.; Raman, R.; Sabbagh, S.; Soukhanovskii, V.
2003-01-01
The dependence of H-mode access on the poloidal location of the gas injection source has been investigated in the National Spherical Torus Experiment (NSTX). We find that gas fueling from the center stack midplane area produces the most reproducible H-mode access with generally the lowest L-H threshold power in lower single-null configuration. The edge toroidal rotation velocity is largest (in direction of the plasma current) just before the L-H transition with center stack midplane fueling, and then reverses direction after the L-H transition. Simulation of these results with a 2-D guiding-center Monte Carlo neoclassical transport code is qualitatively consistent with the trends in the measured velocities. Double-null discharges exhibit H-mode access with gas fueling from either the center stack midplane or center stack top locations, indicating a reduced sensitivity of H-mode access on fueling location in that shape
Systémový pohled na klub AC Sparta
Čečák, František
2015-01-01
Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Aragonite coating solutions (ACS) based on artificial seawater
Tas, A. Cuneyt
2015-03-01
Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org
2002-12-01
The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.
Solid fuel applications to transportation engines
Energy Technology Data Exchange (ETDEWEB)
Rentz, Richard L.; Renner, Roy A.
1980-06-01
The utilization of solid fuels as alternatives to liquid fuels for future transportation engines is reviewed. Alternative liquid fuels will not be addressed nor will petroleum/solid fuel blends except for the case of diesel engines. With respect to diesel engines, coal/oil mixtures will be addressed because of the high interest in this specific application as a result of the large number of diesel engines currently in transportation use. Final assessments refer to solid fuels only for diesel engines. The technical assessments of solid fuels utilization for transportation engines is summarized: solid fuel combustion in transportation engines is in a non-developed state; highway transportation is not amenable to solid fuels utilization due to severe environmental, packaging, control, and disposal problems; diesel and open-cycle gas turbines do not appear worthy of further development, although coal/oil mixtures for slow speed diesels may offer some promise as a transition technology; closed-cycle gas turbines show some promise for solid fuels utilization for limited applications as does the Stirling engine for use of cleaner solid fuels; Rankine cycle engines show good potential for limited applications, such as for locomotives and ships; and any development program will require large resources and sophisticated equipment in order to advance the state-of-the-art.
The system architecture for renewable synthetic fuels
DEFF Research Database (Denmark)
Ridjan, Iva
To overcome and eventually eliminate the existing heavy fossil fuels in the transport sector, there is a need for new renewable fuels. This transition could lead to large capital costs for implementing the new solutions and a long time frame for establishing the new infrastructure unless a suitable...... and production plants, so it is important to implement it in the best manner possible to ensure an efficient and flexible system. The poster will provide an overview of the steps involved in the production of synthetic fuel and possible solutions for the system architecture based on the current literature...
Ratso, Sander; Kruusenberg, Ivar; Käärik, Maike; Kook, Mati; Puust, Laurits; Saar, Rando; Leis, Jaan; Tammeveski, Kaido
2018-01-01
The search for an efficient electrocatalyst for oxygen reduction reaction (ORR) to replace platinum in fuel cell cathode materials is one of the hottest topics in electrocatalysis. Among the many non-noble metal catalysts, metal/nitrogen/carbon composites made by pyrolysis of cheap materials are the most promising with control over the porosity and final structure of the catalyst a crucial point. In this work we show a method of producing a highly active ORR catalyst in alkaline media with a controllable porous structure using titanium carbide derived carbon as a base structure and dicyandiamide along with FeCl3 or CoCl2 as the dopants. The resulting transition metal-nitrogen co-doped carbide derived carbon (M/N/CDC) catalyst is highly efficient for ORR electrocatalysis with the activity in 0.1 M KOH approaching that of commercial 46.1 wt.% Pt/C. The catalyst materials are also investigated by scanning electron microscopy, Raman spectroscopy and X-ray photoelectron spectroscopy to characterise the changes in morphology and composition causing the raise in electrochemical activity. MEA performance of M/N/CDC cathode materials in H2/O2 alkaline membrane fuel cell is tested with the highest power density reached being 80 mW cm-2 compared to 90 mW cm-2 for Pt/C.
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
Nuclear research and test reactors have been in operation for over 60 years, over 270 research reactors are currently operating in more than 50 countries. This meeting is dedicated to different aspects of research reactor fuels: new fuels for new reactors, the conversion to low enriched uranium fuels, spent fuel management and computational tools for core simulation. About 80 contributions are reported in this document, they are organized into 7 sessions: 1) international topics and overview on new projects and fuel, 2) new projects and upgrades, 3) fuel development, 4) optimisation and research reactor utilisation, 5) innovative methods in research reactors physics, 6) safety, operation and research reactor conversion, 7) fuel back-end management, and a poster session. Experience from Australian, Romanian, Libyan, Syrian, Vietnamese, South-African and Ghana research reactors are reported among other things. The Russian program for research reactor spent fuel management is described and the status of the American-driven program for the conversion to low enriched uranium fuels is presented. (A.C.)
ac propulsion system for an electric vehicle
Geppert, S.
1980-01-01
It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.
Is the French fuel cycle management an asset for international business?
International Nuclear Information System (INIS)
Beutier, D.; Debes, M.
2016-01-01
In order to comfort its energy independence and diminish the amount of radioactive waste, France has chosen to close its fuel cycle since long. Thanks to the size of the fleet of reactors operating in France, reprocessing techniques have been validated on an industrial scale and France is now the only country to master these technologies. The French strategy of closing the fuel cycle allows, first, the vitrification of high-level radioactive wastes and their storing in passive installations before their definitive disposal and secondly, it allows the recycling of fissile materials. Several other countries like Japan, United-Kingdom, the Netherlands and China soon have also chosen to close their fuel cycle. Plutonium recycling is made through the fabrication of MOX (mixed uranium and plutonium oxides) fuel in the MELOX plant with an output of 120 tons a year. A second recycling of spent MOX fuel in PWR is unlikely because of the poor isotopic quality of the plutonium, the recycling will be possible and economically competitive in fast reactors when these 4. generation reactors take over. The important, complete and unique experience of AREVA in terms of fuel cycle from fuel fabrication to waste vitrification via plutonium recycling is a relevant asset in the competitive international nuclear energy market. (A.C.)
Development of MOX fuel database
International Nuclear Information System (INIS)
Ikusawa, Yoshihisa; Ozawa, Takayuki
2007-03-01
We developed MOX Fuel Database, which included valuable data from several irradiation tests in FUGEN and Halden reactor, for help of LWR MOX use. This database includes the data of fabrication and irradiation, and the results of post-irradiation examinations for seven fuel assemblies, i.e. P06, P2R, E03, E06, E07, E08 and E09, irradiated in FUGEN. The highest pellet peak burn-up reached ∼48GWd/t in MOX fuels, of which the maximum plutonium content was ∼6 wt%, irradiated in E09 fuel assembly without any failure. Also the data from the instrumented MOX fuels irradiated in HBWR to study the irradiation behavior of BWR MOX fuels under the steady state condition (IFA-514/565 and IFA-529), under the load-follow operation condition (IFA-554/555) and under the transit condition (IFA-591) are included in this database. The highest assembly burn-up reached ∼56 GWd/t in IFA-565 steady state irradiation test, and the maximum linear power of MOX fuel rods was 58.3-68.4 kW/m without any failure in IFA-591 ramp test. In addition, valuable instrument data, i.e. cladding elongation, fuel stack elongation, fuel center temperature and rod inner pressure were obtained from IFA-554/555 load-follow test. (author)
Middle to Upper Paleolithic transition in Moravia: New sites, new dates, new ideas
Czech Academy of Sciences Publication Activity Database
Škrdla, Petr
2017-01-01
Roč. 450, 2 September 2017 (2017), s. 116-125 ISSN 1040-6182 R&D Projects: GA ČR GA15-19170S; GA AV ČR IAA800010801 Keywords : Moravia * Bohunician * Szeletian * Aurignacian * Dating * Middle to Upper Paleolithic transition Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 2.199, year: 2016
Development of CH{sub 3}OH fueled PEMFC power plants for hybrid transit buses
Energy Technology Data Exchange (ETDEWEB)
Baumert, R; Cooper, R; Feasey, G [DBB Fuel Cell Engines Corp., Poway, CA (United States)
1999-12-31
An overview of the methanol fuel cell power system was provided, identifying improved efficiency and reduced emissions as the principal advantages. Four critical tasks regarding on-board fuel processing were described: (1) efficient methanol conversion (steam reforming), (2) effective reformate purification (selective catalytic oxidation), (3) optimized heat integration, and (4) rapid response to transients. A description of a 100 kW PEM fuel cell bus engine package was also presented. As far as a development time table is concerned, the DBB Fuel Cell Engines Corp. of Poway California has completed two methanol fueled PEMFC power plants, fabrication of the initial 100 kW PEMFC engine is in progress and scheduled for delivery by 1998. The two methanol fueled commercial products which are in the planning stages are the 100 and 200 kW class FCPS for hybrid and non-hybrid buses and other applications. tabs., figs.
International Nuclear Information System (INIS)
Stratton, R.W.; Ledergerber, G.; Ingold, F.; Latimer, T.W.; Chidester, K.M.
1993-01-01
The preparation of mixed carbide fuel for a joint (US-Swiss) irradiation test in the US Fast Flux Test Facility (FFTF) is described, together with the experiment design and the irradiation conditions. Two fabrication routes were compared. The US produced 66 fuel pins containing pellet fuel via the powder-pellet (dry) route, and the Swiss group produced 25 sphere pac pins of mixed carbide using the internal gelation (wet) route. Both sets of fuel met all t the requirements of the specifications concerning soichiometry, chemical composition and structure. The pin designs were as similar as possible. The test operated successfully in the FFTF for 620 effective full power days until October 1988 and reached over 8% burn up with peak powers of around 80 kW/m. The conclusions were that the choice of sphere pac or pellet fuel for reactor application is dependent on preferred differences in fabrication (e.g. economics and environmental factors) and not on differences in irradiation behaviour. (orig.)
Test of high temperature fuel element, (1)
International Nuclear Information System (INIS)
Akino, Norio; Shiina, Yasuaki; Nekoya, Shin-ichi; Takizuka, Takakazu; Emori, Koichi
1980-11-01
Heat transfer experiment to measure the characteristics of a VHTR fuel in the same condition of the reactor core was carried out using HTGL (High Temperature Helium Gas Loop) and its test section. In this report, the details of the test section, related problems of construction and some typical results are described. The newly developed heater with graphite heat transfer surface was used as a simulated fuel element to determine the heat transfer characteristics. Following conclusions were obtained; (1) Reynolds number between turbulent and transitional region is about 2600. (2) Reynolds number between transitional and laminar region is about 4800. (3) The laminarization phenomena have not been observed and are hardly occurred in annular tubes comparing with round tube. (4) Measured Nusselt numbers agree to the established correlations in turbulent and laminar regions. (author)
Origin and development of the new U-Mo nuclear fuel
International Nuclear Information System (INIS)
Boyard, M.; Languille, A.; Thomasson, J.; Hamy, J.M.
2002-01-01
Historically most research reactors have used highly enriched nuclear fuels (enrichment > 90 %). Since 1977 the non-proliferation policy has imposed to convert these reactors to far less enriched fuels (< 20 %). An international consensus has evolved towards a nuclear fuel with an enrichment factor of 19,75 %, this fuel is made of a powdered U-Mo alloy scattered in an aluminium die. The external dimensions and the cladding materials of the fuel plate are unchanged in order to minimize development and qualification costs. The U-Mo fuel is expected to maintain or even to increase the performance of reactors and to allow the processing of spent fuels in the same installations as those used for fuels issuing from power plants. Cea, Cogema, Cerca, Framatome, and Technicatome have shared their technical means, their know-how and their financial resources to develop this new nuclear fuel. 2006 is the contract date by which American authorities will stop repatriating the ancient spent fuel (uranium silicide) from research reactors so it is imperative to make available by this date a new nuclear fuel with a satisfactory end of cycle. This article also presents the French program of qualification of the U-Mo fuel. 2 series of irradiation have already been performed, one (Isis-1) in Osiris reactor (Saclay, France) and the second (Umus) in HFR (Petten, Netherlands). A clad failure has led to stop the Umus experiment. 2 new series of irradiation are scheduled to start in 2002. In a parallel way, in the framework of the design of the RJH (Jules Horowitz reactor) Cea will soon perform irradiation of U-Mo fuel plates in BR2 (Mol, Belgium). (A.C.)
Systémový pohled na klub AC Sparta
Čečák, František
2014-01-01
Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...
Characterization of the 309 fuel examination facility
International Nuclear Information System (INIS)
Greenhalgh, W.O.; Cornwell, B.C.
1997-01-01
This document identifies radiological, chemical and physical conditions inside the Fuel Examination Facility. It is located inside the Plutonium Recycle Test Reactor containment structure (309 Building.) The facility was a hot cell used for examination of PRTR fuel and equipment during the 1960's. Located inside the cell is a PRTR shim rod assembly, reported are radiological conditions of the sample. The conditions were assessed as part of overall 309 Building transition
An Institutional Approach to Understanding Energy Transitions
Koster, Auriane Magdalena
Energy is a central concern of sustainability because how we produce and consume energy affects society, economy, and the environment. Sustainability scientists are interested in energy transitions away from fossil fuels because they are nonrenewable, increasingly expensive, have adverse health effects, and may be the main driver of climate change. They see an opportunity for developing countries to avoid the negative consequences fossil-fuel-based energy systems, and also to increase resilience, by leap-frogging-over the centralized energy grid systems that dominate the developed world. Energy transitions pose both challenges and opportunities. Obstacles to transitions include 1) an existing, centralized, complex energy-grid system, whose function is invisible to most users, 2) coordination and collective-action problems that are path dependent, and 3) difficulty in scaling up RE technologies. Because energy transitions rely on technological and social innovations, I am interested in how institutional factors can be leveraged to surmount these obstacles. The overarching question that underlies my research is: What constellation of institutional, biophysical, and social factors are essential for an energy transition? My objective is to derive a set of "design principles," that I term institutional drivers, for energy transitions analogous to Ostrom's institutional design principles. My dissertation research will analyze energy transitions using two approaches: applying the Institutional Analysis and Development Framework and a comparative case study analysis comprised of both primary and secondary sources. This dissertation includes: 1) an analysis of the world's energy portfolio; 2) a case study analysis of five countries; 3) a description of the institutional factors likely to promote a transition to renewable-energy use; and 4) an in-depth case study of Thailand's progress in replacing nonrenewable energy sources with renewable energy sources. My research will
Transition period fuel cycle from current to next generation reactors for Japan
International Nuclear Information System (INIS)
Yamashita, Junichi; Fukasawa, Tetsuo; Hoshino, Kuniyoshi; Kawamura, Fumio; Shiina, Kouji; Sasahira, Akira
2007-01-01
Long-term energy security and global warming prevention can be achieved by a sustainable electricity supply with next generation fast breeder reactors (FBRs). Current light water reactors (LWRs) will be replaced by FBRs and FBR cycle will be established in the future considering the limited amount of uranium (U) resource. The introduction of FBRs requires plutonium (Pu) recovered from LWR spent fuel. The authors propose advanced system named Flexible Fuel Cycle Initiative (FFCI)' which can supply enough Pu and hold no surplus Pu, can respond flexibly the future technical and social uncertainties, and can achieve an economical FBR cycle. FFCI can simplify the 2nd LWR reprocessing facility for Japan (after Rokkasho Reprocessing Plant) which only carries out U removal from LWR spent fuel. Residual 'Recycle Material' is, according to FBRs introduction status, immediately treated in the FBR reprocessing to fabricate FBR fuel or temporarily stored for the utilization in FBRs at necessary timing. FFCI has high flexibility by having several options for future uncertainties by the introduction of Recycle Material as a buffer material between LWR and FBR cycles. (author)
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string
Magnetic properties of 3d-transition metal and rare earth fluoride glasses
International Nuclear Information System (INIS)
Renard, J.P.; Dupas, C.; Velu, E.; Jacobini, C.; Fonteneau, G.; Lucas, J.
1981-01-01
The ac susceptibility of fluoride glasses in the ternary systems PbF 2 -MnF 2 -FeF 3 , ThF 4 -BaF 2 -MnF 2 , ZnF 2 -BaF 2 -RF 3 (R = Dy-Ho) has been studied down to 0.3 K. The susceptibility of rare earth glasses exhibits a broad maximum strongly dependent on the measuring frequency ν while a spin glass transition with a sharp susceptibility cusp nearly independent on ν is observed in 3d-transition metal glasses. Magnetic after effects are observed below the spin freezing temperature. (orig.)
Mapa acústico parcial de Benetusser
MORILLA CASTELLANOS, EMILIO
2012-01-01
Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...
An, Yanzhao
2018-02-27
This study investigated the transition from conventional Compression Ignition (CI) to Partially Premixed Combustion (PPC) in an optical engine for fuels with differing properties. Combustion stratification and emissions were measured with diesel, naphtha and their corresponding surrogate fuels, N-heptane and PRF50. The aim of the study is to link the combustion images with engine out emissions and mixture homogeneity. Single injection strategy with the change of start of injection (SOI) from late to early injections was employed. Results show that combustion phasing trend is similar for diesel/N-heptane as well as for naphtha/PRF50 as the SOI moved from late injection timing to early injection timing. However, there is a significant difference in combustion phasing behavior for gasoline like fuels (naphtha and PRF50) and diesel fuels (diesel and N-heptane). CO emissions show an inverted V-shaped trend with one single peak in the transition zone. A “W” shape trend, with two bottoms at various dilution rates is observed for the UHC emissions. NOX emissions are high in the transition zone and decreased to lower levels in CI and PPC zones. NOX emissions are significantly reduced by reducing the intake O2 concentration with nitrogen. Except for diesel, the other three fuels show lower soot emissions. When compared to diesel like fuels, the natural luminosity of the images are lower for gasoline like fuels, indicating better premixed combustion. As the SOI is changed from CI to PPC mode, the combustion stratification increases towards a peak value in the transition zone and then decreases to a low level in PPC zone. A competition exists between the intake temperature and the dilution rate for the combustion stratification. The level of stratification is higher for real fuels (diesel and naphtha) when compared to surrogate fuel (N-heptane and PRF50).
Wide Operating Voltage Range Fuel Cell Battery Charger
DEFF Research Database (Denmark)
Hernandez Botella, Juan Carlos; Mira Albert, Maria del Carmen; Sen, Gokhan
2014-01-01
DC-DC converters for fuel cell applications require wide voltage range operation due to the unique fuel cell characteristic curve. Primary parallel isolated boost converter (PPIBC) is a boost derived topology for low voltage high current applications reaching an efficiency figure up to 98...... by two the converter input-to-output voltage gain. This allows covering the conditions when the fuel cell stack operates in the activation region (maximum output voltage) and increases the degrees of freedom for converter optimization. The transition between operating modes is studied because represents...
All ceramic structure for molten carbonate fuel cell
Smith, James L.; Kucera, Eugenia H.
1992-01-01
An all-ceramic molten carbonate fuel cell having a composition formed of a multivalent metal oxide or oxygenate such as an alkali metal, transition metal oxygenate. The structure includes an anode and cathode separated by an electronically conductive interconnect. The electrodes and interconnect are compositions ceramic materials. Various combinations of ceramic compositions for the anode, cathode and interconnect are disclosed. The fuel cell exhibits stability in the fuel gas and oxidizing environments. It presents reduced sealing and expansion problems in fabrication and has improved long-term corrosion resistance.
DEFF Research Database (Denmark)
Liu, Xiong; Wang, Peng; Loh, Poh Chiang
2011-01-01
This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...
AC conductivity of a quantum Hall line junction
International Nuclear Information System (INIS)
Agarwal, Amit; Sen, Diptiman
2009-01-01
We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.
International Nuclear Information System (INIS)
King, D.S.; Cox, A.N.; Hodson, S.W.
1975-01-01
Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)
ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus
International Nuclear Information System (INIS)
Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi
2007-01-01
orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae
International Nuclear Information System (INIS)
Blissell, W.H.; Ciez, A.P.; Mitchell, J.L.; Winkler, C.J.
1986-12-01
This document describes the Westinghouse Preliminary Design for the Prototypical Consolidation Demonstration Project per Department of Energy (DOE) Contract No. DE-AC07-86ID12649 and under direction of the DOE Idaho Operations Office. The preliminary design is the first step to providing the Department of Energy with a fully qualified, licensable, cost-effective spent fuel rod consolidation system. The design was developed using proven technologies and equipment to create an innovative approach to previous rod consolidation concepts. These innovations will better enable the Westinghouse system to: consolidate fuel rods in a precise, fully-controlled, accountable manner; package all rods from two PWR fuel assemblies or from four BWR fuel assemblies in one 8.5 inch square consolidated rods canister; meet all functional requirements; operate with all fuel types common to the US commercial nuclear industry with minimal tooling changeouts; and meet consolidation production process rates, while maintaining operator and public health and safety. This Preliminary Design Report provides both detailed descriptions of the equipment required to perform the rod consolidation process and the supporting analyses to validate the design
Interface agreement for the management of 308 Building Spent Nuclear Fuel. Revision 1
International Nuclear Information System (INIS)
Danko, A.D.
1995-01-01
The Hanford Site Spent Nuclear Fuel (SNF) Project was formed to manage the SNF at Hanford. Specifically, the mission of the SNF Project on the Hanford Site is to ''provide safe, economic, environmentally sound management of Hanford SNF in a manner which stages it for final disposition.'' The current mission of the Fuel Fabrication Facilities Transition Project (FFFTP) is to transition the 308 Building for turn over to the Environmental Restoration Contractor for decontamination and decommissioning
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
Detection of Genetic Modification 'ac2' in Potato Foodstuffs
Directory of Open Access Journals (Sweden)
Petr Kralik
2009-01-01
Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.
Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk
2015-01-01
An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493
International Nuclear Information System (INIS)
Lima, D.B.P.L. de; Florio, D.Z. de; Bezerra, M.E.O.
2016-01-01
Fuel cells produce electrical current from the electrochemical combustion of a gas or liquid (H2, CH4, C2H5OH, CH3OH, etc.) inserted into the anode cell. An important class of fuel cells is the SOFC (Solid Oxide Cell Fuel). It has a ceramic electrolyte that transports protons (H +) or O-2 ions and operating at high temperatures (500-1000 °C) and mixed conductive electrodes (ionic and electronic) ceramics or cermets. This work aims to develop anodes for fuel cells of solid oxide (SOFC) in order to direct operations with renewable fuels and strategic for the country (such as bioethanol and biogas). In this context, it becomes important to study in relation to the ceramic materials, especially those that must be used in high temperatures. Some types of double perovskites such as Sr2MgMoO6 (or simply SMMO) have been used as anodes in SOFC. In this study were synthesized by the polymeric precursor method, analyzed and characterized different ceramic samples of families SMMO, doped with Nb, this is: Sr2 (MgMo)1-xNbxO6 with 0 ≤ x ≤ 0.2. The materials produced were characterized by various techniques such as, thermal analysis, X-ray diffraction and scanning electron microscopy, and electrical properties determined by dc and ac measurements in a wide range of temperature, frequency and partial pressure of oxygen. The results of this work will contribute to a better understanding of advanced ceramic properties with mixed driving (electronic and ionic) and contribute to the advancement of SOFC technology operating directly with renewable fuels. (author)
International Nuclear Information System (INIS)
Crombie, D.; Lister, D.H.
2006-01-01
Full text: In 2002, the Canadian Parliament passed into law the Nuclear Fuel Waste Act that established the Nuclear Waste Management Organisation (NWMO). The NWMO was given three years to study the issues surrounding the long-term management of Canada's used nuclear fuel and to recommend to government a permanent solution. In doing so, it recognised early that the issues were as much social as technical and embarked on an extensive Canada-wide campaign of public engagement. It sponsored debates among interested parties, held public information and dialogue sessions, maintained an active Web site and sought input from expert individuals and groups. A strong focus was put upon engaging Aboriginal groups. At about the same time as the NWMO was established, the Advisory Council (AC) was formed. The AC is composed of nine people from a variety of backgrounds, including social and political sciences, environmental law, aboriginal affairs, science and engineering, and with diverging opinions on energy utilisation. The AC followed the public engagement activities closely and, as it received regular briefings and progress reports from the NWMO, offered advice and criticism as appropriate. Throughout, the AC was diligent in maintaining its independence and ensuring that its own activities were fully transparent. Part of this diligence entailed the compilation of a Tracking Matrix of its activities, which has been made available for public scrutiny. In 2005 November, the Final Report of the NWMO was submitted to the Canadian Government, recommending an Adaptive Phased Management approach to deep geological disposal. At the same time, the AC submitted its Final Report. This paper summarises the activities of the AC and describes how such a diverse group of individuals came to a consensus on generally supporting the NWMO's recommendation yet, at the same time, offering several caveats, particularly with regard to energy policy in Canada