WorldWideScience

Sample records for ac transit fuel

  1. Alameda-Contra Costa Transit District (AC Transit) Fuel Cell Transit Buses: Preliminary Evaluation Results

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2007-03-01

    This report provides an evaluation of three prototype fuel cell-powered transit buses operating at AC Transit in Oakland, California, and six baseline diesel buses similar in design to the fuel cell buses.

  2. National Fuel Cell Bus Program: Accelerated Testing Evaluation Report and Appendices, Alameda-Contra Costa Transit District (AC Transit)

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 through October 2008. Evaluation results include implementation experience, fueling station operation, fuel cell bus operations at Golden Gate Transit, and evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and roadcalls).

  3. National Fuel Cell Bus Program: Accelerated Testing Evaluation Report #2, Alameda-Contra Costa Transit District (AC Transit) and Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2010-06-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006, comparing similar diesel buses operating from the same depot. It covers November 2007 through February 2010. Results include implementation experience, fueling station operation, evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and road calls), and a summary of achievements and challenges encountered during the demonstration.

  4. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  5. Checklist for transition to new highway fuel(s).

    Energy Technology Data Exchange (ETDEWEB)

    Risch, C.; Santini, D.J. (Energy Systems)

    2011-12-15

    Transportation is vital to the U.S. economy and society. As such, U.S. Presidents have repeatedly stated that the nation needs to reduce dependence on petroleum, especially for the highway transportation sector. Throughout history, highway transportation fuel transitions have been completed successfully both in United States and abroad. Other attempts have failed, as described in Appendix A: Historical Highway Fuel Transitions. Planning for a transition is critical because the changes can affect our nation's ability to compete in the world market. A transition will take many years to complete. While it is tempting to make quick decisions about the new fuel(s) of choice, it is preferable and necessary to analyze all the pertinent criteria to ensure that correct decisions are made. Doing so will reduce the number of changes in highway fuel(s). Obviously, changes may become necessary because of occurrences such as significant technology breakthroughs or major world events. With any and all of the possible transitions to new fuel(s), the total replacement of gasoline and diesel fuels is not expected. These conventional fuels are envisioned to coexist with the new fuel(s) for decades, while the revised fuel and vehicle infrastructures are implemented. The transition process must analyze the needs of the primary 'players,' which consist of the customers, the government, the fuel industry, and the automotive industry. To maximize the probability of future successes, the prime considerations of these groups must be addressed. Section 2 presents a succinct outline of the Checklist. Section 3 provides a brief discussion about the groupings on the Checklist.

  6. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2016

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jeffers, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2016-11-01

    This report, published annually, summarizes the progress of fuel cell electric bus development in the United States and discusses the achievements and challenges of introducing fuel cell propulsion in transit. The report provides a summary of results from evaluations performed by the National Renewable Energy Laboratory. Funding for this effort is provided by the U.S. Department of Energy's Fuel Cell Technologies Office within the Office of Energy Efficiency and Renewable Energy and by the U.S. Department of Transportation's Federal Transit Administration. The 2016 summary results primarily focus on the most recent year for each demonstration, from August 2015 through July 2016. The results for these buses account for more than 550,000 miles traveled and 59,500 hours of fuel cell power system operation. The primary results presented in the report are from three demonstrations of two different fuel-cell-dominant bus designs: Zero Emission Bay Area Demonstration Group led by Alameda-Contra Costa Transit District (AC Transit) in California; American Fuel Cell Bus Project at SunLine Transit Agency in California; and American Fuel Cell Bus Project at the University of California at Irvine.

  7. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2015

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States); Gikakis, Christina [Federal Transit Administration, Washington, DC (United States)

    2015-12-11

    This report, published annually, summarizes the progress of fuel cell electric bus (FCEB) development in the United States and discusses the achievements and challenges of introducing fuel cell propulsion in transit. Various stakeholders, including FCEB developers, transit agencies, and system integrators, have expressed the value of this annual status report, which provides a summary of results from evaluations performed by the National Renewable Energy Laboratory. The annual status report tracks the progress of the FCEB industry toward meeting technical targets, documents the lessons learned, and discusses the path forward for commercial viability of fuel cell technology for transit buses. The 2015 summary results primarily focus on the most recent year for each demonstration, from August 2014 through July 2015. The results for these buses account for more than 1,045,000 miles traveled and 83,000 hours of fuel cell power system operation. The primary results presented in the report are from two demonstrations of fuel-cell-dominant bus designs: the Zero Emission Bay Area Demonstration Group led by Alameda-Contra Costa Transit District (AC Transit) in California and the American Fuel Cell Bus Project at SunLine Transit Agency in California.

  8. A smooth transition to hydrogen transportation fuel

    Energy Technology Data Exchange (ETDEWEB)

    Berry, G.D.; Smith, J.R.; Schock, R.N.

    1995-04-14

    The goal of this work is to examine viable near-term infrastructure options for a transition to hydrogen fueled vehicles and to suggest profitable directions for technology development. The authors have focused in particular on the contrasting options of decentralized production using the existing energy distribution network, and centralized production of hydrogen with a large-scale infrastructure. Delivered costs have been estimated using best available industry cost and deliberately conservative economic assumptions. The sensitivities of these costs have then been examined for three small-scale scenarios: (1) electrolysis at the home for one car, and production at the small station scale (300 cars/day), (2) conventional alkaline electrolysis and (3) steam reforming of natural gas. All scenarios assume fueling a 300 mile range vehicle with 3.75 kg. They conclude that a transition appears plausible, using existing energy distribution systems, with home electrolysis providing fuel costing 7.5 to 10.5{cents}/mile, station electrolysis 4.7 to 7.1{cents}/mile, and steam reforming 3.7 to 4.7{cents}/mile. The average car today costs about 6{cents}/mile to fuel. Furthermore, analysis of liquid hydrogen delivered locally by truck from central processing plants can also be competitive at costs as low as 4{cents}/mile. These delivered costs are equal to $30 to $70 per GJ, LHV. Preliminary analysis indicates that electricity transmission costs favor this method of distributing energy, until very large (10 GW) hydrogen pipelines are installed. This indicates that significant hydrogen pipeline distribution will be established only when significant markets have developed.

  9. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2010

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.; Gigakis, C.

    2010-11-01

    This status report, fourth in a series of annual status reports from the U.S. Department of Energy's National Renewable Energy Laboratory, summarizes progress and accomplishments from demonstrations of fuel cell transit buses in the United States. This year's assessment report provides the results from the fifth year of operation of five Van Hool, ISE, and UTC Power fuel cell buses operating at AC Transit, SunLine, and CTTRANSIT. The achievements and challenges of this bus design, implementation, and operating are presented, with a focus on the next steps for implementing larger numbers and new and different designs of fuel cell buses. The major positive result from nearly five years of operation is the dramatic increase in reliability experienced for the fuel cell power system.

  10. Fuel cell transit bus development & commercialization programs at Gerogetown University

    Energy Technology Data Exchange (ETDEWEB)

    Wimmer, R.; Larkins, J.; Romano, S. [Georgetown Univ., Washington, DC (United States)

    1996-12-31

    Fourteen years ago, Georgetown University (GU) perceived the need for a clean, efficient power systems for transportation that could operate on non-petroleum based fuels. The transit bus application was selected to begin system development. GU recognized the range and recharge constraints of a pure battery powered transit bus. A Fuel Cell power system would circumvent these limitations and, with an on board reformer, accommodate liquid fuel for rapid refueling. Feasibility studies for Fuel Cell power systems for transit buses were conducted with the Los Alamos National Laboratory in 1983. Successful results of this investigation resulted in the DOT/DOE Fuel Cell transit bus development program. The first task was to prove that small Fuel Cell power plants were possible. This was achieved with the Phase I development of two 25 kW Phosphoric Acid Fuel Cell (PAFC) brassboard systems. A liquid cooled version was selected for the Phase II activity in which three 30-foot Fuel Cell powered Test Bed Buses (TBBs) were fabricated. The first of these TBBs was delivered in the spring of 1994. All three of these development vehicles are now in Phase III of the program to conduct testing and evaluation, is conducting operational testing of the buses. The test will involve two fuel cell-operated buses; one with a proton exchange fuel cell and the other with a phosphoric acid fuel cell.

  11. An overview of power electronics applications in fuel cell systems: DC and AC converters.

    Science.gov (United States)

    Ali, M S; Kamarudin, S K; Masdar, M S; Mohamed, A

    2014-01-01

    Power electronics and fuel cell technologies play an important role in the field of renewable energy. The demand for fuel cells will increase as fuel cells become the main power source for portable applications. In this application, a high-efficiency converter is an essential requirement and a key parameter of the overall system. This is because the size, cost, efficiency, and reliability of the overall system for portable applications primarily depend on the converter. Therefore, the selection of an appropriate converter topology is an important and fundamental aspect of designing a fuel cell system for portable applications as the converter alone plays a major role in determining the overall performance of the system. This paper presents a review of power electronics applications in fuel cell systems, which include various topology combinations of DC converters and AC inverters and which are primarily used in fuel cell systems for portable or stand-alone applications. This paper also reviews the switching techniques used in power conditioning for fuel cell systems. Finally, this paper addresses the current problem encountered with DC converters and AC inverter.

  12. Core analysis during transition from 37-element fuel to CANFLEX-NU fuel in CANDU 6

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Chang Joon; Suk, Ho Chun [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    1998-12-31

    An 1200-day time-dependent fuel-management for the transition from 37-element fuel to CANFLEX-NU fuel in a CANDU 6 reactor has been simulated to show the compatibility of the CANFLEX-NU fuel with the reactor operation. The simulation calculations were carried out with the RFSP code, provided by cell averaged fuel properties obtained from the POWDERPUFS-V code. The refueling scheme for both fuels was an eight bundle shift at a time. The simulation results show that the maximum channel and bundle powers were maintained below the license limit of the CANDU 6. This indicates that the CANFLEX-NU fuel bundle is compatible with the CANDU 6 reactor operation during the transition period. 3 refs., 2 figs., 1 tab. (Author)

  13. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2009

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.; Gikakis, C.

    2009-10-01

    This report documents progress in meeting the technological challenges of fuel cell propulsion for transportation based on current fuel cell transit bus demonstrations and plans for more fuel cell transit buses and hydrogen infrastructure.

  14. Stick-slip to sliding transition of dynamic contact lines under AC electrowetting

    NARCIS (Netherlands)

    Mannetje, 't D.J.C.M.; Mugele, F.; Ende, van den D.

    2013-01-01

    We show that at low velocities the dynamics of a contact line of a water drop moving over a Teflon-like surface under ac electrowetting must be described as stick–slip motion, rather than one continuous movement. At high velocities we observe a transition to a slipping regime. In the slipping regime

  15. BC Transit Fuel Cell Bus Project: Evaluation Results Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Post, M.

    2014-02-01

    This report evaluates a fuel cell electric bus demonstration led by British Columbia Transit (BC Transit) in Whistler, Canada. BC Transit is collaborating with the California Air Resources Board and the U.S. Department of Energy's National Renewable Energy Laboratory to evaluate the buses in revenue service. This evaluation report covers two years of revenue service data on the buses from April 2011 through March 2013.

  16. DC Smart Grid Connected with Fuel Charging Station and AC Load by Hybrid MLI

    Directory of Open Access Journals (Sweden)

    Naveen Kumar

    2013-07-01

    Full Text Available This paper presents the Solar (photo voltaic power Plant and Windmill plant with DC Smart Grid connected with an DC Fuel Charging Station For Electric Vehicle (EV, Plug in Hybrid Electric Vehicle (PHEV and converted to AC load for Consumer single or Three phase ac load by means of Hybrid Multilevel Inverter (MLI. Solar Energy which store energy in lithium-ion battery and connected to Smart Grid .Wind Energy which get stored in Lithium-ion battery that Fixed DC Voltage connected with DC Smart Grid. Smart Grid which are Connected with DC Fuel Charging Station in Ring Topology with a certain distance for charging of Electric Vehicle (EV and Plug-in Hybrid Electric Vehicle with On-Board (Integrated Charger for faster charging of EV. In Power demand for Consumer the DC load from smart grid converted into an ac load by Hybrid Multilevel Inverter. In Consumers Place the small wind mill and PV panel are installed that energy can be used for consumers load at peak time or power Shutdown .Other than the power shutdown or peak time in the consumers place, stored DC Energy can be fed to Smart Grid. A major development in distribution automation is deployment of smart meters as a gateway between the utility and customer. With such capabilities the smart meter becomes not only a point of measurement of consumed kWh but also a controller capable of bidirectional communications with both the customer and utility.

  17. Parameters characterization and optimization of activated carbon (AC) cathodes for microbial fuel cell application.

    Science.gov (United States)

    Santoro, Carlo; Artyushkova, Kateryna; Babanova, Sofia; Atanassov, Plamen; Ieropoulos, Ioannis; Grattieri, Matteo; Cristiani, Pierangela; Trasatti, Stefano; Li, Baikun; Schuler, Andrew J

    2014-07-01

    Activated carbon (AC) is employed as a cost-effective catalyst for cathodic oxygen reduction in microbial fuel cells (MFC). The fabrication protocols of AC-based cathodes are conducted at different applied pressures (175-3500 psi) and treatment temperatures (25-343°C). The effects of those parameters along with changes in the surface morphology and chemistry on the cathode performances are comprehensively examined. The cathodes are tested in a three-electrode setup and explored in single chamber membraneless MFCs (SCMFCs). The results show that the best performance of the AC-based cathode is achieved when a pressure of 1400 psi is applied followed by heat treatment of 150-200°C for 1h. The influence of the applied pressure and the temperature of the heat treatment on the electrodes and SCMFCs is demonstrated as the result of the variation in the transfer resistance, the surface morphology and surface chemistry of the AC-based cathodes tested.

  18. Speeding the transition: Designing a fuel-cell hypercar

    Energy Technology Data Exchange (ETDEWEB)

    Williams, B.D.; Moore, T.C.; Lovins, A.B. [Rocky Mountain Inst., Snowmass, CO (United States). Hypercar Center

    1997-12-31

    A rapid transformation now underway in automotive technology could accelerate the transition to transportation powered by fuel cells. Ultralight, advanced-composite, low-drag, hybrid-electric hypercars--using combustion engines--could be three- to fourfold more efficient and one or two orders of magnitude cleaner than today`s cars, yet equally safe, sporty, desirable, and (probably) affordable. Further, important manufacturing advantages--including low tooling and equipment costs, greater mechanical simplicity, autobody parts consolidation, shorter product cycles, and reduced assembly effort and space--permit a free-market commercialization strategy. This paper discusses a conceptual hypercar powered by a proton-exchange-membrane fuel cell (PEMFC). It outlines the implications of platform physics and component selection for the vehicle`s mass budget and performance. The high fuel-to-traction conversion efficiency of the hypercar platform could help automakers overcome the Achilles` heel of hydrogen-powered vehicles: onboard storage. Moreover, because hypercars would require significantly less tractive power, and even less fuel-cell power, they could adopt fuel cells earlier, before fuel cells` specific cost, mass, and volume have fully matured. In the meantime, commercialization in buildings can help prepare fuel cells for hypercars. The promising performance of hydrogen-fueled PEMFC hypercars suggests important opportunities in infrastructure development for direct-hydrogen vehicles.

  19. Modeling a reversible solid oxide fuel cell as a storage device within AC power networks

    Energy Technology Data Exchange (ETDEWEB)

    Ren, J.; Roscoe, A.J.; Burt, G. [Department of Electronic and Electrical Engineering, Royal College, University of Strathclyde, Glasgow (United Kingdom); Gamble, S.R.; Irvine, J.T.S. [School of Chemistry, University of St. Andrews, Purdie Building, St. Andrews (United Kingdom)

    2012-10-15

    A reversible solid oxide fuel cell (RSOFC) system, consisting of a RSOFC stack, heat store, and electrical inverters to convert DC to AC power, is shown by computer modeling to have the potential to efficiently store electrical energy. This paper describes the modeling of a single RSOFC, based on a proposed cell geometry, empirical data on the resistivities of the components, and calculation of activation and diffusion polarization resistances from electrochemical theory. Data from ac impedance spectroscopy measurements on symmetrical cells are used to model RSOFC impedance. A RSOFC stack is modeled by electrically linking the individual cells inside a pressurized vessel. A phase change heat store is added to improve energy storage efficiency. The model is implemented in MATLAB {sup registered} /Simulink {sup registered}. Two competing inverter control schemes are compared, trading off DC bus ripple against AC power quality. It is found that selection of appropriate DC bus capacitance is important in certain scenarios, with potential system cost implications. It is shown that the system can store electrical energy at an efficiency of 64% over a single discharge-charge cycle, i.e., hydrogen to electricity and heat to hydrogen. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. BC Transit Fuel Cell Bus Project Evaluation Results: Second Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Post, M.

    2014-09-01

    Second report evaluating a fuel cell electric bus (FCEB) demonstration led by British Columbia Transit (BC Transit) in Whistler, Canada. BC Transit is collaborating with the California Air Resources Board and the U.S. Department of Energy's National Renewable Energy Laboratory to evaluate the buses in revenue service. NREL published its first report on the demonstration in February 2014. This report is an update to the previous report; it covers 3 full years of revenue service data on the buses from April 2011 through March 2014 and focuses on the final experiences and lessons learned.

  1. Influence of the ac Stark effect on multiphoton transitions in molecules

    Science.gov (United States)

    Meerts, W. Leo; Ozier, Irving; Hougen, Jon T.

    1989-05-01

    A multiphoton mechanism for molecular beam transitions is presented which relies on a large first-order ac Stark effect to modulate the energy separation of the initial and final states of the multiphoton transition, but which does not require the presence of any intermediate level(s). The theoretical formalism uses ideas from the laser multiphoton literature for a two-level system interacting with a monochromatic electromagnetic radiation field, together with a close analog of the rotating wave approximation. The diagonal matrix elements of the Hamiltonian operator corresponding to the large ac Stark effect are removed by a mathematical substitution which in effect transforms appropriate differences of these diagonal elements into transition moments involving higher harmonics of the frequency of the monochromatic radiation field. The electric field strength of the true monochromatic radiation field is ``distributed'' among the higher harmonics of the effective field according to an expression involving Bessel functions. Because these Bessel functions are bounded, there exists for a given time t of exposure to the radiation, a threshold for the magnitude of the transition dipole matrix element coupling the two levels: Below this threshold, the transition probability in a traditional one-photon molecular beam electric resonance experiment cannot be made unity simply by increasing the amplitude of the radiation field. In fact, if the coupling matrix element is small enough, the molecular beam electric resonance signal cannot be detected within exposure time t. The algebraic formalism described above is checked by computer solution of an initial value problem involving four real coupled linear differential equations. It is then used to explain the multiphoton transitions previously observed in molecular beam electric resonance studies on the two symmetric top molecules OPF3 and CH3 CF3, where the number of photons involved in a given transition varies from 1

  2. Leveraging Fuel Subsidy Reform for Transition in Yemen

    Directory of Open Access Journals (Sweden)

    Olivier Ecker

    2012-10-01

    Full Text Available Yemen is currently undergoing a major political transition, yet many economic challenges—including fuel subsidy reform—remain highly relevant. To inform the transition process with respect to a potential subsidy reform, we use a dynamic computable general equilibrium and microsimulation model for Yemen; we show that overall growth effects of subsidy reduction are positive in general, but poverty can increase or decrease depending on reform design. A promising strategy for a successful reform combines fuel subsidy reduction with direct income transfers to the poorest one-third of households during reform, and productivity-enhancing investment in infrastructure, plus fiscal consolidation. Public investments should be used for integrating economic spaces and restructuring of agricultural, industrial and service value chains in order to create a framework that encourages private-sector-led and job-creating growth.

  3. The ac Stark shifts of the terahertz clock transitions of barium

    Institute of Scientific and Technical Information of China (English)

    余庚华; 耿鹰鸽; 李隆; 周超; 段丞博; 柴瑞鹏; 杨永明

    2015-01-01

    Wavelength-dependent AC Stark shifts and magic wavelengths of the terahertz clock transitions between the metastable triplet states 6s5d 3D1 and 6s5d 3D2 are investigated with considering the optical lattice trapping of barium atoms with the linearly polarized laser. The trap depths and the slopes of light shift difference with distinct magic wave-lengths of the optical lattices are also discussed in detail. Several potentially suitable working points for the optical lattice trapping laser are recommended and selected from these magic wavelengths.

  4. Investigation of the hydrogen release incident at the AC Transit Emeryville Facility.

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Aaron P.; San Marchi, Christopher W.; Levin, Jamie; Butler, Dennis

    2012-06-01

    This report summarizes the investigation of the release of approximately 300kg of hydrogen at the AC Transit Facility in Emeryville, CA. The hydrogen release was avoidable in both the root cause and contributing factors. The report highlights the need for communication in all phases of project planning and implementation. Apart from the failed valve, the hydrogen system functioned as designed, venting the hydrogen gas a safe distance above surrounding structures and keeping the subsequent fire away from personnel and equipment. The Emeryville Fire Department responded appropriately given the information provided to the Incident Commander. No injuries or fatalities resulted from the incident.

  5. Investigation of the Interfacial Transition Zone between Aggregate-Cement Paste by AC Impedance Spectroscopy

    Institute of Scientific and Technical Information of China (English)

    KONG Lijuan; HOU Lirong; WANG Yuhua; SUN Guowen

    2016-01-01

    Three different types and sizes of coarse aggregate were chosen, and the alternating current (AC) impedance of cement paste samples with and without aggregate was measured at different curing ages. Based on Song’s equivalent circuit model, the electrical properties from the AC impedance results were obtained, and the resistance of connected pores RCCP was used to characterize the microstructure of the interfacial transition zone (ITZ). The results show that the RCCP of concrete sample with aggregate is lower than that of cement paste sample, which indicates that the introduction of aggregate in cement paste makes the ITZ porous. Furthermore, for the same type of aggregate, an increase in particle size leads to a more porous ITZ, which accounts for the “water effect” and a larger aggregate would accumulate a thicker water iflm around it. In addition, for the same size of aggregate, the physical interaction between aggregate and cement paste is dominant in early age, and the microstructure of the ITZ around limestone aggregate is denser, which mainly depends on its rough surface and high water absorption. However, the microstructures of the ITZ around granite and basalt aggregates are denser in later age, which may be due to their higher chemical activity, and the chemical interaction between them and cement paste resulting in the generation of more hydrates. AC impedance spectroscopy thus proves to be powerful for evaluation of the microstructure of the ITZ.

  6. AC-field-induced quantum phase transitions in density of states

    Science.gov (United States)

    Yang, Kai-Hua; Liu, Kai-Di; Wang, Huai-Yu; Qin, Chang-Dong

    2016-02-01

    We investigate the joint effects of the intralead electron interaction and an external alternating gate voltage on the time-averaged local density of states (DOSs) of a quantum dot coupled to two Luttinger-liquid leads in the Kondo regime. A rich dependence of the DOSs on the driving amplitude and intralead interaction is demonstrated. We show that the feature is quite different for different interaction strengths in the presence of the ac field. It is shown that the photon-assisted transport processes cause an additional splitting of the Kondo peak or dip, which exhibits photon-assisted single-channel (1CK) or two-channel Kondo (2CK) physics behavior. The phase transition between photon-assisted 1CK and 2CK physics occurs when the interaction strength is moderately strong. The inelastic channels associated with photon-assisted electron tunneling can dominate electron transport for weak interaction when the ac amplitude is greater than the frequency by one order of magnitude. In the limit of strong interaction the DOSs scale as a power-law behavior which is strongly affected by the ac field.

  7. SunLine Transit Agency Fuel Cell Transit Bus: Fifth Evaluation Report (Report and Appendices)

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2009-08-01

    This report describes operations at SunLine Transit Agency for a prototype fuel cell bus and five compressed natural gas (CNG) buses. This is the fifth evaluation report for this site, and it describes results and experiences from October 2008 through June 2009. These results are an addition to those provided in the previous four evaluation reports.

  8. SunLine Transit Agency Fuel Cell Transit Bus: Fourth Evaluation Report (Report and Appendices)

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2009-01-01

    This report describes operations at SunLine Transit Agency for a prototype fuel cell bus and five new compressed natural gas (CNG) buses. This is the fourth evaluation report for this site, and it describes results and experiences from April 2008 through October 2008. These results are an addition to those provided in the previous three evaluation reports.

  9. Connecticut Transit (CTTRANSIT) Fuel Cell Transit Bus: Second Evaluation Report and Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2009-05-01

    This report describes operations at Connecticut Transit (CTTRANSIT) in Hartford for one prototype fuel cell bus and three new diesel buses operating from the same location. The evaluation period in this report (January 2008 through February 2009) has been chosen to coincide with a UTC Power propulsion system changeout that occurred on January 15, 2008.

  10. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2011

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.; Gikakis, C.

    2011-11-01

    This status report, fifth in a series of annual status reports from the U.S. Department of Energy's National Renewable Energy Laboratory (NREL), discusses the achievements and challenges of fuel cell propulsion for transit and summarizes the introduction of fuel cell transit buses in the United States. Progress this year includes an increase in the number of fuel cell electric buses (FCEBs), from 15 to 25, operating at eight transit agencies, as well as increased diversity of the fuel cell design options for transit buses. The report also provides an analysis of the combined results from fuel cell transit bus demonstrations evaluated by NREL with a focus on the most recent data through July 2011 including fuel cell power system reliability and durability; fuel economy; roadcall; and hydrogen fueling results. These evaluations cover 22 of the 25 FCEBs currently operating.

  11. Safety evaluation of a hydrogen fueled transit bus

    Energy Technology Data Exchange (ETDEWEB)

    Coutts, D.A.; Thomas, J.K.; Hovis, G.L.; Wu, T.T. [Westinghouse Savannah River Co., Aiken, SC (United States)

    1997-12-31

    Hydrogen fueled vehicle demonstration projects must satisfy management and regulator safety expectations. This is often accomplished using hazard and safety analyses. Such an analysis has been completed to evaluate the safety of the H2Fuel bus to be operated in Augusta, Georgia. The evaluation methods and criteria used reflect the Department of Energy`s graded approach for qualifying and documenting nuclear and chemical facility safety. The work focused on the storage and distribution of hydrogen as the bus motor fuel with emphases on the technical and operational aspects of using metal hydride beds to store hydrogen. The safety evaluation demonstrated that the operation of the H2Fuel bus represents a moderate risk. This is the same risk level determined for operation of conventionally powered transit buses in the United States. By the same criteria, private passenger automobile travel in the United States is considered a high risk. The evaluation also identified several design and operational modifications that resulted in improved safety, operability, and reliability. The hazard assessment methodology used in this project has widespread applicability to other innovative operations and systems, and the techniques can serve as a template for other similar projects.

  12. Stick-Slip to Sliding Transition of Dynamic Contact Lines under AC Electrowetting.

    Science.gov (United States)

    't Mannetje, D J C M; Mugele, F; van den Ende, D

    2013-12-03

    We show that at low velocities the dynamics of a contact line of a water drop moving over a Teflon-like surface under ac electrowetting must be described as stick-slip motion, rather than one continuous movement. At high velocities we observe a transition to a slipping regime. In the slipping regime the observed dependence of the contact angle is well described by a linearization of both the hydrodynamic and the molecular-kinetic model for the dynamic contact line behavior. The overall geometry of the drop also has a strong influence on the contact angle: if the drop is confined to a disk-like shape with radius R, much larger than the capillary length, and height h, smaller than the capillary length, the advancing angle increases steeper with velocity as the aspect ratio h/R is smaller. Although influence of the flow field near a contact line on the contact angle behavior has also been observed in other experiments, these observations do not fit either model. Finally, in our ac experiments no sudden increase of the hysteresis beyond a certain voltage and velocity was observed, as reported by other authors for a dc voltage, but instead we find with increasing voltage a steady decrease of the hysteresis.

  13. Transitioning nuclear fuel cycles with uncertain fast reactor costs

    Energy Technology Data Exchange (ETDEWEB)

    Phathanapirom, U.B., E-mail: bphathanapirom@utexas.edu; Schneider, E.A.

    2016-06-15

    This paper applies a novel decision making methodology to a case study involving choices leading to the transition from the current once-through light water reactor fuel cycle to one relying on continuous recycle of plutonium and minor actinides in fast reactors in the face of uncertain fast reactor capital costs. Unique to this work is a multi-stage treatment of a range of plausible trajectories for the evolution of fast reactor capital costs over time, characterized by first-of-a-kind penalties as well as time- and unit-based learning. The methodology explicitly incorporates uncertainties in key parameters into the decision-making process by constructing a stochastic model and embedding uncertainties as bifurcations in the decision tree. “Hedging” strategies are found by applying a choice criterion to select courses of action which mitigate “regrets”. These regrets are calculated by evaluating the performance of all possible transition strategies for every feasible outcome of the uncertain parameter. The hedging strategies are those that preserve the most flexibility for adjusting the fuel cycle strategy in response to new information as uncertainties are resolved.

  14. Reducing transit bus emissions: Alternative fuels or traffic operations?

    Science.gov (United States)

    Alam, Ahsan; Hatzopoulou, Marianne

    2014-06-01

    In this study, we simulated the operations and greenhouse gas (GHG) emissions of transit buses along a busy corridor and quantified the effects of two different fuels (conventional diesel and compressed natural gas) as well as a set of driving conditions on emissions. Results indicate that compressed natural gas (CNG) reduces GHG emissions by 8-12% compared to conventional diesel, this reduction could increase to 16% with high levels of traffic congestion. However, the benefits of switching from conventional diesel to CNG are less apparent when the road network is uncongested. We also investigated the effects of bus operations on emissions by applying several strategies such as transit signal priority (TSP), queue jumper lanes, and relocation of bus stops. Results show that in congested conditions, TSP alone can reduce GHG emissions by 14% and when combined with improved technology; a reduction of 23% is achieved. The reduction benefits are even more apparent when other transit operational improvements are combined with TSP. Finally a sensitivity analysis was performed to investigate the effect of operational improvements on emissions under varying levels of network congestion. We observe that under “extreme congestion”, the benefits of TSP decrease.

  15. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2013

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Gikakis, C.

    2013-12-01

    This report is the seventh in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. The report also provides a snapshot of current FCEB performance results from August 2012 through July 2013 for five FCEB demonstrations at four transit agencies.

  16. Transition Analysis of Promising U.S. Future Fuel Cycles Using ORION

    Energy Technology Data Exchange (ETDEWEB)

    Sunny, Eva E. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Worrall, Andrew [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Peterson, Joshua L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Powers, Jeffrey J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gehin, Jess C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gregg, Robert [Preston Laboratory, Springfields Works (United Kingdom)

    2015-01-01

    The US Department of Energy Office of Fuel Cycle Technologies performed an evaluation and screening (E&S) study of nuclear fuel cycle options to help prioritize future research and development decisions. Previous work for this E&S study focused on establishing equilibrium conditions for analysis examples of 40 nuclear fuel cycle evaluation groups (EGs) and evaluating their performance according to a set of 22 standardized metrics. Following the E&S study, additional studies are being conducted to assess transitioning from the current US fuel cycle to future fuel cycle options identified by the E&S study as being most promising. These studies help inform decisions on how to effectively achieve full transition, estimate the length of time needed to undergo transition from the current fuel cycle, and evaluate performance of nuclear systems and facilities in place during the transition. These studies also help identify any barriers to achieve transition. Oak Ridge National Laboratory (ORNL) Fuel Cycle Options Campaign team used ORION to analyze the transition pathway from the existing US nuclear fuel cycle—the once-through use of low-enriched-uranium (LEU) fuel in thermal-spectrum light water reactors (LWRs) —to a new fuel cycle with continuous recycling of plutonium and uranium in sodium fast reactors (SFRs). This paper discusses the analysis of the transition from an LWR to an SFR fleet using ORION, highlights the role of lifetime extensions of existing LWRs to aid transition, and discusses how a slight delay in SFR deployment can actually reduce the time to achieve an equilibrium fuel cycle.

  17. Spin density wave (SDW) transition in Ru doped BaFeAs{sub 2} investigated by AC steady state calorimetry

    Energy Technology Data Exchange (ETDEWEB)

    Vinod, K., E-mail: vinod@igcar.gov.in; Sharma, Shilpam; Sundar, C. S.; Bharathi, A. [Low Temperature Studies Section, Condensed Matter Physics Division, Materials Science Group, Indira Gandhi Centre for Atomic Research (IGCAR), Kalpakkam-603102 (India)

    2015-06-24

    Heat capacity measurements were done on sub-micron sized BaFe{sub 2−x}Ru{sub x}As{sub 2} single crystals using thin film membrane based the AC steady state calorimetry technique. Noticeable thermal hysteresis is observed in the heat capacity of the BaFe{sub 2−x}Ru{sub x}As{sub 2} during cooling and warming cycles, indicating first order nature of the SDW transition.

  18. Bay Area Transit Agencies Propel Fuel Cell Buses Toward Commercialization (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2010-07-01

    This fact sheet describes the Zero Emission Bay Area (ZEBA) demonstration of the next generation of fuel cells buses. Several transit agencies in the San Francisco Bay Area are participating in demonstrating the largest single fleet of fuel cell buses in the United States.

  19. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2012

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Chandler, Kevin [Battelle, Columbus, OH (United States); Gikakis, Christina [Federal Transit Administration, Washington, DC (United States)

    2012-11-01

    This report is the sixth in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. The report also provides a snapshot of current FCEB performance results over the last year.

  20. SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: Fourth Results Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2013-01-01

    SunLine Transit Agency, which provides public transit services to the Coachella Valley area of California, has demonstrated hydrogen and fuel cell bus technologies for more than 10 years. In May 2010, SunLine began demonstrating the advanced technology (AT) fuel cell bus with a hybrid electric propulsion system, fuel cell power system, and lithium-based hybrid batteries. This report describes operations at SunLine for the AT fuel cell bus and five compressed natural gas buses. The U.S. Department of Energy's National Renewable Energy Laboratory (NREL) is working with SunLine to evaluate the bus in real-world service to document the results and help determine the progress toward technology readiness. NREL has previously published three reports documenting the operation of the fuel cell bus in service. This report provides a summary of the results with a focus on the bus operation from February 2012 through November 2012.

  1. SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: First Results Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2011-03-01

    This report describes operations at SunLine Transit Agency for their newest prototype fuel cell bus and five compressed natural gas (CNG) buses. In May 2010, SunLine began operating its sixth-generation hydrogen fueled bus, an Advanced Technology (AT) fuel cell bus that incorporates the latest design improvements to reduce weight and increase reliability and performance. The agency is collaborating with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) to evaluate the bus in revenue service. This report provides the early data results and implementation experience of the AT fuel cell bus since it was placed in service.

  2. Advanced Nuclear Fuel Cycle Transitions: Optimization, Modeling Choices, and Disruptions

    Science.gov (United States)

    Carlsen, Robert W.

    Many nuclear fuel cycle simulators have evolved over time to help understan the nuclear industry/ecosystem at a macroscopic level. Cyclus is one of th first fuel cycle simulators to accommodate larger-scale analysis with it liberal open-source licensing and first-class Linux support. Cyclus also ha features that uniquely enable investigating the effects of modeling choices o fuel cycle simulators and scenarios. This work is divided into thre experiments focusing on optimization, effects of modeling choices, and fue cycle uncertainty. Effective optimization techniques are developed for automatically determinin desirable facility deployment schedules with Cyclus. A novel method fo mapping optimization variables to deployment schedules is developed. Thi allows relationships between reactor types and scenario constraints to b represented implicitly in the variable definitions enabling the usage o optimizers lacking constraint support. It also prevents wasting computationa resources evaluating infeasible deployment schedules. Deployed power capacit over time and deployment of non-reactor facilities are also included a optimization variables There are many fuel cycle simulators built with different combinations o modeling choices. Comparing results between them is often difficult. Cyclus flexibility allows comparing effects of many such modeling choices. Reacto refueling cycle synchronization and inter-facility competition among othe effects are compared in four cases each using combinations of fleet of individually modeled reactors with 1-month or 3-month time steps. There are noticeable differences in results for the different cases. The larges differences occur during periods of constrained reactor fuel availability This and similar work can help improve the quality of fuel cycle analysi generally There is significant uncertainty associated deploying new nuclear technologie such as time-frames for technology availability and the cost of buildin advanced reactors

  3. ac hopping magnetotransport across the spin-flop transition in lightly doped La2CuO4

    Science.gov (United States)

    Sushkov, Oleg P.; Kotov, Valeri N.

    2008-02-01

    The weak ferromagnetism present in insulating La2CuO4 at low doping leads to a spin flop transition, and to transverse (interplane) hopping of holes in a strong external magnetic field. This results in a dimensional crossover 2D→3D for the in-plane transport, which in turn leads to an increase of the hole’s localization length and increased conduction. We demonstrate theoretically that as a consequence of this mechanism, a frequency-dependent jump of the in-plane ac hopping conductivity occurs at the spin flop transition. We predict the value and the frequency dependence of the jump. Experimental studies of this effect would provide important confirmation of the emerging understanding of lightly doped insulating La2-xSrxCuO4 .

  4. AC impedance modelling study on porous electrodes of proton exchange membrane fuel cells using an agglomerate model

    Science.gov (United States)

    Gerteisen, Dietmar; Hakenjos, Alex; Schumacher, Jürgen O.

    A one-dimensional model of the PEM fuel cell cathode is developed to analyse ac impedance spectra and polarisation curves. The porous gas diffusion electrode is assumed to consist of a network of dispersed catalyst (Pt/C) forming spherically shaped agglomerated zones that are filled with electrolyte. The coupled differential equation system describes: ternary gas diffusion in the backing (O2 , N2 , water vapour), Fickian diffusion and Tafel kinetics for the oxygen reduction reaction (ORR) inside the agglomerates, proton migration with ohmic losses and double-layer charging in the electrode. Measurements are made of a temperature-controlled fuel cell with a geometric area of 1.4 cm × 1.4 cm. Lateral homogeneity is ensured by using a high stoichiometry of λmin . The model predicts the behaviour of measured polarisation curves and impedance spectra. It is found that a better humidification of the electrode leads to a higher volumetric double-layer capacity. The catalyst layer resistance shows the same behaviour depending on the humidification as the membrane resistance. Model parameters, e.g. Tafel slope, ionic resistance and agglomerate radius are varied. A sensitivity analysis of the model parameters is conducted.

  5. Using Checklists to Assess Your Transition to Alternative Fuels: A Technical Reference

    Energy Technology Data Exchange (ETDEWEB)

    Risch, C. E. [Argonne National Lab. (ANL), Argonne, IL (United States); Santini, D. J. [Argonne National Lab. (ANL), Argonne, IL (United States); Johnson, L. R. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2016-12-01

    The Checklist for Transition to New Alternative Fuel(s) was published in September 2011 by Chuck Risch and Dan Santini. Many improvements, described below, have been incorporated into this current document, Checklists for Assessing the Transitions to New Highway Fuels.2 Further, the original authors and Larry Johnson, co-author of the current report, identified a need for a succinct version of the full report and prepared a brochure based on it to aid busy decisionmakers: Check It Out: Using Checklists to Assess Your Transition to Alternative Fuels.2 These checklists are tools for those stakeholders charged with determining a feasible alternative fuel or fuels for highway transportation systems of the future. The original had four major players whose needs had to be satisfied for a successful transition. The term “activist,” intended to encompass environmental and other special interests, was included in the “customers” category. Activists are customers of the government in the sense that they organize citizens to exert political pressure to regulate the design of vehicles, fuel infrastructure, and roadway networks. Many who evaluate alternative fuels view activists, particularly environmental activists, as a separate category. Further, “activist” has become a pejorative term to many people. Therefore, we have used the word “advocate” or “activist/advocate” instead. Thus, in this update we recognize that environmental and other activists/advocates have been--and will continue to be--a powerful force promoting change in the nature of the fuels that are used in transportation.

  6. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2012

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chander, K.; Gikakis, C.

    2012-11-01

    This report is the sixth in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. The report also provides a snapshot of current FCEB performance results over the last year. There are 25 active FCEBs in demonstrations this year at eight locations.

  7. Fuel Cell Transit Bus Evaluations: Joint Evaluation Plan for the U.S. Department of Energy and the Federal Transit Administration (Report and Appendix)

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2010-11-01

    This document describes the fuel cell transit bus evaluations performed by the National Renewable Energy Laboratory (NREL) and funded by the U.S. Department of Energy (DOE) and the U.S. Department of Transportation's Federal Transit Administration (FTA). This document provides a description of the demonstration sites, funding sources, and data collection activities for fuel cell transit bus evaluations currently planned from FY10 through FY12.

  8. Diffusion and Gas Conversion Analysis of Solid Oxide Fuel Cells at Loads via AC Impedance

    Directory of Open Access Journals (Sweden)

    Robert U. Payne

    2011-01-01

    Full Text Available Impedance measurements were conducted under practical load conditions in solid oxide fuel cells of differing sizes. For a 2 cm2 button cell, impedance spectra data were separately measured for the anode, cathode, and total cell. Improved equivalent circuit models are proposed and applied to simulate each of measured impedance data. Circuit elements related to the chemical and physical processes have been added to the total-cell model to account for an extra relaxation process in the spectra not measured at either electrode. The processes to which elements are attributed have been deduced by varying cell temperature, load current, and hydrogen concentration. Spectra data were also obtained for a planar stack of five 61 cm2 cells and the individual cells therein, which were fitted to a simplified equivalent circuit model of the total button cell. Similar to the button cell, the planar cells and stack exhibit a pronounced low-frequency relaxation process, which has been attributed to concentration losses, that is, the combined effects of diffusion and gas conversion. The simplified total-cell model approximates well the dynamic behavior of the SOFC cells and the whole stack.

  9. Dynamic Analysis of Nuclear Waste Generation Based on Nuclear Fuel Cycle Transition Scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, S. R. [University of Science and Technology, Daejeon (Korea, Republic of); Ko, W. I. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    According to the recommendations submitted by the Public Engagement Commission on Spent Nuclear Fuel Management (PECOS), the government was advised to pick the site for an underground laboratory and interim storage facilities before the end of 2020 followed by the related research for permanent and underground disposal of spent fuel after 10 years. In the middle of the main issues, the factors of environmentally friendly and safe way to handle nuclear waste are inextricable from nuclear power generating nation to ensure the sustainability of nuclear power. For this purposes, the closed nuclear fuel cycle has been developed regarding deep geological disposal, pyroprocessing, and burner type sodium-cooled fast reactors (SFRs) in Korea. Among two methods of an equilibrium model and a dynamic model generally used for screening nuclear fuel cycle system, the dynamic model is more appropriate to envisage country-specific environment with the transition phase in the long term and significant to estimate meaningful impacts based on the timedependent behavior of harmful wastes. This study aims at analyzing the spent nuclear fuel generation based on the long-term nuclear fuel cycle transition scenarios considered at up-to-date country specific conditions and comparing long term advantages of the developed nuclear fuel cycle option between once-through cycle and Pyro-SFR cycle. In this study, a dynamic analysis was carried out to estimate the long-term projection of nuclear electricity generation, installed capacity, spent nuclear fuel arising in different fuel cycle scenarios based on the up-to-date national energy plans.

  10. Comparative analysis of US and Canadian transit ridership response to rising fuel prices

    Energy Technology Data Exchange (ETDEWEB)

    Haire, A.R.; Machemeehl, R.B. [Texas Univ., Austin, TX (United States)

    2007-07-01

    Since worldwide gasoline prices have risen significantly over the last three years, several transit agencies have indicated that fuel price growth is the major impetus to increased transit ridership. This paper presented the results of a research project that builds upon previous research conducted in 2006 which found high correlation between fuel price and transit ridership in several historically auto-based United States cities. This comparative research attempted to determine whether a similar pattern of fuel cost-driven mode choice could be observed in three Canadian cities. The selected cities, Calgary, Ottawa, and Vancouver, were chosen based on their relative levels of auto-orientation and the extent and variety of transit services offered. It was concluded that although ridership and fuel prices grew in all three cities, the rates of growth do not correspond and correlation is unlikely. Reasons for this inconsistency with patterns in American cities may involve higher-density city layouts and commute distances. 3 refs., 3 tabs., 7 figs.

  11. Design of transition cores of RSG GAS (MPR-30) with higher loading silicide fuel

    Energy Technology Data Exchange (ETDEWEB)

    Liem, Peng Hong, E-mail: liemph@nais.ne.j [Research Laboratory for Nuclear Reactors, Tokyo Institute of Technology, O-okayama, Meguro, Tokyo 152-8550 (Japan); Sembiring, Tagor Malem [Center for Reactor Technology and Nuclear Safety, National Nuclear Energy Agency (Batan), Puspiptek, Serpong, Tangerang 15310 (Indonesia)

    2010-06-15

    A procedure of designing transition cores to achieve the equilibrium silicide core of RSG GAS with higher fuel loading of 300 g U/fuel element (FE) (meat density of 3.55 g U/cm{sup 3}) has been proposed. In the proposed procedure, the EOC excess reactivity of each transition core is minimized in order to satisfy the safety design limit of one-stuck-rod sub-criticality margin while keeping the maximum of radial power peaking factor below the allowable value. Under the design procedure, the initial fuel loadings are increased gradually in two steps, i.e. from 250 to 275 g U/FE followed by 275-300 g U/FE. The analysis results show that all transition cores can satisfy all design requirements and safety limits. We concluded that the obtained transition core design should be adopted into the future core conversion program of RSG GAS. The targeted silicide core can be achieved practically in at least 24 transition cores.

  12. SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: Third Results Reports

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2012-05-01

    This report describes operations at SunLine Transit Agency for their newest prototype fuel cell bus and five compressed natural gas (CNG) buses. In May 2010, SunLine began operating its sixth-generation hydrogen fueled bus, an Advanced Technology (AT) fuel cell bus that incorporates the latest design improvements to reduce weight and increase reliability and performance. The agency is collaborating with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) to evaluate the bus in revenue service. NREL has previously published two reports documenting the operation of the fuel cell bus in service. This report provides a summary of the results with a focus on the bus operation from July 2011 through January 2012.

  13. SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: Second Results Report and Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2011-10-01

    This report describes operations at SunLine Transit Agency for their newest prototype fuel cell bus and five compressed natural gas (CNG) buses. In May 2010, SunLine began operating its sixth-generation hydrogen fueled bus, an Advanced Technology (AT) fuel cell bus that incorporates the latest design improvements to reduce weight and increase reliability and performance. The agency is collaborating with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) to evaluate the bus in revenue service. This is the second results report for the AT fuel cell bus since it was placed in service, and it focuses on the newest data analysis and lessons learned since the previous report. The appendices, referenced in the main report, provide the full background for the evaluation. They will be updated as new information is collected but will contain the original background material from the first report.

  14. Superconducting transition in ruthenocuprate RuSr2GdCu2O8 viewed from the studies of the imaginary part of ac susceptibility

    Science.gov (United States)

    Zivkovic, I.; Drobac, D.; Ariosa, D.; Berger, H.; Pavuna, D.; Prester, M.

    2002-12-01

    We have measured two structurally similar superconducting systems, RuSr2GdCu2O8 and GdBa2Cu3O7 by means of high-resolution ac susceptibility. The real and the imaginary part of ac susceptibility of both bulk-ceramic and powdered samples have been studied down to the very small magnetic-field levels. We show that there are significant differences in the evolution of superconductivity in the two studied superconducting systems. In particular, we show that the superconducting transition in the grains in RuSr2GdCu2O8 system is masked with intrinsic magnetism of complex origin.

  15. Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration Results. Fourth Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, Leslie [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2015-07-02

    This report presents results of a demonstration of fuel cell electric buses (FCEB) operating in Oakland, California. Alameda-Contra Costa Transit District (AC Transit) leads the Zero Emission Bay Area (ZEBA) demonstration, which includes 12 advanced-design fuel cell buses and two hydrogen fueling stations. The FCEBs in service at AC Transit are 40-foot, low-floor buses built by Van Hool with a hybrid electric propulsion system that includes a US Hybrid fuel cell power system and EnerDel lithium-based energy storage system. The buses began revenue service in May 2010.

  16. Flame spread over electrical wire with AC electric fields: Internal circulation, fuel vapor-jet, spread rate acceleration, and molten insulator dripping

    KAUST Repository

    Lim, Seungjae

    2015-04-01

    The effect of electric field on the characteristics of flame spread along a polyethylene (PE) insulated electrical wire was investigated experimentally by varying the AC frequency and voltage applied to the wire. The results showed that the flame spread rate was accelerated due to the convergence of electric flux near the end of wire, having three distinct regimes depending on applied voltage. In each regime, several subregimes could be identified depending on AC frequency. Flame shape (height and width) and slanted direction of the spreading flame were influenced differently. Fuel-vapor jets were ejected from the molten PE surface even for the baseline case without the application of an electric field; this could be attributed to the bursting of fuel vapor bubbles generated from internal boiling at the molten PE surface. An internal circulation of molten-PE was also observed as a result of non-uniform heating by the spreading flame. In the high voltage regime with a high AC frequency, excessive dripping of molten PE led to flame extinction.

  17. The transition to hydrogen as a transportation fuel: Costs and infrastructure requirements

    Energy Technology Data Exchange (ETDEWEB)

    Schock, R.N.; Berry, G.D.; Ramback, G.D.; Smith, J.R.

    1996-03-20

    Hydrogen fuel, used in an internal combustion engine optimized for maximum efficiency and as part of a hybrid-electric vehicle, will give excellent performance and range with emissions below one-tenth the ultra-low emission vehicle standards being considered in California as Equivalent Zero Emission Vehicles. These vehicles can also be manufactured with increased but not excessive cost. Hydrogen-fueled engines have demonstrated indicated efficiencies of more than 50% under lean operation. Combining optimized engines and other advanced components, the overall vehicle efficiency should approach 40%, compared with 13% for a conventional vehicle in the urban driving cycle. The optimized engine-generator unit is the mechanical equivalent of the fuel cell but at a cost competitive with today`s engines. The increased efficiency of hybrid-electric vehicles now makes hydrogen fuel competitive with today`s conventional vehicles. Conservative analysis of the infrastructure options to support a transition to a hydrogen-fueled light-duty fleet indicates that hydrogen may be utilized at a total cost comparable to the 3.1 cents/km U.S. vehicle operators pay today while using conventional automobiles. Both on-site production by electrolysis or reforming of natural gas and liquid hydrogen distribution offer the possibility of a smooth transition by taking advantage of existing large-scale energy infrastructures. Eventually, renewable sources of electricity and scalable methods of making hydrogen will have lower costs than today. With a hybrid-electric propulsion system, the infrastructure to supply hydrogen and the vehicles to use it can be developed today and thus be in place when fuel cells become economical for vehicle use.

  18. Fuel oxidation at the walk-to-run-transition in humans.

    Science.gov (United States)

    Ganley, Kathleen J; Stock, Anthony; Herman, Richard M; Santello, Marco; Willis, Wayne T

    2011-05-01

    Multiple factors (including anthropometric, kinetic, mechanical, kinematic, perceptual, and energetic factors) are likely to play a role in the walk-to-run transition in humans. The primary purpose of the present study was to consider an additional factor, the metabolic fuel source. Indirect calorimetry was used to measure fuel oxidation, and perception of effort was recorded as 10 overnight-fasted adults locomoted on a level treadmill at speeds progressing from 1.56 to 2.46 m s(-1) in increments of 0.11 m s(-1) and 10.0 minutes under 3 conditions: (1) unconstrained choice of gait, (2) walking at all speeds, and (3) running at all speeds. The preferred transition speed was 2.08 ± 0.03 m s(-1). Gait transition from walking to running increased oxygen consumption rate, decreased the perception of effort, and decreased the rate of carbohydrate oxidation. We propose that, in an evolutionary context, gait transition, guided by the perception of effort, can be viewed as a carbohydrate-sparing strategy.

  19. Solar Electricity and Solar Fuels: Status and Perspectives in the Context of the Energy Transition.

    Science.gov (United States)

    Armaroli, Nicola; Balzani, Vincenzo

    2016-01-04

    The energy transition from fossil fuels to renewables is already ongoing, but it will be a long and difficult process because the energy system is a gigantic and complex machine. Key renewable energy production data show the remarkable growth of solar electricity technologies and indicate that crystalline silicon photovoltaics (PV) and wind turbines are the workhorses of the first wave of renewable energy deployment on the TW scale around the globe. The other PV alternatives (e.g., copper/indium/gallium/selenide (CIGS) or CdTe), along with other less mature options, are critically analyzed. As far as fuels are concerned, the situation is significantly more complex because making chemicals with sunshine is far more complicated than generating electric current. The prime solar artificial fuel is molecular hydrogen, which is characterized by an excellent combination of chemical and physical properties. The routes to make it from solar energy (photoelectrochemical cells (PEC), dye-sensitized photoelectrochemical cells (DSPEC), PV electrolyzers) and then synthetic liquid fuels are presented, with discussion on economic aspects. The interconversion between electricity and hydrogen, two energy carriers directly produced by sunlight, will be a key tool to distribute renewable energies with the highest flexibility. The discussion takes into account two concepts that are often overlooked: the energy return on investment (EROI) and the limited availability of natural resources-particularly minerals-which are needed to manufacture energy converters and storage devices on a multi-TW scale.

  20. Technical Approach and Plan for Transitioning Spent Nuclear Fuel (SNF) Project Facilities to the Environmental Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    SKELLY, W.A.

    1999-10-06

    This document describes the approach and process in which the 100-K Area Facilities are to be deactivated and transitioned over to the Environmental Restoration Program after spent nuclear fuel has been removed from the K Basins. It describes the Transition Project's scope and objectives, work breakdown structure, activity planning, estimated cost, and schedule. This report will be utilized as a planning document for project management and control and to communicate details of project content and integration.

  1. Prediction of Emissions from Biodiesel Fueled Transit Buses Using Artificial Neural Networks

    Directory of Open Access Journals (Sweden)

    Abhisek Mudgal

    2011-06-01

    Full Text Available The growing demand of freight transportation and passenger cars has led to air pollution, green house gas emissions (especially CO2 and fuel supply concerns. Research has been carried out on biodiesel which is shown to generate lower emissions. However, the amount of emissions generated is not well understood which entails more vigorous data collection and development of emissions models. A comprehensive data collection plan was developed and emissions (NOx, HC, CO, CO2 and PM10 from biodiesel fueled transit buses were collected using a portable emissions measurement system (PEMS. Linear models were developed and tested for each emission. However, the models could not capture the emissions spikes well resulting in very low R2 values. Artificial neural networks (ANNs based models were then employed on this data because of their ability to handle nonlinearity and not requiring assumptions on the input data as needed by statistical models. Sensitivity analysis was performed on the input parameters, number of hidden layers, learning rate and learning algorithm to arrive at an optimum ANN architecture. The optimal architecture for this study was found to be two hidden layers with 50 hidden nodes for each of NOx, HC, CO, and PM and one hidden layer for CO2. The emissions were predicted using best-performance ANN models for each emission. Scatter-plots of observed versus predicted values showed R2 of 0.96, 0.94, 0.82, 0.98 and 0.78 for NOx, HC, CO, CO2 and PM emissions, respectively. Histogram on prediction error showed low frequency for large errors.

  2. Storage Free Smart Energy Management for Frequency Control in a Diesel-PV-Fuel Cell-Based Hybrid AC Microgrid.

    Science.gov (United States)

    Sekhar, P C; Mishra, S

    2016-08-01

    This paper proposes a novel, smart energy management scheme for a microgrid, consisting of a diesel generator and power electronic converter interfaced renewable energy-based generators, such as photovoltaic (PV) and fuel cell, for frequency regulation without any storage. In the proposed strategy, output of the PV is controlled in coordination with other generators using neurofuzzy controller, either only for transient frequency regulation or for both transient and steady-state frequency regulation, depending on the load demand, thereby eliminating the huge storage requirements. The option of demand response control is also explored along with the generation control. For accurate and quick tracking of maximum power point and its associated reserve power from the PV generator, this paper also proposes a novel adaptive-predictor-corrector-based tracking mechanism.

  3. Metal-insulator transition in AC{sub 60}:RbC{sub 60} and KC{sub 60}

    Energy Technology Data Exchange (ETDEWEB)

    Khazeni, K.; Crespi, V.H.; Hone, J.; Zettl, A.; Cohen, M.L. [Department of Physics, University of California at Berkeley, Berkeley, California 94720 (United States)]|[Materials Sciences Division, Lawrence Berkeley Laboratory, Berkeley, California 94720 (United States)

    1997-09-01

    At zero pressure polymerized RbC{sub 60} is an insulator, whereas polymerized KC{sub 60} is a metal with a slight low-temperature resistive upturn. We report measurements of the resistivity of RbC{sub 60} under pressure, finding a hysteretic resistive transition in RbC{sub 60} near 200 K at 5 kbar, at which point the material transforms from insulator to metal. Correcting the resistivity to constant volume, both materials are metallic below the transition with a common low-temperature resistive upturn which is suppressed under compression. {copyright} {ital 1997} {ital The American Physical Society}

  4. Critical factors in transitioning from fuel cell to cold fusion technology

    Energy Technology Data Exchange (ETDEWEB)

    Mcgraw, T.F.; Davis, R.R.

    1998-07-01

    The fuel cell industry possesses much of the required manufacturing equipment and knowledge-base (e.g., proton conduction and hydrogen safety) necessary to develop cold fusion systems. Key factors in making a transition to cold fusion technology are discussed. Loading of reaction material can be provided by electrolytic charging and high gas over-pressure. Effective pressures over 10,000 atmospheres are required in cold fusion systems, giving a loading of H/M = 1; and a combination of loading methods is highly desirable. Systems must be designed to provide continuous flow of hydrogen ions ({much{underscore}gt}10{sup 17}/sec for ten kilowatts), with an input power source of 50 watts (est.). Cold fusion experiments have shown that helium is formed during the reaction, and physical changes occur in the reaction material. These revelations impact design and operation of cold fusion systems, as the reaction material must be replaced periodically, while the systems must maintain integrity during operation. Safety and cost are also highly important considerations.

  5. Portable fuel cell systems for America's army: technology transition to the field

    Science.gov (United States)

    Patil, Ashok S.; Dubois, Terry G.; Sifer, Nicholas; Bostic, Elizabeth; Gardner, Kristopher; Quah, Michael; Bolton, Christopher

    The US Army Communications, Electronics Research Development and Engineering Center (CERDEC) envisions three thrust areas for portable fuel cell systems for military applications. These areas include soldier power (500 W), it is imperative that the fuel cell power units be able to operate on fuels within the military logistics chain [DOD 4140.25-M, DOD Directive 4140.25 (1993)]. CERDEC is currently conducting research on catalysts and microchannel fuel reformers that offer great promise for the reforming of diesel and JP-8 fuels into hydrogen. In addition to research work on PEM fuel cells and enabling technologies, the Army is also conducting research on direct methanol and solid oxide fuel cells, and combined heat and power applications utilizing new high temperature fuel cells.

  6. Optimization of fuel cell membrane electrode assemblies for transition metal ion-chelating ordered mesoporous carbon cathode catalysts

    OpenAIRE

    Johanna K. Dombrovskis; Cathrin Prestel; Anders E. C. Palmqvist

    2014-01-01

    Transition metal ion-chelating ordered mesoporous carbon (TM-OMC) materials were recently shown to be efficient polymer electrolyte membrane fuel cell (PEMFC) catalysts. The structure and properties of these catalysts are largely different from conventional catalyst materials, thus rendering membrane electrode assembly (MEA) preparation parameters developed for conventional catalysts not useful for applications of TM-OMC catalysts. This necessitates development of a methodology to incorporate...

  7. Nuclear Energy R&D Imperative 3: Enable a Transition Away from Fossil Fuel in the Transportation and Industrial Sectors

    Energy Technology Data Exchange (ETDEWEB)

    David Petti; J. Stephen Herring

    2010-03-01

    As described in the Department of Energy Office of Nuclear Energy’s Nuclear Energy R&D Roadmap, nuclear energy can play a significant role in supplying energy for a growing economy while reducing both our dependence on foreign energy supplies and emissions from the burning of fossil fuels. The industrial and transportation sectors are responsible for more than half of the greenhouse gas emissions in the U.S., and imported oil supplies 70% of the energy used in the transportation sector. It is therefore important to examine the various ways nuclear energy can facilitate a transition away from fossil fuels to secure environmentally sustainable production and use of energy in the transportation and manufacturing industry sectors. Imperative 3 of the Nuclear Energy R&D Roadmap, entitled “Enable a Transition Away from Fossil Fuels by Producing Process Heat for use in the Transportation and Industrial Sectors”, addresses this need. This document presents an Implementation Plan for R&D efforts related to this imperative. The expanded use of nuclear energy beyond the electrical grid will contribute significantly to overcoming the three inter-linked energy challenges facing U.S. industry: the rising and volatile prices for premium fossil fuels such as oil and natural gas, dependence on foreign sources for these fuels, and the risks of climate change resulting from carbon emissions. Nuclear energy could be used in the industrial and transportation sectors to: • Generate high temperature process heat and electricity to serve industrial needs including the production of chemical feedstocks for use in manufacturing premium fuels and fertilizer products, • Produce hydrogen for industrial processes and transportation fuels, and • Provide clean water for human consumption by desalination and promote wastewater treatment using low-grade nuclear heat as a useful additional benefit. Opening new avenues for nuclear energy will significantly enhance our nation’s energy

  8. The Oil Climax: Can Nigeria’s fuel subsidy reforms propel energy transitions?

    NARCIS (Netherlands)

    Osunmuyiwa, Olufolahan; Kalfagianni, Agni

    2017-01-01

    Abstract Recent studies in the field of political science and environmental resource governance suggest that oil-exporting economies have begun to implement fuel subsidy reforms. However, while most studies on this issue focus largely on the broader environmental and economic consequences of fuel su

  9. Technical Breakthrough Points and Opportunities in Transition Scenarios for Hydrogen as Vehicular Fuel

    Energy Technology Data Exchange (ETDEWEB)

    Diakov, V.; Ruth, M.; James, B.; Perez, J.; Spisak, A.

    2011-12-01

    This technical reports is about investigating a generic case of hydrogen production/delivery/dispensing pathway evolution in a large population city, assuming that hydrogen fuel cell electric vehicles (FCEV) will capture a major share of the vehicle market by the year 2050. The range of questions that are considered includes (i) what is the typical succession of hydrogen pathways that minimizes consumer cost? (ii) what are the major factors that will likely influence this sequence?

  10. Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration Results: Fifth Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jeffers, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2016-06-01

    This report presents results of a demonstration of fuel cell electric buses (FCEB) operating in Oakland, California. Alameda-Contra Costa Transit District (AC Transit) leads the Zero Emission Bay Area (ZEBA) demonstration, which includes 13 advanced-design fuel cell buses and two hydrogen fueling stations. The ZEBA partners are collaborating with the U.S. Department of Energy (DOE) and DOE's National Renewable Energy Laboratory (NREL) to evaluate the buses in revenue service. NREL has published four previous reports describing operation of these buses. This report presents new and updated results covering data from January 2015 through December 2015.

  11. Optimization of fuel cell membrane electrode assemblies for transition metal ion-chelating ordered mesoporous carbon cathode catalysts

    Directory of Open Access Journals (Sweden)

    Johanna K. Dombrovskis

    2014-12-01

    Full Text Available Transition metal ion-chelating ordered mesoporous carbon (TM-OMC materials were recently shown to be efficient polymer electrolyte membrane fuel cell (PEMFC catalysts. The structure and properties of these catalysts are largely different from conventional catalyst materials, thus rendering membrane electrode assembly (MEA preparation parameters developed for conventional catalysts not useful for applications of TM-OMC catalysts. This necessitates development of a methodology to incorporate TM-OMC catalysts in the MEA. Here, an efficient method for MEA preparation using TM-OMC catalyst materials for PEMFC is developed including effects of catalyst/ionomer loading and catalyst/ionomer-mixing and application procedures. An optimized protocol for MEA preparation using TM-OMC catalysts is described.

  12. Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration: First Results Report

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2011-08-01

    This report documents the early implementation experience for the Zero Emission Bay Area (ZEBA) Demonstration, the largest fleet of fuel cell buses in the United States. The ZEBA Demonstration group includes five participating transit agencies: AC Transit (lead transit agency), Santa Clara Valley Transportation Authority (VTA), Golden Gate Transit (GGT), San Mateo County Transit District (SamTrans), and San Francisco Municipal Railway (Muni). The ZEBA partners are collaborating with the U.S. Department of Energy (DOE) and DOE's National Renewable Energy Laboratory (NREL) to evaluate the buses in revenue service.

  13. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  14. Mechanisms of disease: epithelial-mesenchymal transition and back again: does cellular plasticity fuel neoplastic progression?

    Energy Technology Data Exchange (ETDEWEB)

    Bissell, Mina J; Turley, Eva A.; Veiseh, Mandana; Radisky, Derek C.; Bissell, Mina J.

    2008-02-13

    Epithelial-mesenchymal transition (EMT) is a conversion that facilitates organ morphogenesis and tissue remodeling in physiological processes such as embryonic development and wound healing. A similar phenotypic conversion is also detected in fibrotic diseases and neoplasia, which is associated with disease progression. EMT in cancer epithelial cells often seems to be an incomplete and bi-directional process. In this Review, we discuss the phenomenon of EMT as it pertains to tumor development, focusing on exceptions to the commonly held rule that EMT promotes invasion and metastasis. We also highlight the role of the RAS-controlled signaling mediators, ERK1, ERK2 and PI3-kinase, as microenvironmental responsive regulators of EMT.

  15. Star-Forming Brightest Cluster Galaxies at 0.25 < z < 1.25: A Transitioning Fuel Supply

    Energy Technology Data Exchange (ETDEWEB)

    McDonald, M.; Stalder, B.; Bayliss, M.; Allen, S. W.; Applegate, D. E.; Ashby, M. L. N.; Bautz, M.; Benson, B. A.; Bleem, L. E.; Brodwin, M.; Carlstrom, J. E.

    2016-02-01

    We present a multi-wavelength study of 90 brightest cluster galaxies (BCGs) in a sample of galaxy clusters selected via the Sunyaev Zel'dovich effect by the South Pole Telescope, utilizing data from various ground- and space-based facilities. We infer the star formation rate (SFR) for the BCG in each cluster, based on the UV and IR continuum luminosity, as well as the [O II] emission line luminosity in cases where spectroscopy is available, finding 7 systems with SFR > 100 Msun/yr. We find that the BCG SFR exceeds 10 Msun/yr in 31 of 90 (34%) cases at 0.25 < z < 1.25, compared to ~1-5% at z ~ 0 from the literature. At z > 1, this fraction increases to 92(+6)(-31)%, implying a steady decrease in the BCG SFR over the past ~9 Gyr. At low-z, we find that the specific star formation rate in BCGs is declining more slowly with time than for field or cluster galaxies, most likely due to the replenishing fuel from the cooling ICM in relaxed, cool core clusters. At z > 0.6, the correlation between cluster central entropy and BCG star formation - which is well established at z ~ 0 - is not present. Instead, we find that the most star-forming BCGs at high-z are found in the cores of dynamically unrelaxed clusters. We investigate the rest-frame near-UV morphology of a subsample of the most star-forming BCGs using data from the Hubble Space Telescope, finding complex, highly asymmetric UV morphologies on scales as large as ~50-60 kpc. The high fraction of star-forming BCGs hosted in unrelaxed, non-cool core clusters at early times suggests that the dominant mode of fueling star formation in BCGs may have recently transitioned from galaxy-galaxy interactions to ICM cooling.

  16. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  17. Design of a microbial fuel cell and its transition to microbial electrolytic cell for hydrogen production by electrohydrogenesis.

    Science.gov (United States)

    Gupta, Pratima; Parkhey, Piyush; Joshi, Komal; Mahilkar, Anjali

    2013-10-01

    Anaerobic bacteria were isolated from industrial wastewater and soil samples and tested for exoelectrogenic activity by current production in double chambered microbial fuel cell (MFC), which was further transitioned into a single chambered microbial electrolytic cell to test hydrogen production by electrohydrogenesis. Of all the cultures, the isolate from industrial water sample showed the maximum values for current = 0.161 mA, current density = 108.57 mA/m2 and power density = 48.85 mW/m2 with graphite electrode. Maximum voltage across the cell, however, was reported by the isolate from sewage water sample (506 mv) with copper as electrode. Tap water with KMnO4 was the best cathodic electrolyte as the highest values for all the measured MFC parameters were reported with it. Once the exoelectrogenic activity of the isolates was confirmed by current production, these were tested for hydrogen production in a single chambered microbial electrolytic cell (MEC) modified from the MFC. Hydrogen production was reported positive from co-culture of isolates of both the water samples and co-culture of one soil and one water sample. The maximum rate and yield of hydrogen production was 0.18 m3H2/m3/d and 3.2 mol H2/mol glucose respectively with total hydrogen production of 42.4 mL and energy recovery of 57.4%. Cumulative hydrogen production for a five day cycle of MEC operation was 0.16 m3H2/m3/d.

  18. Assessing transition trajectories towards a sustainable energy system: A case study on the Dutch transition to climate-neutral transport fuel chains

    NARCIS (Netherlands)

    Suurs, R.A.A.; Hekkert, M.P.; Meeus, M.T.H.; Nieuwlaar, E.

    2004-01-01

    This paper proposes a method for the ex ante evaluation of technological trajectories. As a case we study the Dutch transport energy system and its transition to climate neutrality. Two technological trajectories are proposed: (i) a sequence of transition steps based on radical infrastructural chang

  19. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  20. Diseño acústico y electroacústico de Waipahu Transit Center en Honolulú, Hawái

    OpenAIRE

    Sierra Carballo, Christian

    2014-01-01

    El objetivo de este Proyecto Fin de Grado es el diseño de megafonía y PAGA (Public Address /General Alarm) de la estación de tren Waipahu Transit Center en la ciudad de Honolulú, Hawái. Esta estación forma parte de una nueva línea de tren que está en proceso de construcción actualmente llamada Honolulu Rail Transit. Inicialmente la línea de tren constará de 21 estaciones, en las que prácticamente todas están diseñadas como pasos elevados usando como referencia las autopistas que cruzan la isl...

  1. Hydrogen Scenario Analysis Summary Report: Analysis of the Transition to Hydrogen Fuel Cell Vehicles and the Potential Hydrogen Energy Infrastructure Requirements

    Energy Technology Data Exchange (ETDEWEB)

    Greene, David L [ORNL; Leiby, Paul Newsome [ORNL; James, Brian [Directed Technologies, Inc.; Perez, Julie [Directed Technologies, Inc.; Melendez, Margo [National Renewable Energy Laboratory (NREL); Milbrandt, Anelia [National Renewable Energy Laboratory (NREL); Unnasch, Stefan [Life Cycle Associates; Rutherford, Daniel [TIAX, LLC; Hooks, Matthew [TIAX, LLC

    2008-03-01

    Achieving a successful transition to hydrogen-powered vehicles in the U.S. automotive market will require strong and sustained commitment by hydrogen producers, vehicle manufacturers, transporters and retailers, consumers, and governments. The interaction of these agents in the marketplace will determine the real costs and benefits of early market transformation policies, and ultimately the success of the transition itself. The transition to hydrogen-powered transportation faces imposing economic barriers. The challenges include developing and refining a new and different power-train technology, building a supporting fuel infrastructure, creating a market for new and unfamiliar vehicles, and achieving economies of scale in vehicle production while providing an attractive selection of vehicle makes and models for car-buyers. The upfront costs will be high and could persist for a decade or more, delaying profitability until an adequate number of vehicles can be produced and moved into consumer markets. However, the potential rewards to the economy, environment, and national security are immense. Such a profound market transformation will require careful planning and strong, consistent policy incentives. Section 811 of the Energy Policy Act (EPACT) of 2005, Public Law 109-59 (U.S. House, 2005), calls for a report from the Secretary of Energy on measures to support the transition to a hydrogen economy. The report was to specifically address production and deployment of hydrogen-fueled vehicles and the hydrogen production and delivery infrastructure needed to support those vehicles. In addition, the 2004 report of the National Academy of Sciences (NAS, 2004), The Hydrogen Economy, contained two recommendations for analyses to be conducted by the U.S. Department of Energy (DOE) to strengthen hydrogen energy transition and infrastructure planning for the hydrogen economy. In response to the EPACT requirement and NAS recommendations, DOE's Hydrogen, Fuel Cells and

  2. Analysis of the Transition to Hydrogen Fuel Cell Vehicles and the Potential Hydrogen Energy Infrastructure Requirements, March 2008

    Energy Technology Data Exchange (ETDEWEB)

    Greene, David L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Leiby, Paul N. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); James, Brian [Directed Technologies, Inc., Youngstown, OH (United States); Perez, Julie [Directed Technologies, Inc., Youngstown, OH (United States); Melendez, Margo [National Renewable Energy Lab. (NREL), Golden, CO (United States); Milbrandt, Anelia [National Renewable Energy Lab. (NREL), Golden, CO (United States); Unnash, Stefan [Life Cycle Associates, Portola Valley, CA (United States); Rutherford, Daniel [Life Cycle Associates, Portola Valley, CA (United States); Hooks, Matthew [TIAX, LLC, Lexingtion, MA (United States)

    2008-03-14

    Achieving a successful transition to hydrogen-powered vehicles in the U.S. automotive market will require strong and sustained commitment by hydrogen producers, vehicle manufacturers, transporters and retailers, consumers, and governments. The interaction of these agents in the marketplace will determine the real costs and benefits of early market transformation policies, and ultimately the success of the transition itself.

  3. Fuel Pellets from Wheat Straw: The Effect of Lignin Glass Transition and Surface Waxes on Pelletizing Properties

    DEFF Research Database (Denmark)

    Stelte, Wolfgang; Clemons, Craig; Holm, Jens K.;

    2012-01-01

    and a high concentration of hydrophobic waxes on its outer surface that may limit the pellet strength. The present work studies the impact of the lignin glass transition on the pelletizing properties of wheat straw. Furthermore, the effect of surface waxes on the pelletizing process and pellet strength...... are investigated by comparing wheat straw before and after organic solvent extraction. The lignin glass transition temperature for wheat straw and extracted wheat straw is determined by dynamic mechanical thermal analysis. At a moisture content of 8%, transitions are identified at 53°C and 63°C, respectively....... Pellets are pressed from wheat straw and straw where the waxes have been extracted from. Two pelletizing temperatures were chosen—one below and one above the glass transition temperature of lignin. The pellets compression strength, density, and fracture surface were compared to each other. Pellets pressed...

  4. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  5. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  6. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  7. Hydrogen Scenario Analysis Summary Report: Analysis of the Transition to Hydrogen Fuel Cell Vehicles and the Potential Hydrogen Energy Infrastructure Requirements

    Energy Technology Data Exchange (ETDEWEB)

    Greene, David L [ORNL; Leiby, Paul Newsome [ORNL; James, Brian [Directed Technologies, Inc.; Perez, Julie [Directed Technologies, Inc.; Melendez, Margo [National Renewable Energy Laboratory (NREL); Milbrandt, Anelia [National Renewable Energy Laboratory (NREL); Unnasch, Stefan [Life Cycle Associates; Rutherford, Daniel [TIAX, LLC; Hooks, Matthew [TIAX, LLC

    2008-03-01

    Achieving a successful transition to hydrogen-powered vehicles in the U.S. automotive market will require strong and sustained commitment by hydrogen producers, vehicle manufacturers, transporters and retailers, consumers, and governments. The interaction of these agents in the marketplace will determine the real costs and benefits of early market transformation policies, and ultimately the success of the transition itself. The transition to hydrogen-powered transportation faces imposing economic barriers. The challenges include developing and refining a new and different power-train technology, building a supporting fuel infrastructure, creating a market for new and unfamiliar vehicles, and achieving economies of scale in vehicle production while providing an attractive selection of vehicle makes and models for car-buyers. The upfront costs will be high and could persist for a decade or more, delaying profitability until an adequate number of vehicles can be produced and moved into consumer markets. However, the potential rewards to the economy, environment, and national security are immense. Such a profound market transformation will require careful planning and strong, consistent policy incentives. Section 811 of the Energy Policy Act (EPACT) of 2005, Public Law 109-59 (U.S. House, 2005), calls for a report from the Secretary of Energy on measures to support the transition to a hydrogen economy. The report was to specifically address production and deployment of hydrogen-fueled vehicles and the hydrogen production and delivery infrastructure needed to support those vehicles. In addition, the 2004 report of the National Academy of Sciences (NAS, 2004), The Hydrogen Economy, contained two recommendations for analyses to be conducted by the U.S. Department of Energy (DOE) to strengthen hydrogen energy transition and infrastructure planning for the hydrogen economy. In response to the EPACT requirement and NAS recommendations, DOE's Hydrogen, Fuel Cells and

  8. Fuel cycle: the transition between the third and the fourth generation of reactors; Cycle du combustible: faire la transition vers les 3eme et 4eme generations de reacteurs

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-07-01

    Many challenges arrive today for the french research and development on the fuel cycle: promote the industrial technologies, improve the world increase of the nuclear and adapt the fuel cycle technologies to the future reactors. In this framework the report presents after a recall on the fuel cycle, the researches on the fuel, the optimization of the recycling, the wastes management, the simulation and Phenix an experimentation tool for the fuel. (A.L.B.)

  9. Star-Forming Brightest Cluster Galaxies at 0.25 < z < 1.25: A Transitioning Fuel Supply

    CERN Document Server

    McDonald, M; Bayliss, M; Allen, S W; Applegate, D E; Ashby, M L N; Bautz, M; Benson, B A; Bleem, L E; Brodwin, M; Carlstrom, J E; Chiu, I; Desai, S; Gonzalez, A H; Hlavacek-Larrondo, J; Holzapfel, W L; Marrone, D P; Miller, E D; Reichardt, C L; Saliwanchik, B R; Saro, A; Schrabback, T; Stanford, S A; Stark, A A; Vieira, J D; Zenteno, A

    2015-01-01

    We present a multi-wavelength study of 90 brightest cluster galaxies (BCGs) in a sample of galaxy clusters selected via the Sunyaev Zel'dovich effect by the South Pole Telescope, utilizing data from various ground- and space-based facilities. We infer the star formation rate (SFR) for the BCG in each cluster, based on the UV and IR continuum luminosity, as well as the [O II] emission line luminosity in cases where spectroscopy is available, finding 7 systems with SFR > 100 Msun/yr. We find that the BCG SFR exceeds 10 Msun/yr in 31 of 90 (34%) cases at 0.25 1, this fraction increases to 92(+6)(-31)%, implying a steady decrease in the BCG SFR over the past ~9 Gyr. At low-z, we find that the specific star formation rate in BCGs is declining more slowly with time than for field or cluster galaxies, most likely due to the replenishing fuel from the cooling ICM in relaxed, cool core clusters. At z > 0.6, the correlation between cluster central entropy and BCG star formation - which is well established at z ~ 0 - i...

  10. Cost-effective fuel and technology choices in the transportation sector in a future carbon constrained world: Results from the Global Energy Transition (GET) model

    Energy Technology Data Exchange (ETDEWEB)

    Grahn, Maria

    2009-06-15

    This thesis analyzes future fuel and technology choices focusing on transport in a carbon constrained world. The analysis tool used in all five appended papers is the cost-minimizing Global Energy Transition (GET) model. Paper I analyzes cost-effective fuel and technology choices for passenger vehicles under a variety of vehicle cost-assumptions and how these choices depend on technology paths in the electricity sector. We find that cost estimates as well as the availability of carbon capture and storage technology and concentrating solar power have a substantial impact, ranging from a dominance of hydrogen to a dominance of electricity. Paper II analyzes the cost-effectiveness of biofuels for transportation, assuming that industrialized regions start reducing their CO{sub 2} emissions some decades ahead of developing regions. We find that biofuels may play a more important role for transportation in industrialized regions if these regions assume their responsibilities and reduce emissions before developing regions start reducing theirs, compared to the case in which all countries take action under a global cap and trade emissions reduction regime. Paper III analyzes how policy instruments aimed at increasing the use of biofuels for transportation in industrialized regions affect CO{sub 2} emissions in industrialized and developing regions. We find that such policy instruments may lead to avoided emissions in industrialized regions, especially during the first 50 years, and in a few specific cases in the developing regions, too. However, in the majority of cases, such a biofuels policy leads to increased emissions in the developing regions, i.e., to 'carbon leakage'. Paper IV analyzes why two global energy systems models reach different results on the cost-effectiveness of biofuels, although the models have strong similarities. We find biomass most cost-effectively used for heat production at low CO{sub 2} taxes in both models. Biomass allocation at

  11. AC susceptibilities of grain-textured superconductors

    Science.gov (United States)

    Sakamoto, N.; Fukuda, Y.; Koga, M.; Akune, T.; Khan, H. R.; Lüders, K.

    2008-09-01

    In-phase χ n‧ and out-phase χ n″ components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field Bdc, an amplitude Ba and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low- Tc metallic superconductors, χ1‧ shows smooth transition and χ1″ does single peak. High- Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in χ1″ and shoulders in χ1‧ appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  12. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  13. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  14. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  15. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  16. Modelling socio-metabolic transitions: The historical take-off, the acceleration of fossil fuel use, and the 1970s oil price shock - the first trigger of a future decline?

    Science.gov (United States)

    Wiedenhofer, Dominik; Rovenskaya, Elena; Krausmann, Fridolin; Haas, Willi; Fischer-Kowalski, Marina

    2013-04-01

    By talking about socio-metabolic transitions, we talk about changes in the energy base of socio-economic systems, leading to fundamental changes in social and environmental relations. This refers to the historical shift from a biomass-based (agrarian) economy to a fossil fuel based (industrial) economy just as much as to a future shift from fossil fuels to renewable energy carriers. In our presentation, • We will first show that this pattern of transition can be identified for most high income industrial countries: the later the transition started, the faster it proceeded, and the turning point to stabilization of metabolic rates in all of them happened in the early 1970ies. Due to the inherent non-linearity of this process, two approaches will be aplied to estimate parameters for the starting point, transition speed and saturation level: firstly a combination of an expontential and a generalized logistic function and secondly a Gompertz function. For both an iterative test procedure is applied to find the global minimum of the residual error for the whole function and all its parameters. This theory-based approach allows us to apply a robust methodology across all cases, thereby yielding results which can be generalized. • Next, we will show that this was not just a "historical" socio-ecological transition, however. Currently, a substantial number of countries comprising more than half of the world's population are following a similar transitional pathway at an ever accelerating pace. Based on empirical data on physical resource use and the above sketched methodology, we can show that these so-called emerging economies are currently in the take-off or acceleration phase of the very same transition. • Apart from these "endogenous" processes of socio-metabolic transition, we will investigate the effect of external shocks and their impact on the dynamics of energy and materials use. The first such shock we will explore is the oil crisis of 1972 that possibly

  17. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  18. Releasing metal catalysts via phase transition: (NiO)0.05-(SrTi0.8Nb0.2O3)0.95 as a redox stable anode material for solid oxide fuel cells.

    Science.gov (United States)

    Xiao, Guoliang; Wang, Siwei; Lin, Ye; Zhang, Yanxiang; An, Ke; Chen, Fanglin

    2014-11-26

    Donor-doped perovskite-type SrTiO3 experiences stoichiometric changes at high temperatures in different Po2 involving the formation of Sr or Ti-rich impurities. NiO is incorporated into the stoichiometric strontium titanate, SrTi0.8Nb0.2O3-δ (STN), to form an A-site deficient perovskite material, (NiO)0.05-(SrTi0.8Nb0.2O3)0.95 (Ni-STN), for balancing the phase transition. Metallic Ni nanoparticles can be released upon reduction instead of forming undesired secondary phases. This material design introduces a simple catalytic modification method with good compositional control of the ceramic backbones, by which transport property and durability of solid oxide fuel cell anodes are largely determined. Using Ni-STN as anodes for solid oxide fuel cells, enhanced catalytic activity and remarkable stability in redox cycling have been achieved. Electrolyte-supported cells with the cell configuration of Ni-STN-SDC anode, La0.8Sr0.2Ga0.87Mg0.13O3 (LSGM) electrolyte, and La0.6Sr0.4Co0.2Fe0.8O3 (LSCF) cathode produce peak power densities of 612, 794, and 922 mW cm(-2) at 800, 850, and 900 °C, respectively, using H2 as the fuel and air as the oxidant. Minor degradation in fuel cell performance resulted from redox cycling can be recovered upon operating the fuel cells in H2. Such property makes Ni-STN a promising regenerative anode candidate for solid oxide fuel cells.

  19. 微生物燃料电池MnO2/S-AC泡沫镍空气阴极的制备及其性能%Preparation and properties of nickel foam air cathode with MnO2/S-AC catalyst for microbial fuel cells

    Institute of Scientific and Technical Information of China (English)

    杨斯琦; 刘中良; 侯俊先; 周宇

    2015-01-01

    The kinetics of oxygen reduction of cathode catalyst is a critical factor that limits the performance of microbial fuel cells (MFCs). The composite catalyst of three composite proportion(1:3, 1:1 and 3:1), which were prepared by reacting KMnO4 with supercapacitor activated carbon (S-AC),were tested as air-cathode catalyst of microbial fuel cells (MFCs) for oxygen reduction. X-ray diffraction (XRD) was used to characterize the catalysts, energy dispersive X-Ray Spectroscopy to estimate the quality of MnO2, scanning electron microscopy (SEM) to observe the surface morphology, and BET method to examine surface area and pore distribution characteristics, to analyze the factors affecting the performance of the composite catalyst. With increasing of composite proportion, the MnO2 sheets gathered into nano-particles (300—500 nm) on the surface of S-AC. At the same time, there is the decrease of the internal and external surface area MnO2/S-AC. Nickel foam air-cathode was made with different catalysts, and tested in air-cathode MFCs to study the effect on MFC performance by linear sweep voltammetry (LSV), polarization curves and power density curve. When the feeding ratio of KMnO4: S-AC is 1:3,the maximum power density was 321.2 mW·m?2, which was increased by about 20% over the S-AC loading MFC. However, when the feeding ratio was increased to 1:1 and 3:1, the maximum power density decreased to 240.9 and 160.3 mW·m?2. MnO2/S-AC composite catalyst within a certain ratio range could effectively improve the performance of air-cathode and MFC, which helps to the expansion application of air-cathode MFC.%利用超级电容器活性炭(S-AC)直接还原KMnO4制备出复合比例分别为1:3、1:1和3:1的MnO2/S-AC复合催化剂,进而负载于泡沫镍上制得MnO2/S-AC泡沫镍空气阴极.通过X射线衍射(XRD)、扫描电镜(SEM)、能量散射X 射线谱(EDX)和比表面积(BET)及孔分布测试对所制复合催化剂表征可知,随复合比例

  20. Hopes, Hypes and Disappointments: On the role of expectations for sustainability transitions : A case study on hydrogen and fuel cell technology for transport

    NARCIS (Netherlands)

    Budde, B.

    2015-01-01

    The aim of this thesis is to better understand the role of (changing) expectations for innovation and transition processes. It aims to gain insights in the processes leading to periods of hypes, followed by disappointment and the effects of such expectation dynamics on transitions. Empirically this

  1. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  2. Fuel cell development for transportation: Catalyst development

    Energy Technology Data Exchange (ETDEWEB)

    Doddapaneni, N. [Sandia National Lab., Albuquerque, NM (United States)

    1996-04-01

    Fuel cells are being considered as alternate power sources for transportation and stationary applications. With proton exchange membrane (PEM) fuel cells the fuel crossover to cathodes causes severe thermal management and cell voltage drop due to oxidation of fuel at the platinized cathodes. The main goal of this project was to design, synthesize, and evaluate stable and inexpensive transition metal macrocyclic catalysts for the reduction of oxygen and be electrochemically inert towards anode fuels such as hydrogen and methanol.

  3. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  4. AC susceptibilities of grain-textured superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, N. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan)], E-mail: saka@te.kyusan-u.ac.jp; Fukuda, Y.; Koga, M.; Akune, T. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan); Khan, H.R. [Institut von Ionenstrahl und Vakuum Technologie, 73728 Esslingen (Germany); Lueders, K. [Freie Universitaet Berlin, Arnimallee, Fac.Physik, D-14195 Berlin (Germany)

    2008-09-15

    In-phase {chi}{sub n}' and out-phase {chi}{sub n}'' components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field B{sub dc}, an amplitude B{sub a} and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low-T{sub c} metallic superconductors, {chi}{sub 1}' shows smooth transition and {chi}{sub 1}'' does single peak. High-T{sub c} oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in {chi}{sub 1}'' and shoulders in {chi}{sub 1}' appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  5. AC Motor Drive Fed by Renewable Energy Sources with PWM

    Directory of Open Access Journals (Sweden)

    J. Pavalam

    2014-01-01

    Full Text Available In this fast aproaching nature of technology the ned of Electricity becomes a mandatory in developing technology. The ned of Electricity increases the power demand where the power demand met by the conventional sources of energy has some disadvantage of polution, this disadvantage can be decreased by the use of the Renewable energy sources like Fuel Cel and available solar energy. When a FUEL cel produces AC power, basicaly two stages are required for conversion first a bosting stage and second is inversion stage. In this paper the Bost inverter topology is achieved where in the conventional methods the normal DC - AC power conversion method is used where as in this paper the PWM based DC - AC inverter has ben used which is useful in reducing the harmonics in the output of the Inverter. The voltage controled output is produced in the bost inverter the curent controled output is taken from dc-dc bidirectional converter. The Fuel cel canot be relied as a whole so a Solar PV module is conected acros the Load so while the Sunlight days the PV arays generate power and in the night time the Fuel cel is used to generate power for the load. Since, the Fuel cel and PV arays can generate power in Partial load they are prefered than any other sources. When the output from the Solar PV aray is low or when the sunlight available is not eficient in generating the power a automatic switch over is provided in the junction betwen the Solar PV aray and Fuel cel so that whenever it hapens the switch automaticaly switch over to another source. The simulation results are presented to confirm the operational feature of the proposed system.

  6. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  7. Solid Oxide Fuel Cell

    DEFF Research Database (Denmark)

    2010-01-01

    The solid oxide fuel cell comprising a metallic support material, an active anode layer consisting of a good hydrocarbon cracking catalyst, an electrolyte layer, an active cathode layer, and a transition layer consisting of preferably a mixture of LSM and a ferrite to the cathode current collector...

  8. Fuel Pathway Integration Technical Team Roadmap

    Energy Technology Data Exchange (ETDEWEB)

    None

    2013-06-01

    The Fuel Pathway Integration Technical Team (FPITT) supports the U.S. DRIVE Partnership (the Partnership) in the identification and evaluation of implementation scenarios for fuel cell technology pathways, including hydrogen and fuel cell electric vehicles in the transportation sector, both during a transition period and in the long term.

  9. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  10. High Efficiency Reversible Fuel Cell Power Converter

    DEFF Research Database (Denmark)

    Pittini, Riccardo

    The large scale integration of renewable energy sources requires suitable energy storage systems to balance energy production and demand in the electrical grid. Bidirectional fuel cells are an attractive technology for energy storage systems due to the high energy density of fuel. Compared...... entitled "High Efficiency Reversible Fuel Cell Power Converter" and it presents the design of a high efficiency dc-dc converter developed and optimized for bidirectional fuel cell applications. First, a brief overview of fuel cell and energy storage technologies is presented. Different system topologies...... to traditional unidirectional fuel cell, bidirectional fuel cells have increased operating voltage and current ranges. These characteristics increase the stresses on dc-dc and dc-ac converters in the electrical system, which require proper design and advanced optimization. This work is part of the PhD project...

  11. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  12. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  13. Operation and Control of Grid Connected Hybrid AC/DC Microgrid using various RES

    Directory of Open Access Journals (Sweden)

    Kodanda Ram R B P U S B

    2014-10-01

    Full Text Available This paper proposes a Hybrid AC/DC Microgrid in alliance with Photo Voltaic (PV energy, Wind Energy and Proton Exchange Membrane (PEM Fuel cells. Microgrids are becoming increasingly attractive to the researchers because of the less greenhouse gases, low running cost, and flexibility to operate in connection with utility grid. The Hybrid AC/DC Microgrid constitutes independent AC and DC subgrids, where all the corresponding sources and loads are connected to their respective buses and these buses are interfaced using an interfacing converter. The Hybrid AC/DC Microgrid increases system efficiency by reducing the multiple reverse conversions involved in conventional RES integration to grid. A Small Hybrid AC/DC Microgrid in grid connected mode was modeled and simulated in MATLAB-SIMULINK environment. The simulation results proves the stable operation considering the uncertainty of generations and loads.

  14. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  15. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  16. Phase sensitive quantum interference on forbidden transition in ladder scheme

    CERN Document Server

    Koganov, Gennady A

    2014-01-01

    A three level ladder system is analyzed and the coherence of initially electric-dipole forbidden transition is calculated. Due to the presence of two laser fields the initially dipole forbidden transition becomes dynamically permitted due to ac Stark effect. It is shown that such transitions exhibit quantum-interference-related phenomena, such as electromagnetically induced transparency, gain without inversion and enhanced refractive index. Gain and dispersion characteristics of such transitions strongly depend upon the relative phase between the driving and the probe fields. Unlike allowed transitions, gain/absorption behavior of ac-Stark allowed transitions exhibit antisymmetric feature on the Rabi sidebands. It is found that absorption/gain spectra possess extremely narrow sub-natural resonances on these ac Stark allowed forbidden transitions. An interesting finding is simultaneous existence of gain and negative dispersion at Autler-Townes transition which may lead to both reduction of the group velocity a...

  17. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-04-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

  18. A catalyst layer optimisation approach using electrochemical impedance spectroscopy for PEM fuel cells operated with pyrolysed transition metal-N-C catalysts

    Science.gov (United States)

    Malko, Daniel; Lopes, Thiago; Ticianelli, Edson A.; Kucernak, Anthony

    2016-08-01

    The effect of the ionomer to carbon (I/C) ratio on the performance of single cell polymer electrolyte fuel cells is investigated for three different types of non-precious metal cathodic catalysts. Polarisation curves as well as impedance spectra are recorded at different potentials in the presence of argon or oxygen at the cathode and hydrogen at the anode. It is found that a optimised ionomer content is a key factor for improving the performance of the catalyst. Non-optimal ionomer loading can be assessed by two different factors from the impedance spectra. Hence this observation could be used as a diagnostic element to determine the ideal ionomer content and distribution in newly developed catalyst-electrodes. An electrode morphology based on the presence of inhomogeneous resistance distribution within the porous structure is suggested to explain the observed phenomena. The back-pressure and relative humidity effect on this feature is also investigated and supports the above hypothesis. We give a simple flowchart to aid optimisation of electrodes with the minimum number of trials.

  19. A shift in emission time profiles of fossil fuel combustion due to energy transitions impacts source receptor matrices for air quality.

    Science.gov (United States)

    Hendriks, Carlijn; Kuenen, Jeroen; Kranenburg, Richard; Scholz, Yvonne; Schaap, Martijn

    2015-03-01

    Effective air pollution and short-lived climate forcer mitigation strategies can only be designed when the effect of emission reductions on pollutant concentrations and health and ecosystem impacts are quantified. Within integrated assessment modeling source-receptor relationships (SRRs) based on chemistry transport modeling are used to this end. Currently, these SRRs are made using invariant emission time profiles. The LOTOS-EUROS model equipped with a source attribution module was used to test this assumption for renewable energy scenarios. Renewable energy availability and thereby fossil fuel back up are strongly dependent on meteorological conditions. We have used the spatially and temporally explicit energy model REMix to derive time profiles for backup power generation. These time profiles were used in LOTOS-EUROS to investigate the effect of emission timing on air pollutant concentrations and SRRs. It is found that the effectiveness of emission reduction in the power sector is significantly lower when accounting for the shift in the way emissions are divided over the year and the correlation of emissions with synoptic situations. The source receptor relationships also changed significantly. This effect was found for both primary and secondary pollutants. Our results indicate that emission timing deserves explicit attention when assessing the impacts of system changes on air quality and climate forcing from short lived substances.

  20. Fossil Fuels.

    Science.gov (United States)

    Crank, Ron

    This instructional unit is one of 10 developed by students on various energy-related areas that deals specifically with fossil fuels. Some topics covered are historic facts, development of fuels, history of oil production, current and future trends of the oil industry, refining fossil fuels, and environmental problems. Material in each unit may…

  1. Variations in the relationship between fuel price and bus ridership among U.S. transit systems[Includes the CSCE forum on professional practice and career development : 1. international engineering mechanics and materials specialty conference : 1. international/3. coastal, estuarine and offshore engineering specialty conference : 2. international/8. construction specialty conference

    Energy Technology Data Exchange (ETDEWEB)

    Haire, A.R.; Machemehl, R.B. [Texas Univ., Austin, TX (United States). Dept. of Civil Architectural, and Environmental Engineering

    2009-07-01

    This study examined several characteristics of bus transit systems to explore potential relationships regarding how system characteristics may affect travelers' choice to use public transportation. A clear relationship exists between bus ridership and fuel price, although many other factors contribute to ridership growth and fluctuation. The external factors include 6 broad categories (1) population characteristics and changes, (2) economic conditions, (3) cost and availability of alternative modes of transport including toll pricing, parking pricing, taxi fares, automobile costs and availability of commuter benefits programs by employers, (4) land use development patterns and policies, (5) travel conditions, and (6) public funding initiatives. These supplementary factors vary and many lend themselves to service quality measurement. Perceived service quality is an important contributor to public transportation ridership. The study explored community and bus system characteristics associated with perceived service quality and how these characteristics relate to correlation coefficients between fuel price and ridership, using an unconventional trivariate comparison method. Seasonally-adjusted correlation coefficients between ridership and fuel price for 340 bus systems across the United States were plotted against route density, operating speed, peak-hour service frequency, average travel speed, and average total travel time. The study showed that cost-conscious travelers using transit systems in the United States appear willing to compromise on aspects normally linked to convenience in order to use public transit and minimize their fuel expenditures. 10 refs., 1 tab., 6 figs.

  2. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  3. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  4. Fuel distribution

    Energy Technology Data Exchange (ETDEWEB)

    Tison, R.R.; Baker, N.R.; Blazek, C.F.

    1979-07-01

    Distribution of fuel is considered from a supply point to the secondary conversion sites and ultimate end users. All distribution is intracity with the maximum distance between the supply point and end-use site generally considered to be 15 mi. The fuels discussed are: coal or coal-like solids, methanol, No. 2 fuel oil, No. 6 fuel oil, high-Btu gas, medium-Btu gas, and low-Btu gas. Although the fuel state, i.e., gas, liquid, etc., can have a major impact on the distribution system, the source of these fuels (e.g., naturally-occurring or coal-derived) does not. Single-source, single-termination point and single-source, multi-termination point systems for liquid, gaseous, and solid fuel distribution are considered. Transport modes and the fuels associated with each mode are: by truck - coal, methanol, No. 2 fuel oil, and No. 6 fuel oil; and by pipeline - coal, methane, No. 2 fuel oil, No. 6 oil, high-Btu gas, medium-Btu gas, and low-Btu gas. Data provided for each distribution system include component makeup and initial costs.

  5. Structure and Control Strategies of Fuel Cell Vehicle

    Institute of Scientific and Technical Information of China (English)

    宋建国; 张承宁; 孙逢春; 钟秋海

    2004-01-01

    The structure and kinds of the fuel cell vehicle (FCV) and the mathematical model of the fuel cell processor are discussed in detail. FCV includes many parts: the fuel cell thermal and water management, fuel supply, air supply and distribution, AC motor drive, main and auxiliary power management, and overall vehicle control system. So it requires different kinds of control strategies, such as the PID method, zero-pole method, optimal control method, fuzzy control and neural network control. Along with the progress of control method, the fuel cell vehicle's stability and reliability is up-and-up. Experiment results show FCV has high energy efficiency.

  6. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  7. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  8. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  9. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  10. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  11. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  12. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  13. Long-Term Performance of Chemically and Physically Modified Activated Carbons in Air Cathodes of Microbial Fuel Cells

    KAUST Repository

    Zhang, Xiaoyuan

    2014-07-31

    © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim. Activated carbon (AC) is a low-cost and effective catalyst for oxygen reduction in air cathodes of microbial fuel cells (MFCs), but its performance must be maintained over time. AC was modified by three methods: 1)pyrolysis with iron ethylenediaminetetraacetic acid (AC-Fe), 2)heat treatment (AC-heat), and 3)mixing with carbon black (AC-CB). The maximum power densities after one month with these AC cathodes were 35% higher with AC-Fe (1410±50mW m-2) and AC-heat (1400±20mW m-2), and 16% higher with AC-CB (1210±30mW m-2) than for plain AC (1040±20mW m-2), versus 1270±50mW m-2 for a Pt control. After 16months, the Pt cathodes produced only 250±10mW m-2. However, the AC-heat and AC-CB cathodes still produced 960-970mW m-2, whereas plain AC produced 860±60mW m-2. The performance of the AC cathodes was restored to >85% of the initial maximum power densities by cleaning with a weak acid solution. Based on cost considerations among the AC materials, AC-CB appears to be the best choice for long-term performance.

  14. Terminology used for renewable liquid and gaseous fuels based on the conversion of electricity: a review

    DEFF Research Database (Denmark)

    Ridjan, Iva; Mathiesen, Brian Vad; Connolly, David

    2016-01-01

    As the transport sector transitions away from fossil fuels and renewable fuels shift into focus, it is important that the terminology around renewable fuels is clarified. A number of terms such as synthetic fuel and electrofuel are used to describe both renewable and alternative fuels. The aim of...

  15. TMI Fuel Characteristics for Disposal Criticality Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Larry L. Taylor

    2003-09-01

    This report documents the reported contents of the Three Mile Island Unit 2 (TMI-2) canisters. proposed packaging, and degradation scenarios expected in the repository. Most fuels within the U.S. Department of Energy spent nuclear fuel inventory deal with highly enriched uranium, that in most cases require some form of neutronic poisoning inside the fuel canister. The TMI-2 fuel represents a departure from these fuel forms due to its lower enrichment (2.96% max.) values and the disrupted nature of the fuel itself. Criticality analysis of these fuel canisters has been performed over the years to reflect conditions expected during transit from the reactor to the Idaho National Engineering and Environmental Laboratory, water pool storage,1 and transport/dry-pack storage at Idaho Nuclear Technology and Engineering Center.2,3 None of these prior analyses reflect the potential disposal conditions for this fuel inside a postclosure repository.

  16. VISION: Verifiable Fuel Cycle Simulation Model

    Energy Technology Data Exchange (ETDEWEB)

    Jacob J. Jacobson; Abdellatif M. Yacout; Gretchen E. Matthern; Steven J. Piet; David E. Shropshire

    2009-04-01

    The nuclear fuel cycle is a very complex system that includes considerable dynamic complexity as well as detail complexity. In the nuclear power realm, there are experts and considerable research and development in nuclear fuel development, separations technology, reactor physics and waste management. What is lacking is an overall understanding of the entire nuclear fuel cycle and how the deployment of new fuel cycle technologies affects the overall performance of the fuel cycle. The Advanced Fuel Cycle Initiative’s systems analysis group is developing a dynamic simulation model, VISION, to capture the relationships, timing and delays in and among the fuel cycle components to help develop an understanding of how the overall fuel cycle works and can transition as technologies are changed. This paper is an overview of the philosophy and development strategy behind VISION. The paper includes some descriptions of the model and some examples of how to use VISION.

  17. Fuel Cells

    DEFF Research Database (Denmark)

    Smith, Anders; Pedersen, Allan Schrøder

    2014-01-01

    Fuel cells have been the subject of intense research and development efforts for the past decades. Even so, the technology has not had its commercial breakthrough yet. This entry gives an overview of the technological challenges and status of fuel cells and discusses the most promising applications...... of the different types of fuel cells. Finally, their role in a future energy supply with a large share of fluctuating sustainable power sources, e.g., solar or wind, is surveyed....

  18. Magic Wavelength for Hydrogen 1S-2S Transition

    CERN Document Server

    Kawasaki, Akio

    2015-01-01

    The magic wavelength for an optical lattice for hydrogen atoms that cancels the first order AC Stark shift of 1S-2S transition is calculated to be 513 nm. The amount of AC Stark shift $ \\Delta E = -1.19$ kHz/(10kW/cm$^2$) and the slope $d\\Delta E/d \

  19. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nin T, cardiac muscle OS=Homo sapiens... 35 0.27 sp|P98193|DMP1_RAT Dentin matrix...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac...EEDAEAEAETEETRAEEDEEEEEAKEAEDG 68 Query: 329 PADQETP 349 P ++ P Sbjct: 69 PMEESKP 75 >sp|P98193|DMP1_RAT Dentin

  20. AcEST: DK956827 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n, cytoplasmic 1 OS=Salmo salar GN=AC... 389 e-107 tr|B3TH90|B3TH90_POERE Beta-actin OS=Poecilia reticulata ...PE=2 SV=1 389 e-107 tr|B3TH89|B3TH89_POERE Beta-actin OS=Poecilia reticulata PE=4 SV=1 389 e-107 tr|B3GLI4|B

  1. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  2. Contribution to the study of {sup 233}U production with MOX-ThPu fuel in PWR reactor. Transition scenarios towards Th/{sup 233}U iso-generating concepts in thermal spectrum. Development of the MURE fuel evolution code; Contribution a l'etude de la production d'{sup 233}U en combustible MOX-ThPu en reacteur a eau sous pression. Scenarios de transition vers des concepts isogenerateurs Th/{sup 233}U en spectre thermique. Developpement du code MURE d'evolution du combustible

    Energy Technology Data Exchange (ETDEWEB)

    Michel-Sendis, F

    2006-12-15

    If nuclear power is to provide a significant fraction of the growing world energy demand, only through the breeding concept can the development of sustainable nuclear energy become a reality. The study of such a transition, from present-day nuclear technologies to future breeding concepts is therefore pertinent. Among these future concepts, those using the thorium cycle Th/U-233 in a thermal neutron spectrum are of particular interest; molten-salt type thermal reactors would allow for breeding while requiring comparatively low initial inventories of U-233. The upstream production of U-233 can be obtained through the use of thorium-plutonium mixed oxide fuel in present-day light water reactors. This work presents, firstly, the development of the MURE evolution code system, a C++ object-oriented code that allows the study, through Monte Carlo (M.C.) simulation, of nuclear reactors and the evolution of their fuel under neutron irradiation. The M.C. methods are well-suited for the study of any reactor, whether it'd be an existing reactor using a new kind of fuel or a future concept altogether, the simulation is only dependent on nuclear data. Exact and complex geometries can be simulated and continuous energy particle transport is performed. MURE is an interface with MCNP, the well-known and validated transport code, that allows, among other functionalities, to simulate constant power and constant reactivity evolutions. Secondly, the study of MOX ThPu fuel in a conventional light water reactor (REP) is presented; it explores different plutonium concentrations and isotopic qualities in order to evaluate their safety characteristics. Simulation of their evolution allows us to quantify the production of U-233 at the end of burnup. Last, different french scenarios validating a possible transition towards a park of thermal Th/U-233 breeders, are presented. In these scenarios, U-233 is produced in ThPu moxed light water reactors. (author)

  3. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  4. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  5. MODELLING AND FUZZY LOGIC CONTROL OF PEM FUEL CELL SYSTEM POWER GENERATION FOR RESIDENTIAL APPLICATION

    OpenAIRE

    Khaled MAMMAR; CHAKER, Abdelkader

    2010-01-01

    This paper presents a dynamic model of Fuel cell system for residential power generation. The models proposedinclude a fuel cell stack model, reformer model and DC/AC inverter model. More then an analytical details ofhow active and reactive power output of a proton-exchange-membrane (PEM) fuel cell system is controlled.Furthermore a fuzzy logic (FLC) controller is used to control active power of PEM fuel cell system. Thecontroller modifies the hydrogen flow feedback from the terminal load. Si...

  6. DC and AC transport properties on La0.8Sr0.2MnO3

    Institute of Scientific and Technical Information of China (English)

    Zhantao Wei; Xinsheng Yang; Li Lv; Min Zhang; Yong Zhang

    2014-01-01

    Magnetoresistive sensor can be widely used in modern transportation field, such as the vehicle positioning and navigation system, vehicle detection system, and intelligent transportation system. In order to improve the efficiency of magnetoresistive sensor, we synthesized La0.8Sr0.2MnO3 polycrystalline bulks at different sintering temperatures and investigated their DC and AC transport properties in this work. As a result, all samples showed insulator-metal (I-M) phase transition, and the transition temperature (TI-M) shifted to higher temperature with the increase of sintering temperature. The TI-M measured at different AC frequencies was smaller than that measured at DC condition, which implied that the I-M phase transition was suppressed at AC frequencies. The resistivity mea-sured at high AC frequencies was larger than that measured at low AC frequencies, which could be attributed to the change of the magnetic penetration depth (d). However, the room-temperature AC-magnetoresistance (MR) at low frequencies was much larger than that at high frequencies and room-temperature DC-MR. These findings demon-strate that reducing the AC frequency is an effective way for enhancing the room-temperature MR, which can be used to promote the efficiency of magnetoresistive sensor.

  7. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  8. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  9. A DEVICE FOR MEASURING SUPERCONDUCTING TRANSITION TEMPERATURE BY AC SUSCEPTIBILITY MEASUREMENT OF SUPERCONDUCTING FILM IN SMALL ^* CRYOCOOLER%在小型制冷机中测量薄片交流磁化率以决定超导转变温度的装置

    Institute of Scientific and Technical Information of China (English)

    褚向华; 王三胜; 杨慧; 陈笃行

    2012-01-01

    In this paper, a device for measuring superconducting transition temperature in small cryocooler, based on principles of electromagnetic induction and superconducting magnetic effect, is introduced. This device consists of a vacuum chamber, a small cryocooler, a vacuum pump, a vacuum gauge, a lock-in amplifier, a temperature controller, a computer and a coil pancake and so on. The coil pancake, which is fixed in the vacuum claamoer, contains a primary coil and secondary coil, the primary coil and secondary coil are respectively wound onto two coil formers. The measured superconducting thin film is put between the primary coil and the secondary coil. The small cryocooler is used to cool superconducting thin film, the vacuum pump is used to pump gas in the vacuum chamber, and the temperature controller is used to measure and control the temperature of superconducting thin filro. The internal oscillator of the lock-in amplifier is connected to the primary coil to provide an excitation field exerted to the superconducting film. At the same time, the lock-in amplifier is used to measure the response of the secondary coil. In our system, the sample temperature datum and the voltage output of the secondary coil are transmitted and saved in the computer; then these datum can be drawn into V--T lines displayed on the computer screen at real time. Experiments show that this device can be used to obtain superconducting transition temperature automatically by measuring ac susceptibility with a lower cost.%本文介绍了一种利用电磁感应原理和超导磁效应,在小型制冷机中测量超导体转变温度的装置.本装置包括密闭的真空室、压缩制冷机、真空泵、真空计、锁相放大器、温控仪、计算机、线圈绕组.其中,线圈绕组置于真空室内,由初级线圈和次级线圈组成,初级线圈和次级线圈分别绕制在两个线圈骨架上;被测超导薄片材料放置于初级线圈和次级线圈之间

  10. Fuel cells

    Directory of Open Access Journals (Sweden)

    D. N. Srivastava

    1962-05-01

    Full Text Available The current state of development of fuel cells as potential power sources is reviewed. Applications in special fields with particular reference to military requirements are pointed out.

  11. Future Fuels

    Science.gov (United States)

    2006-04-01

    Storage Devices, Fuel Management, Gasification, Fischer-Tropsch, Syngas , Hubberts’s Peak UNCLAS UNCLAS UNCLAS UU 80 Dr. Sujata Millick (703) 696...prices ever higher, and perhaps lead to intermittent fuel shortages as production fluctuates. Clearly, this competition for resources also provides oil...producers multiple options for selling their products, and raises the possibility that the US could face shortages resulting from shifts in

  12. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  13. Shape Dependence of Low-Temperature Magnetic Relaxation of Mn12Ac

    Institute of Scientific and Technical Information of China (English)

    LIU Hai-Qing; SU Shao-Kui; JING Xiu-nian; LIU Ying; LI Yan-rong; HE Lun-Hua; GE Pei-Wen; YAN Qi-Wei; WANG Yun-Ping

    2008-01-01

    We report the discovery that the low-temperature magnetic relaxation in Mn,12 Ac single crystals strongly depends on the shape of the samples. The relaxation time exhibits a minimum at the phase transition point between ferromagnetic and antiferromagnetic phases. The shape dependence is attributed to the dipolar interaction between molecular magnets.

  14. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...

  15. Local Fuel Rod Crud Prediction Tool Applications

    Energy Technology Data Exchange (ETDEWEB)

    Krammen, Michael A.; Karoutas, Zeses E.; Wang, Guoqiang; Young, Michael Y

    2009-06-15

    response to two CILC fuel failures observed in a reactor plant where fuel rod crudding was not initially of concern due to negligible predicted fuel rod steaming on a fuel assembly sub-channel scale. The fuel rod crud observed in the reactor cycle with the fuel rod CILC failures was very localized, but was heaviest on those fuel rods with relatively higher fuel rod duty. These indications led to development of the more locally detailed predictive capability. And, based on the observed behavior, guideline limits have been established by benchmarking the methodology to the fuel rod crud induced fuel failures. The guideline limits are used in designing fuel managements. Application of these tools in subsequent fuel management design for later reactor cycles in both the plant where the CILC fuel failures occurred and in its sister plant with similar operating characteristics have avoided a recurrence of the CILC fuel failure. These tools were also used when a new fuel design with mixing vane grids was introduced in two plants previously fueled with non-mixing vane grids. The predictive tools account for the thermal hydraulic transition core effects. Interestingly, the plant with the generally higher fuel duty, a plant that had experienced Crud Induced Power Shift (CIPS) in earlier cycles, is predicted to easily meet the CIPS and CILC guidelines for the transition and following cycle. While the other plant, which has not experienced CIPS in earlier cycles, is predicted to be operating close to the CILC guideline limits in the transition cycle. The higher duty plant is predicted to have appreciable fuel rod surface area that is steaming over the reactor cycle, while the lower duty plant is predicted to have relatively little fuel rod surface area in steaming. The interpretation is that with a relatively similar crud source in the coolant, a smaller steaming surface area may act as a stronger sink for the available crud, resulting in locally thicker crud. This is a similar

  16. Control of Fuel Cell Power System

    OpenAIRE

    KOCALMIŞ BİLHAN, Ayşe; Wang, Caisheng

    2017-01-01

    In recent years, it is gettingattention for renewable energy sources such as Fuel Cell (FC), batteries,ultracapacitors or photovoltaic panels (PV) for distributed power generationsystems (DG) or electrical vehicles. This paper proposes a DC/DC converter andDC/AC inverter scheme to combine the Fuel Cell Stack (FC). The power systemconsist of a FC stack, a DC/DC converter, inverter and load. A FC mostly couldnot produce necessary output voltage, the DC/DC boost converter is used forobtaining th...

  17. Silencing of Two Insulin Receptor Genes Disrupts Nymph-Adult Transition of Alate Brown Citrus Aphid

    Science.gov (United States)

    Ding, Bi-Yue; Shang, Feng; Zhang, Qiang; Xiong, Ying; Yang, Qun; Niu, Jin-Zhi; Smagghe, Guy; Wang, Jin-Jun

    2017-01-01

    Insulin receptors play key roles in growth, development, and polymorphism in insects. Here, we report two insulin receptor genes (AcInR1 and AcInR2) from the brown citrus aphid, Aphis (Toxoptera) citricidus. Transcriptional analyses showed that AcInR1 increased during the nymph–adult transition in alate aphids, while AcInR2 had the highest expression level in second instar nymphs. AcInR1 is important in aphid development from fourth instar nymphs to adults as verified by dsRNA feeding mediated RNAi. The silencing of AcInR1 or/and AcInR2 produced a variety of phenotypes including adults with normal wings, malformed wings, under-developed wings, and aphids failing to develop beyond the nymphal stages. Silencing of AcInR1 or AcInR2 alone, and co-silencing of both genes, resulted in 73% or 60%, and 87% of aphids with problems in the transition from nymph to normal adult. The co-silencing of AcInR1 and AcInR2 resulted in 62% dead nymphs, but no mortality occurred by silencing of AcInR1 or AcInR2 alone. Phenotypes of adults in the dsInR1 and dsInR2 were similar. The results demonstrate that AcInR1 and AcInR2 are essential for successful nymph–adult transition in alate aphids and show that RNAi methods may be useful for the management of this pest. PMID:28230772

  18. Anomalous behavior of magnetostriction and magnetic ac-suseptibility of Gd1-xPrxCo5 polycrystals

    Directory of Open Access Journals (Sweden)

    A. Amirabadizadeh

    2003-12-01

    Full Text Available Magnetostriction and low field ac-susceptibility of polycrystalline Gd1-xPrxCo5 (x = 0, 0.1 and 0.5 alloys are measured in temperature region of 77-300 K. XRD patterns show that our samples are single phase. For x = 0 (GdCo5 there are no anomaly in temperature dependence of magnetostriction and ac-susceptibility curves. For x = 0.1 and 0.5 temperature dependence of ac-susceptibilities show easy-axes phase transitions. In the case of x = 0.1 sample, the easy-axes of magnetization changes from canted to axial (practically, hexagonal c-axis direction as temperature increases, and ac-susceptibility of x = 0.5 sample shows two iterative transitions, first from basal to canted then canted to axial. Magnetostriction of Pr contained samples anomalously decreases at spin reorientation regions.

  19. Examining the Link Between Public Transit Use and Active Commuting

    Directory of Open Access Journals (Sweden)

    Melissa Bopp

    2015-04-01

    Full Text Available Background: An established relationship exists between public transportation (PT use and physical activity. However, there is limited literature that examines the link between PT use and active commuting (AC behavior. This study examines this link to determine if PT users commute more by active modes. Methods: A volunteer, convenience sample of adults (n = 748 completed an online survey about AC/PT patterns, demographic, psychosocial, community and environmental factors. t-test compared differences between PT riders and non-PT riders. Binary logistic regression analyses examined the effect of multiple factors on AC and a full logistic regression model was conducted to examine AC. Results: Non-PT riders (n = 596 reported less AC than PT riders. There were several significant relationships with AC for demographic, interpersonal, worksite, community and environmental factors when considering PT use. The logistic multivariate analysis for included age, number of children and perceived distance to work as negative predictors and PT use, feelings of bad weather and lack of on-street bike lanes as a barrier to AC, perceived behavioral control and spouse AC were positive predictors. Conclusions: This study revealed the complex relationship between AC and PT use. Further research should investigate how AC and public transit use are related.

  20. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  1. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  2. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  3. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  4. Bio-, recycling- and waste fuels. How does the transition to renewable energy-sources affect the Swedish power and heat preparedness; Bio-, retur- och avfallsbraenslen. Hur oevergaangen till foernybara energikaellor paaverkar Sveriges el- och vaermeberedskap

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    The total energy supply in Sweden amounted to 600 TWh in 2000. Close to 100 TWh of these were Bio-, recycling- and waste-fuels (BRW), which means that the use of these fuels has tripled during the last decade. BRW stand for half the energy supply to district heating in Sweden. A large number of heat and power plants built for fossil fuels have been converted to BRW, and several new plants designed for biofuels have been taken into operation. Upgraded biofuels (briquets, pellets and powders) have substituted fuel oil in households and small heating networks. These developments make it important to study issues about safety of supply and emergency planning. In difference to fossil fuels there is no obligation to set up emergency stocks of BRW in Sweden. In combination with an increased dependence on logistics this means that the preparedness in short time emergency situations has deteriorated. For short periods, fuel oil and coal can however be used as replacement fuels. The increased know-how on producing, handling, transport and combustion of BRW is, on the other hand, a great asset for Sweden both in normal and emergency situations.

  5. Dynamic Systems Analysis Report for Nuclear Fuel Recycle

    Energy Technology Data Exchange (ETDEWEB)

    Brent Dixon; Sonny Kim; David Shropshire; Steven Piet; Gretchen Matthern; Bill Halsey

    2008-12-01

    This report examines the time-dependent dynamics of transitioning from the current United States (U.S.) nuclear fuel cycle where used nuclear fuel is disposed in a repository to a closed fuel cycle where the used fuel is recycled and only fission products and waste are disposed. The report is intended to help inform policy developers, decision makers, and program managers of system-level options and constraints as they guide the formulation and implementation of advanced fuel cycle development and demonstration efforts and move toward deployment of nuclear fuel recycling infrastructure.

  6. Cluster emission in the radioactive decay of 223Ac

    CERN Document Server

    Steyn, G F; Faccio, D; Bonetti, R; Tretyakova, S P; Shishkin, S V; Ogloblin, A A; Pik-Pichak, G A; Vermeulen, C; van der Meulen, N P; van der Walt, T N; McGee, D

    2010-01-01

    The branching ratio of 223Ac decay by spontaneous 14C emission was measured and a search for 15N clusters was performed. After exposure of a hemispherical array of solid-state nuclear track detectors, 347 14C events were identified and no 15N events. B(14C) = λ(14C)/λ(α) = (3.2 ± 1.0) x 10-11 is consistent with a favoured ground state to ground state transition. As no nitrogen tracks were found, only an upper limit could be inferred for 15N emission, B(15N) = λ(15N)/λ(α) ≤ 2.2 x 10-13 (confidence limit 90%), consistent with an unfavoured transition. Intense 227Pa sources were produced for this study, using the reaction 232Th(p,6n)227Pa. This offered an opportunity to compare the measured source strength with predictions based on published excitation function data.

  7. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  8. Fault Tolerant Three-Phase AC Motor Drive Topologies:A Comparison of Features, Cost, and Limitations

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    THE RELIABILITY of adjustables peed ac motor drives is an area of great interest for all members of the drives community and marketplace. This is particularly the case for the military, aerospace and automotive industries that are increasingly adopting variable speed drives in order to improve overall system efficiency and performance. There are certain safety critical applications such as steering, fuel pumps,

  9. The legacy of fossil fuels.

    Science.gov (United States)

    Armaroli, Nicola; Balzani, Vincenzo

    2011-03-01

    Currently, over 80% of the energy used by mankind comes from fossil fuels. Harnessing coal, oil and gas, the energy resources contained in the store of our spaceship, Earth, has prompted a dramatic expansion in energy use and a substantial improvement in the quality of life of billions of individuals in some regions of the world. Powering our civilization with fossil fuels has been very convenient, but now we know that it entails severe consequences. We treat fossil fuels as a resource that anyone anywhere can extract and use in any fashion, and Earth's atmosphere, soil and oceans as a dump for their waste products, including more than 30 Gt/y of carbon dioxide. At present, environmental legacy rather than consistence of exploitable reserves, is the most dramatic problem posed by the relentless increase of fossil fuel global demand. Harmful effects on the environment and human health, usually not incorporated into the pricing of fossil fuels, include immediate and short-term impacts related to their discovery, extraction, transportation, distribution, and burning as well as climate change that are spread over time to future generations or over space to the entire planet. In this essay, several aspects of the fossil fuel legacy are discussed, such as alteration of the carbon cycle, carbon dioxide rise and its measurement, greenhouse effect, anthropogenic climate change, air pollution and human health, geoengineering proposals, land and water degradation, economic problems, indirect effects on the society, and the urgent need of regulatory efforts and related actions to promote a gradual transition out of the fossil fuel era. While manufacturing sustainable solar fuels appears to be a longer-time perspective, alternatives energy sources already exist that have the potential to replace fossil fuels as feedstocks for electricity production.

  10. Simulational studies of epitaxial semiconductor superlattices: Quantum dynamical phenomena in ac and dc electric fields

    Energy Technology Data Exchange (ETDEWEB)

    Reynolds, Joseph [Iowa State Univ., Ames, IA (United States)

    1997-10-08

    Using high-accuracy numerical methods the author investigates the dynamics of independent electrons in both ideal and realistic superlattices subject to arbitrary ac and/or dc electric fields. For a variety of superlattice potentials, optically excited initial wave packets, and combinations of ac and dc electric fields, he numerically solves the time-dependent Schroedinger equation. In the case of ideal periodic superlattice potentials, he investigates a long list of dynamical phenomena involving multiple miniband transitions and time-dependent electric fields. These include acceleration effects associated with interminiband transitions in strong fields, Zener resonances between minibands, dynamic localization with ac fields, increased single-miniband transport with an auxiliary resonant ac field, and enhanced or suppressed interminiband probability exchange using an auxiliary ac field. For all of the cases studied, the resulting time-dependent wave function is analyzed by projecting the data onto convenient orthonormal bases. This allows a detailed comparison with approximately analytic treatments. In an effort to explain the rapid decay of experimentally measured Bloch oscillation (BO) signals the author incorporates a one-dimensional representation of interface roughness (IR) into their superlattice potential. He shows that as a result of IR, the electron dynamics can be characterized in terms of many discrete, incommensurate frequencies near the Block frequency. Chapters 2, 3, 4 and 5 have been removed from this report and will be processed separately.

  11. Fuel cells:

    DEFF Research Database (Denmark)

    Sørensen, Bent

    2013-01-01

    A brief overview of the progress in fuel cell applications and basic technology development is presented, as a backdrop for discussing readiness for penetration into the marketplace as a solution to problems of depletion, safety, climate or environmental impact from currently used fossil and nucl......A brief overview of the progress in fuel cell applications and basic technology development is presented, as a backdrop for discussing readiness for penetration into the marketplace as a solution to problems of depletion, safety, climate or environmental impact from currently used fossil...

  12. Solar fuels

    Energy Technology Data Exchange (ETDEWEB)

    Bolton, J.R.

    1978-11-17

    The paper is concerned with (1) the thermodynamic and kinetic limits for the photochemical conversion and storage of solar energy as it is received on the earth's surface, and (2) the evaluation of a number of possible photochemical reactions with particular emphasis on the production of solar hydrogen from water. Procedures for generating hydrogen fuel are considered. Topics examined include the general requirements for a fuel-generation reaction, the photochemical reaction, limits on the conversion of light energy to chemical energy, an estimate of chemical storage efficiency, and the water decomposition reaction.

  13. Analysis of DC/DC Converter Efficiency for Energy Storage System Based on Bidirectional Fuel Cells

    DEFF Research Database (Denmark)

    Pittini, Riccardo; Zhang, Zhe; Andersen, Michael A. E.

    2013-01-01

    Renewable energy sources are fluctuating depending on the availability of the energy source. For this reason, energy storage is becoming more important and bidirectional fuel cells represent an attractive technology. Fuel cells require highcurrent low-voltage dc-dc or dc-ac converters as power...

  14. Development of a 200kW multi-fuel type PAFC power plant

    Energy Technology Data Exchange (ETDEWEB)

    Take, Tetsuo; Kuwata, Yutaka; Adachi, Masahito; Ogata, Tsutomu [NTT Integrated Information & Energy System Labs., Tokyo (Japan)

    1996-12-31

    Nippon Telegraph and Telephone Corporation (NFT) has been developing a 200 kW multi-fuel type PAFC power plant which can generate AC 200 kW of constant power by switching fuel from pipeline town gas to liquefied propane gas (LPG) and vice versa. This paper describes the outline of the demonstration test plant and test results of its fundamental characteristics.

  15. A Possible Solution for the U.S. Navy’s Addiction to Petroleum: A Business Case Analysis for Transitioning the U.S. Navy From Petroleum to Synthetic Fuel Resources

    Science.gov (United States)

    2007-03-01

    temperatures , to be useful. Today’s tactical vehicles have a limited fuel volume and fuel weight capacity. Furthermore, tactical vehicles are subject to...Kuwait or Dubai and crashing it into Abqaiq or Ras Tanura, could turn the complex into an inferno. 16 This could take up to 50 percent of Saudi...are inconsistencies within the data that affect the capital and operating expenses of each cost study. For example if the feedstock is coal, there

  16. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  17. Energy Transition Initiative: Islands Playbook (Book)

    Energy Technology Data Exchange (ETDEWEB)

    2015-01-01

    The Island Energy Playbook (the Playbook) provides an action-oriented guide to successfully initiating, planning, and completing a transition to an energy system that primarily relies on local resources to eliminate a dependence on one or two imported fuels. It is intended to serve as a readily available framework that any community can adapt to organize its own energy transition effort.

  18. Hysteresis and transition in swirling nonpremixed flames

    NARCIS (Netherlands)

    Tummers, M.J.; Hübner, A.W.; Veen, van E.H.; Hanjalic, K.; Meer, van der Th.H.

    2009-01-01

    Strongly swirling nonpremixed flames are known to exhibit a hysteresis when transiting from an attached long, sooty, yellow flame to a short lifted blue flame, and vice versa. The upward transition (by increasing the air and fuel flow rates) corresponds to a vortex breakdown, i.e. an abrupt change f

  19. Transport fuel

    DEFF Research Database (Denmark)

    Ronsse, Frederik; Jørgensen, Henning; Schüßler, Ingmar

    2014-01-01

    Worldwide, the use of transport fuel derived from biomass increased four-fold between 2003 and 2012. Mainly based on food resources, these conventional biofuels did not achieve the expected emission savings and contributed to higher prices for food commod - ities, especially maize and oilseeds...

  20. Fuel Cells

    Science.gov (United States)

    Hawkins, M. D.

    1973-01-01

    Discusses the theories, construction, operation, types, and advantages of fuel cells developed by the American space programs. Indicates that the cell is an ideal small-scale power source characterized by its compactness, high efficiency, reliability, and freedom from polluting fumes. (CC)

  1. Metal-free and Oxygen-free Graphene as Oxygen Reduction Catalysts for Highly Efficient Fuel Cells

    Science.gov (United States)

    2013-06-30

    L. Science 2009, 323, 760) and nitrogen-doped graphene sheets (Qu, L.; Liu, Y.; Baek, J.-B.; Dai, L. ACS Nano 2010, 4, 1321) as highly efficient...fuel to create heat, fuel cells convert chemical energy directly into electricity. By pumping , for example, hydrogen gas onto one electrode (the anode...760) and nitrogen-doped graphene sheets (Qu, L.; Liu, Y.; Baek, J.-B.; Dai, L. ACS Nano 2010, 4, 1321) as highly efficient ORR, we have developed in

  2. Examining hydrogen transitions.

    Energy Technology Data Exchange (ETDEWEB)

    Plotkin, S. E.; Energy Systems

    2007-03-01

    This report describes the results of an effort to identify key analytic issues associated with modeling a transition to hydrogen as a fuel for light duty vehicles, and using insights gained from this effort to suggest ways to improve ongoing modeling efforts. The study reported on here examined multiple hydrogen scenarios reported in the literature, identified modeling issues associated with those scenario analyses, and examined three DOE-sponsored hydrogen transition models in the context of those modeling issues. The three hydrogen transition models are HyTrans (contractor: Oak Ridge National Laboratory), MARKAL/DOE* (Brookhaven National Laboratory), and NEMS-H2 (OnLocation, Inc). The goals of these models are (1) to help DOE improve its R&D effort by identifying key technology and other roadblocks to a transition and testing its technical program goals to determine whether they are likely to lead to the market success of hydrogen technologies, (2) to evaluate alternative policies to promote a transition, and (3) to estimate the costs and benefits of alternative pathways to hydrogen development.

  3. The Feasibility of Applying AC Driven Low-Temperature Plasma for Multi-Cycle Detonation Initiation

    Science.gov (United States)

    Zheng, Dianfeng

    2016-11-01

    Ignition is a key system in pulse detonation engines (PDE). As advanced ignition methods, nanosecond pulse discharge low-temperature plasma ignition is used in some combustion systems, and continuous alternating current (AC) driven low-temperature plasma using dielectric barrier discharge (DBD) is used for the combustion assistant. However, continuous AC driven plasmas cannot be used for ignition in pulse detonation engines. In this paper, experimental and numerical studies of pneumatic valve PDE using an AC driven low-temperature plasma igniter were described. The pneumatic valve was jointly designed with the low-temperature plasma igniter, and the numerical simulation of the cold-state flow field in the pneumatic valve showed that a complex flow in the discharge area, along with low speed, was beneficial for successful ignition. In the experiments ethylene was used as the fuel and air as oxidizing agent, ignition by an AC driven low-temperature plasma achieved multi-cycle intermittent detonation combustion on a PDE, the working frequency of the PDE reached 15 Hz and the peak pressure of the detonation wave was approximately 2.0 MPa. The experimental verifications of the feasibility in PDE ignition expanded the application field of AC driven low-temperature plasma. supported by National Natural Science Foundation of China (No. 51176001)

  4. Use of silicide fuel in the Ford Nuclear Reactor - to lengthen fuel element lifetimes

    Energy Technology Data Exchange (ETDEWEB)

    Bretscher, M.M.; Snelgrove, J.L. [Argonne National Lab., IL (United States); Burn, R.R.; Lee, J.C. [Univ. of Michigan, Ann Arbor, MI (United States). Phoenix Memorial Lab.

    1995-12-31

    Based on economic considerations, it has been proposed to increase the lifetime of LEU fuel elements in the Ford Nuclear Reactor by raising the {sup 235}U plate loading from 9.3 grams in aluminide (UAl{sub x}) fuel to 12.5 grams in silicide (U{sub 3}Si{sub 2}) fuel. For a representative core configuration, preliminary neutronic depletion and steady state thermal hydraulic calculations have been performed to investigate core characteristics during the transition from an all-aluminide to an all-silicide core. This paper discusses motivations for this fuel element upgrade, results from the calculations, and conclusions.

  5. Fuzzy Logic Based Control of Power of PEM Fuel Cell System for Residential Application

    Directory of Open Access Journals (Sweden)

    Khaled MAMMAR

    2009-07-01

    Full Text Available This paper presents a dynamic model of Fuel cell system for residential power generation. The models proposed include a fuel cell stack model, reformer model and DC/AC inverter model. Furthermore a fuzzy logic (FLC controller is used to control active power of PEM fuel cell system. The controller modifies the hydrogen flow feedback from the terminal load. Simulation results confirmed the high performance capability of the fuzzy logic controller to control power generation.

  6. Fuzzy Logic Based Control of Power of PEM Fuel Cell System for Residential Application

    OpenAIRE

    Khaled MAMMAR; CHAKER, Abdelkader

    2009-01-01

    This paper presents a dynamic model of Fuel cell system for residential power generation. The models proposed include a fuel cell stack model, reformer model and DC/AC inverter model. Furthermore a fuzzy logic (FLC) controller is used to control active power of PEM fuel cell system. The controller modifies the hydrogen flow feedback from the terminal load. Simulation results confirmed the high performance capability of the fuzzy logic controller to control power generation.

  7. A New Green Power Inverter for Fuel Cells

    DEFF Research Database (Denmark)

    Andersen, Gert Karmisholt; Klumpner, Christian; Kjær, Søren Bækhøj;

    2002-01-01

    This paper presents a new grid connected inverter for fuel cells. It consists of a two stage power conversion topology. Since the fuel cell operates with a low voltage in a wide voltage range (25 V-45 V) this volt- age must be transformed to around 350-400 V in order to invert this dc power into ac...... startup. The inverter is controlled as a power factor controller with resistor emulation.Experimental results of converter efficiency, grid performance and fuel cell response are shown for a 1 kW prototype. The proposed converter exhibits a high efficiency in a wide power range (higher than 92...

  8. Electric field in an AC dielectric barrier discharge overlapped with a nanosecond pulse discharge

    Science.gov (United States)

    Goldberg, Benjamin M.; Shkurenkov, Ivan; Adamovich, Igor V.; Lempert, Walter R.

    2016-08-01

    The effect of ns discharge pulses on the AC barrier discharge in hydrogen in plane-to-plane geometry is studied using time-resolved measurements of the electric field in the plasma. The AC discharge was operated at a pressure of 300 Torr at frequencies of 500 and 1750 Hz, with ns pulses generated when the AC voltage was near zero. The electric field vector is measured by ps four-wave mixing technique, which generates coherent IR signal proportional to the square of electric field. Absolute calibration was done using an electrostatic (sub-breakdown) field applied to the discharge electrodes, when no plasma was generated. The results are compared with one-dimensional kinetic modeling of the AC discharge and the nanosecond pulse discharge, predicting behavior of both individual micro-discharges and their cumulative effect on the electric field distribution in the electrode gap, using stochastic averaging based on the experimental micro-discharge temporal probability distribution during the AC period. Time evolution of the electric field in the AC discharge without ns pulses, controlled by a superposition of random micro-discharges, exhibits a nearly ‘flat top’ distribution with the maximum near breakdown threshold, reproduced quite well by kinetic modeling. Adding ns pulse discharges on top of the AC voltage waveform changes the AC discharge behavior in a dramatic way, inducing transition from random micro-discharges to a more regular, near-1D discharge. In this case, reproducible volumetric AC breakdown is produced at a well-defined moment after each ns pulse discharge. During the reproducible AC breakdown, the electric field in the plasma exhibits a sudden drop, which coincides in time with a well-defined current pulse. This trend is also predicted by the kinetic model. Analysis of kinetic modeling predictions shows that this effect is caused by large-volume ionization and neutralization of surface charges on the dielectrics by ns discharge pulses. The present

  9. Memory effect in ac plasma displays

    Science.gov (United States)

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  10. Fuel control system for dual fuel engines

    Energy Technology Data Exchange (ETDEWEB)

    Helmich, M.J.; Ryan, W.P.; Marvin, D.H.

    1987-11-24

    A fuel governing system for an engine adapted for operation on a first fuel and a second fuel is described comprising: a first fuel governing system including a spontaneous motion metering means; and a second fuel governing system, the second fuel governing system further comprising: means for providing a first signal indicative of position of the first fuel metering means, which signal approximates total load on the engine, means for providing a second signal of the selected percentage of first fuel relative to total load, means for controlling flow of the second fuel to the engine, which flow causes reflective displacement of the first fuel metering means, means for determining the difference between the first signal and the second signal, which difference is indicative of distance the first fuel metering means must be moved to attain the selected percentage of first fuel relative to total load, and means for causing operation of the means for controlling flow of the second fuel to the engine to cause displacement of the first fuel metering means equal to the distance the first fuel metering means must be moved to attain the selected percentage of first fuel relative to total load.

  11. Use of Pyrolyzed Iron Ethylenediaminetetraacetic Acid Modified Activated Carbon as Air–Cathode Catalyst in Microbial Fuel Cells

    KAUST Repository

    Xia, Xue

    2013-08-28

    Activated carbon (AC) is a cost-effective catalyst for the oxygen reduction reaction (ORR) in air-cathode microbial fuel cells (MFCs). To enhance the catalytic activity of AC cathodes, AC powders were pyrolyzed with iron ethylenediaminetetraacetic acid (FeEDTA) at a weight ratio of FeEDTA:AC = 0.2:1. MFCs with FeEDTA modified AC cathodes and a stainless steel mesh current collector produced a maximum power density of 1580 ± 80 mW/m2, which was 10% higher than that of plain AC cathodes (1440 ± 60 mW/m 2) and comparable to Pt cathodes (1550 ± 10 mW/m2). Further increases in the ratio of FeEDTA:AC resulted in a decrease in performance. The durability of AC-based cathodes was much better than Pt-catalyzed cathodes. After 4.5 months of operation, the maximum power density of Pt cathode MFCs was 50% lower than MFCs with the AC cathodes. Pyridinic nitrogen, quaternary nitrogen and iron species likely contributed to the increased activity of FeEDTA modified AC. These results show that pyrolyzing AC with FeEDTA is a cost-effective and durable way to increase the catalytic activity of AC. © 2013 American Chemical Society.

  12. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  13. Molecular modeling of methyl-α-Neu5Ac analogues docked against cholera toxin--a molecular dynamics study.

    Science.gov (United States)

    Blessy, J Jino; Sharmila, D Jeya Sundara

    2015-02-01

    Molecular modeling of synthetic methyl-α-Neu5Ac analogues modified in C-9 position was investigated by molecular docking and molecular dynamics (MD) simulation methods. Methyl-α-Neu5Ac analogues were docked against cholera toxin (CT) B subunit protein and MD simulations were carried out for three Methyl-α-Neu5Ac analogue-CT complexes (30, 10 and 10 ns) to estimate the binding activity of cholera toxin-Methyl-α-Neu5Ac analogues using OPLS_2005 force field. In this study, direct and water mediated hydrogen bonds play a vital role that exist between the methyl-α-9-N-benzoyl-amino-9-deoxy-Neu5Ac (BENZ)-cholera toxin active site residues. The Energy plot, RMSD and RMSF explain that the simulation was stable throughout the simulation run. Transition of phi, psi and omega angle for the complex was calculated. Molecular docking studies could be able to identify the binding mode of methyl-α-Neu5Ac analogues in the binding site of cholera toxin B subunit protein. MD simulation for Methyl-α-9-N-benzoyl-amino-9-deoxy-Neu5Ac (BENZ), Methyl-α-9-N-acetyl-9-deoxy-9-amino-Neu5Ac and Methyl-α-9-N-biphenyl-4-acetyl-deoxy-amino-Neu5Ac complex with CT B subunit protein was carried out, which explains the stable nature of interaction. These methyl-α-Neu5Ac analogues that have computationally acceptable pharmacological properties may be used as novel candidates for drug design for cholera disease.

  14. Magnetization of YBCO film with ac travelling magnetic waves of relatively short wavelengths

    Science.gov (United States)

    Wang, Wei; Coombs, Tim

    2017-02-01

    The magnetizations of the YBCO film with ac travelling magnetic waves of relatively short wavelengths were studied. The results have verified that the reported "intermediate value" of the superconducting current density [Wang et al., Appl. Phys. Lett. 104(3), 032602 (2014)] was caused by the existence of multiple transition regions in the sample: the magnetic poles induce ±JC in the pole regions, which produces two transition regions within each wavelength λ ( +JC→-JC→+JC , and vice versa, while the symbol → indicates the transition region). The current densities in the transition region are with intermediate values, which are smaller than the critical value. In case of relatively short wavelength, there are multiple transition regions, which occupy a large fraction of the YBCO sample with intermediate current values. Moreover, the wavelike current distributions might help explain the flux transportation and dc output voltage in HTS flux pump.

  15. Sustainable Transition

    DEFF Research Database (Denmark)

    Hansen, Ole Erik; Søndergård, Bent

    2014-01-01

    transition processes. Where. Addresses design processes aimed at sustainable transition enacted in complex social settings, socio-technical systems involving many different actors and agendas. How. The chapter outlines a conceptual and analytic framework for a reflexive design practice for sustainability...... including the perspective of structural changes (transition of socio-technical systems and social practices) and Design as metadesign; an reflexivity on contextual framework of the design practice (regimes/design spaces)....

  16. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Energy Technology Data Exchange (ETDEWEB)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  17. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  18. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  19. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  20. AcEST: DK954326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available mily ATPase, CDC48 subfamily OS=Met... 125 1e-27 tr|B8GJ73|B8GJ73_9EURY AAA famil...al transitional endo... 122 1e-26 tr|A7IB30|A7IB30_METB6 AAA family ATPase, CDC48 subfamily OS=Met...... 122 2e-26 tr|A2SR43|A2SR43_METLZ AAA family ATPase, CDC48 subfamily OS=Met... 122 2e-26...et... 120 5e-26 tr|Q2FSR5|Q2FSR5_METHJ AAA family ATPase, CDC48 subfamily OS=Met... 120 5e-26 >tr|O81459|O81

  1. Josephson effects in an alternating current biased transition edge sensor

    CERN Document Server

    Gottardi, Luciano; Akamatsu, Hiroki; van der Kuur, Jan; Bruijn, Marcel P; Hartog, Roland H den; Hijmering, Richard; Khosropanah, Pourya; Lambert, Colin; van der Linden, Anton J; Ridder, Marcel L; Suzuki, Toyo; Gao, Jan R

    2016-01-01

    We report the experimental evidence of the ac Josephson effect in a transition edge sensor (TES) operating in a frequency domain multiplexer and biased by ac voltage at MHz frequencies. The effect is observed by measuring the non-linear impedance of the sensor. The TES is treated as a weakly linked superconducting system and within the resistively shunted junction model framework. We provide a full theoretical explanation of the results by finding the analytic solution of the non-inertial Langevian equation of the system and calculating the non-linear response of the detector to a large ac bias current in the presence of noise.

  2. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  3. Transition? What transition? : Changing energy systems in an increasingly carbon constrained world

    NARCIS (Netherlands)

    Mc Cahery, J.A.; Lopez de Silanes, Florencio; de Roode, Alexander

    2014-01-01

    Energy transitions have been taking place continuously since the Industrial Revolution. These transitions primarily involve national energy mixes. In general, countries keep moving up the energy ladder, meaning that they integrate larger and larger proportions of specialized fuels into their energy

  4. Micro pumping methods based on AC electrokinetics and Electrorheologically actuated PDMS valves

    Science.gov (United States)

    Soni, Gaurav; Squires, Todd; Meinhart, Carl

    2006-11-01

    We have developed 2 different micropumping methods for transporting ionic fluids through microchannels. The first method is based on Induced Charge Electroosmosis (ICEO) and AC flow field-effect. We used an AC electric field to produce a symmetric ICEO flow on a planar electrode, called `gate'. In order to break the symmetry of ICEO, we applied an additional AC voltage to the gate electrode. Such modulation of the gate potential is called field effect and produces a unidirectional pumping over the gate surface. We used micro PIV to measure pumping velocities for a range of ionic concentration, AC frequency and gate voltage. We have also conducted numerical simulations to understand the deteriorating effect of lateral conduction of surface charge on the pumping velocities. The second method is based on vibration of a flexible PDMS diaphragm actuated by an electrorheological (ER) fluid. ER fluid is a colloidal suspension exhibiting a reversible liquid-to-solid transition under an electric field. This liquid-to-solid transition can yield very high shear stress and can be used to open and close a PDMS valve. Three such valves were fabricated and actuated in a peristaltic fashion in order to achieve positive displacement pumping of fluids.

  5. A Generalised Fault Protection Structure Proposed for Uni-grounded Low-Voltage AC Microgrids

    Science.gov (United States)

    Bui, Duong Minh; Chen, Shi-Lin; Lien, Keng-Yu; Jiang, Jheng-Lun

    2016-04-01

    This paper presents three main configurations of uni-grounded low-voltage AC microgrids. Transient situations of a uni-grounded low-voltage (LV) AC microgrid (MG) are simulated through various fault tests and operation transition tests between grid-connected and islanded modes. Based on transient simulation results, available fault protection methods are proposed for main and back-up protection of a uni-grounded AC microgrid. In addition, concept of a generalised fault protection structure of uni-grounded LVAC MGs is mentioned in the paper. As a result, main contributions of the paper are: (i) definition of different uni-grounded LVAC MG configurations; (ii) analysing transient responses of a uni-grounded LVAC microgrid through line-to-line faults, line-to-ground faults, three-phase faults and a microgrid operation transition test, (iii) proposing available fault protection methods for uni-grounded microgrids, such as: non-directional or directional overcurrent protection, under/over voltage protection, differential current protection, voltage-restrained overcurrent protection, and other fault protection principles not based on phase currents and voltages (e.g. total harmonic distortion detection of currents and voltages, using sequence components of current and voltage, 3I0 or 3V0 components), and (iv) developing a generalised fault protection structure with six individual protection zones to be suitable for different uni-grounded AC MG configurations.

  6. Aviation fuels outlook

    Science.gov (United States)

    Momenthy, A. M.

    1980-01-01

    Options for satisfying the future demand for commercial jet fuels are analyzed. It is concluded that the most effective means to this end are to attract more refiners to the jet fuel market and encourage development of processes to convert oil shale and coal to transportation fuels. Furthermore, changing the U.S. refineries fuel specification would not significantly alter jet fuel availability.

  7. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  8. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  9. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  10. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  11. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  12. Consistent behaviour of AC susceptibility and transport properties in magnetic superconductor RuSr 2GdCu 2O 8

    Science.gov (United States)

    Očko, M.; Živkovic, I.; Prester, M.; Drobac, Dj.; Ariosa, D.; Berger, H.; Pavuna, D.

    2004-02-01

    We report on AC susceptibility, resistivity, thermopower and measurements of sintered magnetic superconductor RuSr 2GdCu 2O 8. The antiferromagnetic phase transition at 133 K is seen clearly in the AC susceptibility as well as in the derivative of resistivity and thermopower. Above the antiferromagnetic transition, we have found some new evidences of the similarity between HTC compounds and the magnetic superconductor. The onset of superconductivity is observed by both transport methods at 46 K, and an explanation why it is not seen in the AC susceptibility data is given. The end of the SC transition occurs at about 24 K in all measured properties. We discuss the steps of broad SC transition, especially the maximum in susceptibility at 34 K, and compare our results with related studies reported in the literature.

  13. Consistent behaviour of AC susceptibility and transport properties in magnetic superconductor RuSr{sub 2}GdCu{sub 2}O{sub 8}

    Energy Technology Data Exchange (ETDEWEB)

    Ocko, M. E-mail: ocko@ifs.hr; Zivkovic, I.; Prester, M.; Drobac, Dj.; Ariosa, D.; Berger, H.; Pavuna, D

    2004-02-01

    We report on AC susceptibility, resistivity, thermopower and measurements of sintered magnetic superconductor RuSr{sub 2}GdCu{sub 2}O{sub 8}. The antiferromagnetic phase transition at 133 K is seen clearly in the AC susceptibility as well as in the derivative of resistivity and thermopower. Above the antiferromagnetic transition, we have found some new evidences of the similarity between HTC compounds and the magnetic superconductor. The onset of superconductivity is observed by both transport methods at 46 K, and an explanation why it is not seen in the AC susceptibility data is given. The end of the SC transition occurs at about 24 K in all measured properties. We discuss the steps of broad SC transition, especially the maximum in susceptibility at 34 K, and compare our results with related studies reported in the literature.

  14. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  15. Levels in 221Fr fed by the α decay of 225Ac

    Science.gov (United States)

    Ardisson, G.; Gasparro, J.; Barci, V.; Sheline, R. K.

    2000-12-01

    The α decay of 225Ac to 221Fr was reinvestigated by γ-ray spectroscopic studies with HPGe detectors and 225Ac sources purified using continuous elution processes. Energies and intensities of about 120 γ-ray transitions were measured. Among these, 40 are reported for the first time. A 221Fr level scheme with 46 excited states and 124 transitions is proposed. The level structure is described in terms of a reflection asymmetric structure with parity doublet bands Kπ=1/2+/-, 3/2+/-, 5/2+/-, and 3/2+/- in order of increasing energy. Both strong and intermediate coupling models have been shown to be in good agreement with the experimental data.

  16. Immobilization of a Metal-Nitrogen-Carbon Catalyst on Activated Carbon with Enhanced Cathode Performance in Microbial Fuel Cells.

    Science.gov (United States)

    Yang, Wulin; Logan, Bruce E

    2016-08-23

    Applications of microbial fuel cells (MFCs) are limited in part by low power densities mainly due to cathode performance. Successful immobilization of an Fe-N-C co-catalyst on activated carbon (Fe-N-C/AC) improved the oxygen reduction reaction to nearly a four-electron transfer, compared to a twoelectron transfer achieved using AC. With acetate as the fuel, the maximum power density was 4.7±0.2 W m(-2) , which is higher than any previous report for an air-cathode MFC. With domestic wastewater as a fuel, MFCs with the Fe-N-C/AC cathode produced up to 0.8±0.03 W m(-2) , which was twice that obtained with a Pt-catalyzed cathode. The use of this Fe-N-C/AC catalyst can therefore substantially increase power production, and enable broader applications of MFCs for renewable electricity generation using waste materials.

  17. Dynamic Stark effect and forbidden-transition spectrallineshapes

    Energy Technology Data Exchange (ETDEWEB)

    Stalnaker, Jason E.; Budker, D.; Freedman, S.J.; Guzman, J.S.; Rochester, S.M.; Yashchuk, V.V.

    2005-12-15

    We report on an experimental and theoretical study of thedynamic (ac) Stark effect on a for bidden transition. A general frameworkfor parameterizing and describing off-resonant ac-Stark shifts ispresented. A model is developed to calculate spectral line shapesresulting from resonant excitation of atoms in an intense standinglight-wave in the presence of off-resonant ac-Stark shifts. The model isused in the analysis and interpretation of a measurement of the ac-Starkshifts of the static-electric-field-induced 6s2 1S0 -->5d6s 3D1transition at 408 nm in atomic Yb. The results are in agreement withestimates of the ac-Stark shift of the transition under the assumptionthat the shift is dominated by that of the 6s2 1S0 ground state. Adetailed description of the experiment and analysis is presented. Abi-product of this work is an ind ependent determination (from thesaturation behavior of the 408-nm transition) of the Stark transitionpolarizability, which is found to be in agreement with our earliermeasurement. This work is part of the ongoing effort aimed at a precisionmeasurement of atomic parity-violation effects in Yb.

  18. Current distribution effects in AC impedance spectroscopy of electroceramic point contact and thin film model electrodes

    DEFF Research Database (Denmark)

    Nielsen, Jimmi; Jacobsen, Torben

    2010-01-01

    The Finite-Element-Method (FEM) was used for the simulations of the effect of a changing current distribution during AC impedance spectrum recording on electroceramic point contact and thin film model electrodes. For pure electronic conducting point contact electrodes the transition from...... regarding its significance is provided. The associated characteristic impedance spectrum shape change is simulated and its origin discussed. Furthermore, the characteristic shape of impedance spectra of thin electroceramic film electrodes with lateral ohmic resistance is studied as a function...

  19. Reinvestigation of superconducting phase diagram of UGe{sub 2} by AC magnetic susceptibility experiment

    Energy Technology Data Exchange (ETDEWEB)

    Ban, S. [Deptartment of Physics, University of Nagoya, Nagoya, 464-8602 (Japan)]. E-mail: f060214d@mbox.nagoya-u.ac.jp; Deguchi, K. [Deptartment of Physics, University of Nagoya, Nagoya, 464-8602 (Japan); Aso, N. [Institute for Solid State Physics, University of Tokyo, Kashiwa 277-8581 (Japan); Homma, Y. [Oarai Branch, Inst. for Mater. Research, University of Tohoku, Ibaraki 311-1313 (Japan); Shiokawa, Y. [Oarai Branch, Inst. for Mater. Research, University of Tohoku, Ibaraki 311-1313 (Japan); Sato, N.K. [Deptartment of Physics, University of Nagoya, Nagoya, 464-8602 (Japan)

    2007-03-15

    We report a superconducting phase diagram of the ferromagnetic superconductor UGe{sub 2} investigated by AC magnetic susceptibility measurements. In contrast to previous phase diagrams, we found that the superconducting transition temperature and volume fraction show a 'M-shaped' structure as a function of pressure. From this observation, we suggest that both of two critical points will play a crucial role in the occurrence of superconductivity in UGe{sub 2}.

  20. Fuel processors for fuel cell APU applications

    Science.gov (United States)

    Aicher, T.; Lenz, B.; Gschnell, F.; Groos, U.; Federici, F.; Caprile, L.; Parodi, L.

    The conversion of liquid hydrocarbons to a hydrogen rich product gas is a central process step in fuel processors for auxiliary power units (APUs) for vehicles of all kinds. The selection of the reforming process depends on the fuel and the type of the fuel cell. For vehicle power trains, liquid hydrocarbons like gasoline, kerosene, and diesel are utilized and, therefore, they will also be the fuel for the respective APU systems. The fuel cells commonly envisioned for mobile APU applications are molten carbonate fuel cells (MCFC), solid oxide fuel cells (SOFC), and proton exchange membrane fuel cells (PEMFC). Since high-temperature fuel cells, e.g. MCFCs or SOFCs, can be supplied with a feed gas that contains carbon monoxide (CO) their fuel processor does not require reactors for CO reduction and removal. For PEMFCs on the other hand, CO concentrations in the feed gas must not exceed 50 ppm, better 20 ppm, which requires additional reactors downstream of the reforming reactor. This paper gives an overview of the current state of the fuel processor development for APU applications and APU system developments. Furthermore, it will present the latest developments at Fraunhofer ISE regarding fuel processors for high-temperature fuel cell APU systems on board of ships and aircrafts.

  1. GSPEL - Fuel Cell Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Fuel Cell Lab (FCL) Provides testing for technology readiness of fuel cell systems The FCL investigates, tests and verifies the performance of fuel-cell systems...

  2. GSPEL - Fuel Cell Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Fuel Cell Lab (FCL)Provides testing for technology readiness of fuel cell systems The FCL investigates, tests and verifies the performance of fuel-cell systems...

  3. Fuel cells: A survey

    Science.gov (United States)

    Crowe, B. J.

    1973-01-01

    A survey of fuel cell technology and applications is presented. The operating principles, performance capabilities, and limitations of fuel cells are discussed. Diagrams of fuel cell construction and operating characteristics are provided. Photographs of typical installations are included.

  4. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  5. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  6. Sustainability of Fossil Fuels

    Science.gov (United States)

    Lackner, K. S.

    2002-05-01

    For a sustainable world economy, energy is a bottleneck. Energy is at the basis of a modern, technological society, but unlike materials it cannot be recycled. Energy or more precisely "negentropy" (the opposite of entropy) is always consumed. Thus, one either accepts the use of large but finite resources or must stay within the limits imposed by dilute but self-renewing resources like sunlight. The challenge of sustainable energy is exacerbated by likely growth in world energy demand due to increased population and increased wealth. Most of the world still has to undergo the transition to a wealthy, stable society with the near zero population growth that characterizes a modern industrial society. This represents a huge unmet demand. If ten billion people were to consume energy like North Americans do today, world energy demand would be ten times higher. In addition, technological advances while often improving energy efficiency tend to raise energy demand by offering more opportunity for consumption. Energy consumption still increases at close to the 2.3% per year that would lead to a tenfold increase over the course of the next century. Meeting future energy demands while phasing out fossil fuels appears extremely difficult. Instead, the world needs sustainable or nearly sustainable fossil fuels. I propose the following definition of sustainable under which fossil fuels would well qualify: The use of a technology or resource is sustainable if the intended and unintended consequences will not force its abandonment within a reasonable planning horizon. Of course sustainable technologies must not be limited by resource depletion but this is only one of many concerns. Environmental impacts, excessive land use, and other constraints can equally limit the use of a technology and thus render it unsustainable. In the foreseeable future, fossil fuels are not limited by resource depletion. However, environmental concerns based on climate change and other environmental

  7. Future aviation fuels overview

    Science.gov (United States)

    Reck, G. M.

    1980-01-01

    The outlook for aviation fuels through the turn of the century is briefly discussed and the general objectives of the NASA Lewis Alternative Aviation Fuels Research Project are outlined. The NASA program involves the evaluation of potential characteristics of future jet aircraft fuels, the determination of the effects of those fuels on engine and fuel system components, and the development of a component technology to use those fuels.

  8. Power Electronic Transformer based Three-Phase PWM AC Drives

    Science.gov (United States)

    Basu, Kaushik

    A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common

  9. Phase transitions

    CERN Document Server

    Solé, Ricard V

    2011-01-01

    Phase transitions--changes between different states of organization in a complex system--have long helped to explain physics concepts, such as why water freezes into a solid or boils to become a gas. How might phase transitions shed light on important problems in biological and ecological complex systems? Exploring the origins and implications of sudden changes in nature and society, Phase Transitions examines different dynamical behaviors in a broad range of complex systems. Using a compelling set of examples, from gene networks and ant colonies to human language and the degradation o

  10. Modelling and control of hybrid renewable energy system connected to AC grid

    Directory of Open Access Journals (Sweden)

    Sami Younsi

    2011-12-01

    Full Text Available This paper discusses the development of new control and supervision method for the optimum operation of hybrid renewable energy system (HRES connected to AC grid. The hybrid system consists of wind generator (WG, diesel generator (DG, and flywheel energy storage system (FESS. These subsystems are based on permanent magnet synchronous machines (PMSM which are controlled by sliding mode control. A supervisor control is designed to determine the energy transfer type of flywheel energy storage system (charging / discharging / no transfer energy, to take decision on diesel generators ON/OFF status, and to determine the reference powers for these two subsystems. The supervisor inputs are the power requested by AC grid, the power generated by wind generator, and the energy stored in flywheel. The objectives of the control and supervision for hybrid renewable energy system are to satisfy the power requested by AC grid, to manage the energy transfer between hybrid system and AC grid, to optimize the use of wind energy, and to reduce fuel of diesel generator. The system is simulated with Matlab – Simulink software and it gave good results.

  11. Current interruption measurement and analysis for PEM fuel cell

    Energy Technology Data Exchange (ETDEWEB)

    Sun, J.C.; Yuan, X.; Wang, H. [National Research Council of Canada, Vancouver, BC (Canada). Inst. for Fuel Cell Innovation

    2007-07-01

    The ohmic resistance, charge transfer resistance and the capacity discharge limit of proton exchange membrane (PEM) fuel cells can be evaluated and characterized by a newly developed, low cost, current interruption measuring method. This paper presented the results of a study in which the current interruption measurement for a PEM fuel cell was set up and proven through measurements with a dummy cell. The current interruption characteristics of a 500 W PEM fuel cell stack with an active area of 280 cm{sup 2} was measured using the National Instrument PCI data acquisition unit combined with a TDI electronics load-bank and a FuelCon test station, at different load currents. The ohmic loss of the stack determined by current interruption measurements was in good agreement with that determined by AC impedance spectroscopy. The same setup was shown to be effective for single cell measurements of a small PEM fuel cell and for a PEM fuel cell stack with a load bank. It was concluded that the current interruption measurement is much faster than the AC impedance method, but has lower accuracy, particularly for a signal with high noise. 1 ref., 10 figs.

  12. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  13. Catalytic Fuel Conversion Facility

    Data.gov (United States)

    Federal Laboratory Consortium — This facility enables unique catalysis research related to power and energy applications using military jet fuels and alternative fuels. It is equipped with research...

  14. Fuel cell

    Energy Technology Data Exchange (ETDEWEB)

    Enomoto, Hirofumi.

    1989-05-22

    This invention aims to maintain a long-term operation with stable cell output characteristics by uniformly supplying an electrolyte from the reserver to the matrix layer over the entire matrix layer, and further to prevent the excessive wetting of the catalyst layer by smoothly absorbing the volume change of the electrolyte, caused by the repeated stop/start-up of the fuel cell, within the reserver system. For this purpose, in this invention, an electrolyte transport layer, which connects with an electrolyte reservor formed at the electrode end, is partly formed between the electrode material and the catalyst layer; a catalyst layer, which faces the electrolyte transport layer, has through-holes, which connect to the matrix, dispersely distributed. The electrolyte-transport layer is a thin sheet of a hydrophilic fibers which are non-wovens of such fibers as carbon, silicon carbide, silicon nitride or inorganic oxides. 11 figs.

  15. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  16. Synthetic and Biomass Alternate Fueling in Aviation

    Science.gov (United States)

    Hendricks, Robert C.; Bushnell, Dennis M.

    2009-01-01

    Must use earth's most abundant natural resources - Biomass, Solar, Arid land (43%), Seawater (97%) with nutrients (80%) plus brackish waters and nutrients resolve environmental triangle of conflicts energy-food-freshwater and ultrafine particulate hazards. Requires Paradigm Shift - Develop and Use Solar* for energy; Biomass for aviation and hybrid-electric-compressed air mobility fueling with transition to hydrogen long term.

  17. FUEL CELL BUS DEMONSTRATION IN MEXICO CITY

    Science.gov (United States)

    The report discusses the performance of a cull-size, zero-emission, Proton Exchange Membrane (PEM) fuel-cell-powered transit bus in the atmospheric environment of Mexico City. To address the air quality problems caused by vehicle emissions in Mexico City, a seminar on clean vehic...

  18. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  19. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  20. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  1. AC410 Unit 2 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

      AC410 Unit 2 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-2-homework-assignment/   3-31 Ron Barber, CPA, is auditing the financial statements of DGF, Inc., a publicly held company. During the course of the audit, Barber discovered that DGF has been making illegal bribes to foreign government officials to obtain business, and he reported the matter to senior management and the board of directors of DGF. Required: If management a...

  2. Consolidated Fuel Reprocessing Program. Progress report, January 1 to March 31, 1979

    Energy Technology Data Exchange (ETDEWEB)

    Unger, W.E. (comp.)

    1979-06-01

    On Oct. 1, 1978, a transition phase was begun to concentrate all US fuel reprocessing research in one major program, the Consolidated Fuel Reprocessing Program (CFRP). The CFRP is organized into the following: process R and D, engineering research, engineering systems, technical support, HTGR fuel reprocessing, and pyrochemical and dry processing methods. Progress is reported in each area. (DLC)

  3. High performance, high durability non-precious metal fuel cell catalysts

    Energy Technology Data Exchange (ETDEWEB)

    Wood, Thomas E.; Atanasoski, Radoslav; Schmoeckel, Alison K.

    2016-03-15

    This invention relates to non-precious metal fuel cell cathode catalysts, fuel cells that contain these catalysts, and methods of making the same. The fuel cell cathode catalysts are highly nitrogenated carbon materials that can contain a transition metal. The highly nitrogenated carbon materials can be supported on a nanoparticle substrate.

  4. Strongly correlated perovskite fuel cells

    Science.gov (United States)

    Zhou, You; Guan, Xiaofei; Zhou, Hua; Ramadoss, Koushik; Adam, Suhare; Liu, Huajun; Lee, Sungsik; Shi, Jian; Tsuchiya, Masaru; Fong, Dillon D.; Ramanathan, Shriram

    2016-06-01

    Fuel cells convert chemical energy directly into electrical energy with high efficiencies and environmental benefits, as compared with traditional heat engines. Yttria-stabilized zirconia is perhaps the material with the most potential as an electrolyte in solid oxide fuel cells (SOFCs), owing to its stability and near-unity ionic transference number. Although there exist materials with superior ionic conductivity, they are often limited by their ability to suppress electronic leakage when exposed to the reducing environment at the fuel interface. Such electronic leakage reduces fuel cell power output and the associated chemo-mechanical stresses can also lead to catastrophic fracture of electrolyte membranes. Here we depart from traditional electrolyte design that relies on cation substitution to sustain ionic conduction. Instead, we use a perovskite nickelate as an electrolyte with high initial ionic and electronic conductivity. Since many such oxides are also correlated electron systems, we can suppress the electronic conduction through a filling-controlled Mott transition induced by spontaneous hydrogen incorporation. Using such a nickelate as the electrolyte in free-standing membrane geometry, we demonstrate a low-temperature micro-fabricated SOFC with high performance. The ionic conductivity of the nickelate perovskite is comparable to the best-performing solid electrolytes in the same temperature range, with a very low activation energy. The results present a design strategy for high-performance materials exhibiting emergent properties arising from strong electron correlations.

  5. Strongly correlated perovskite fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, You; Guan, Xiaofei; Zhou, Hua; Ramadoss, Koushik; Adam, Suhare; Liu, Huajun; Lee, Sungsik; Shi, Jian; Tsuchiya, Masaru; Fong, Dillon D.; Ramanathan, Shriram

    2016-05-16

    Fuel cells convert chemical energy directly into electrical energy with high efficiencies and environmental benefits, as compared with traditional heat engines1, 2, 3, 4. Yttria-stabilized zirconia is perhaps the material with the most potential as an electrolyte in solid oxide fuel cells (SOFCs), owing to its stability and near-unity ionic transference number5. Although there exist materials with superior ionic conductivity, they are often limited by their ability to suppress electronic leakage when exposed to the reducing environment at the fuel interface. Such electronic leakage reduces fuel cell power output and the associated chemo-mechanical stresses can also lead to catastrophic fracture of electrolyte membranes6. Here we depart from traditional electrolyte design that relies on cation substitution to sustain ionic conduction. Instead, we use a perovskite nickelate as an electrolyte with high initial ionic and electronic conductivity. Since many such oxides are also correlated electron systems, we can suppress the electronic conduction through a filling-controlled Mott transition induced by spontaneous hydrogen incorporation. Using such a nickelate as the electrolyte in free-standing membrane geometry, we demonstrate a low-temperature micro-fabricated SOFC with high performance. The ionic conductivity of the nickelate perovskite is comparable to the best-performing solid electrolytes in the same temperature range, with a very low activation energy. The results present a design strategy for high-performance materials exhibiting emergent properties arising from strong electron correlations.

  6. Strongly correlated perovskite fuel cells.

    Science.gov (United States)

    Zhou, You; Guan, Xiaofei; Zhou, Hua; Ramadoss, Koushik; Adam, Suhare; Liu, Huajun; Lee, Sungsik; Shi, Jian; Tsuchiya, Masaru; Fong, Dillon D; Ramanathan, Shriram

    2016-06-09

    Fuel cells convert chemical energy directly into electrical energy with high efficiencies and environmental benefits, as compared with traditional heat engines. Yttria-stabilized zirconia is perhaps the material with the most potential as an electrolyte in solid oxide fuel cells (SOFCs), owing to its stability and near-unity ionic transference number. Although there exist materials with superior ionic conductivity, they are often limited by their ability to suppress electronic leakage when exposed to the reducing environment at the fuel interface. Such electronic leakage reduces fuel cell power output and the associated chemo-mechanical stresses can also lead to catastrophic fracture of electrolyte membranes. Here we depart from traditional electrolyte design that relies on cation substitution to sustain ionic conduction. Instead, we use a perovskite nickelate as an electrolyte with high initial ionic and electronic conductivity. Since many such oxides are also correlated electron systems, we can suppress the electronic conduction through a filling-controlled Mott transition induced by spontaneous hydrogen incorporation. Using such a nickelate as the electrolyte in free-standing membrane geometry, we demonstrate a low-temperature micro-fabricated SOFC with high performance. The ionic conductivity of the nickelate perovskite is comparable to the best-performing solid electrolytes in the same temperature range, with a very low activation energy. The results present a design strategy for high-performance materials exhibiting emergent properties arising from strong electron correlations.

  7. Cascaded Buck-Boost AC/AC converter%级联式Buck-Boost AC/AC变换器

    Institute of Scientific and Technical Information of China (English)

    张友军; 丁明昌; 任永保; 王阿敏; 翁振明

    2010-01-01

    详细分析了Buck型和Boost型AC/AC变换器的工作原理及其控制方法,在此基础上提出了一种新型级联式Buck-Boost AC/AC变换器及其三模式控制策略.三模式控制策略是比较输入电压与基准输出电压的大小,使得变换器只有3种工作模式:Buck模式、Boost模式和滤波模式.该电路虽然由Buck型和Boost型AC/AC变换器2级变换器级联而成,并采用2级占空比调制,但实际上最多只存在一级功率变换,具有控制简单、变换效率高、开关管电压应力低等优点.仿真结果证明了级联式Buck-Boost AC/AC变换器及其控制策略的可行性和理论分析的正确性.

  8. Neutronics and Fuel Performance Evaluation of Accident Tolerant Fuel under Normal Operation Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Xu Wu; Piyush Sabharwall; Jason Hales

    2014-07-01

    This report details the analysis of neutronics and fuel performance analysis for enhanced accident tolerance fuel, with Monte Carlo reactor physics code Serpent and INL’s fuel performance code BISON, respectively. The purpose is to evaluate two of the most promising candidate materials, FeCrAl and Silicon Carbide (SiC), as the fuel cladding under normal operating conditions. Substantial neutron penalty is identified when FeCrAl is used as monolithic cladding for current oxide fuel. From the reactor physics standpoint, application of the FeCrAl alloy as coating layer on surface of zircaloy cladding is possible without increasing fuel enrichment. Meanwhile, SiC brings extra reactivity and the neutron penalty is of no concern. Application of either FeCrAl or SiC could be favorable from the fuel performance standpoint. Detailed comparison between monolithic cladding and hybrid cladding (cladding + coating) is discussed. Hybrid cladding is more practical based on the economics evaluation during the transition from current UO2/zircaloy to Accident Tolerant Fuel (ATF) system. However, a few issues remain to be resolved, such as the creep behavior of FeCrAl, coating spallation, inter diffusion with zirconium, etc. For SiC, its high thermal conductivity, excellent creep resistance, low thermal neutron absorption cross section, irradiation stability (minimal swelling) make it an excellent candidate materials for future nuclear fuel/cladding system.

  9. Transitioning to Biofuels: A System-of-Systems Perspective; Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Riley, C.; Sandor, D.

    2008-06-01

    Using the existing fuel supply chain infrastructure as a framework, this paper discusses a vision for transitioning to a larger biofuels industry and the challenges associated with a massive market and infrastructure transformation.

  10. HTGR fuel and fuel cycle technology

    Energy Technology Data Exchange (ETDEWEB)

    Lotts, A.L.; Coobs, J.H.

    1976-08-01

    The status of fuel and fuel cycle technology for high-temperature gas-cooled reactors (HTGRs) is reviewed. The all-ceramic core of the HTGRs permits high temperatures compared with other reactors. Core outlet temperatures of 740/sup 0/C are now available for the steam cycle. For advanced HTGRs such as are required for direct-cycle power generation and for high-temperature process heat, coolant temperatures as high as 1000/sup 0/C may be expected. The paper discusses the variations of HTGR fuel designs that meet the performance requirements and the requirements of the isotopes to be used in the fuel cycle. Also discussed are the fuel cycle possibilities, which include the low-enrichment cycle, the Th-/sup 233/U cycle, and plutonium utilization in either cycle. The status of fuel and fuel cycle development is summarized.

  11. Economics of Direct Hydrogen Polymer Electrolyte Membrane Fuel Cell Systems

    Energy Technology Data Exchange (ETDEWEB)

    Mahadevan, Kathyayani

    2011-10-04

    Battelle's Economic Analysis of PEM Fuel Cell Systems project was initiated in 2003 to evaluate the technology and markets that are near-term and potentially could support the transition to fuel cells in automotive markets. The objective of Battelle?s project was to assist the DOE in developing fuel cell systems for pre-automotive applications by analyzing the technical, economic, and market drivers of direct hydrogen PEM fuel cell adoption. The project was executed over a 6-year period (2003 to 2010) and a variety of analyses were completed in that period. The analyses presented in the final report include: Commercialization scenarios for stationary generation through 2015 (2004); Stakeholder feedback on technology status and performance status of fuel cell systems (2004); Development of manufacturing costs of stationary PEM fuel cell systems for backup power markets (2004); Identification of near-term and mid-term markets for PEM fuel cells (2006); Development of the value proposition and market opportunity of PEM fuel cells in near-term markets by assessing the lifecycle cost of PEM fuel cells as compared to conventional alternatives used in the marketplace and modeling market penetration (2006); Development of the value proposition of PEM fuel cells in government markets (2007); Development of the value proposition and opportunity for large fuel cell system application at data centers and wastewater treatment plants (2008); Update of the manufacturing costs of PEM fuel cells for backup power applications (2009).

  12. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  13. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  14. DIGESTER GAS - FUEL CELL - PROJECT

    Energy Technology Data Exchange (ETDEWEB)

    Dr.-Eng. Dirk Adolph; Dipl.-Eng. Thomas Saure

    2002-03-01

    GEW has been operating the first fuel cell in Europe producing heat and electricity from digester gas in an environmentally friendly way. The first 9,000 hours in operation were successfully concluded in August 2001. The fuel cell powered by digester gas was one of the 25 registered ''Worldwide projects'' which NRW presented at the EXPO 2000. In addition to this, it is a key project of the NRW State Initiative on Future Energies. All of the activities planned for the first year of operation were successfully completed: installing and putting the plant into operation, the transition to permanent operation as well as extended monitoring till May 2001.

  15. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  16. The system architecture for renewable synthetic fuels

    DEFF Research Database (Denmark)

    Ridjan, Iva

    To overcome and eventually eliminate the existing heavy fossil fuels in the transport sector, there is a need for new renewable fuels. This transition could lead to large capital costs for implementing the new solutions and a long time frame for establishing the new infrastructure unless a suitable...... infrastructure is present. The system integration of synthetic fuels will therefore depend on the existing infrastructure and the possibility of continuing its exploitation to minimize the costs and maximize the use of the current infrastructure in place. The production process includes different steps...... and production plants, so it is important to implement it in the best manner possible to ensure an efficient and flexible system. The poster will provide an overview of the steps involved in the production of synthetic fuel and possible solutions for the system architecture based on the current literature...

  17. SOIL CONTAMINATION BY NITROGEN COMPOUNDS DURING ORGANIC FUEL COMBUSTION

    Directory of Open Access Journals (Sweden)

    V. P. Bubnov

    2010-01-01

    Full Text Available The paper considers a transition mechanism of flue gas nitrogen oxides being formed due to organic fuel combustion from atmosphere into soil. Mechanisms of nitrogen compound origination and transformation in atmosphere and their transition into soil have been presented in the paper. The paper recommends a generalized equation for mathematical description of nitrogen migration into soil. 

  18. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  19. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  20. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  1. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  2. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  3. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  4. Aging, Counterfeiting Configuration Control (AC3)

    Science.gov (United States)

    2010-01-31

    relabeled fake microcircuit chips from overseas - threaten the reliability, safety, and performance of DoD systems. These systems are vulnerable... NASA , Raytheon internal, etc. Aging, Counterfeiting Configuration Control (AC3) Page 13 of 28 are important in determining the alert’s priority

  5. Alternative Fuels (Briefing Charts)

    Science.gov (United States)

    2009-06-19

    SASOL Jet Fuel Qatar GTL Syntroleum Jet fuel in B-52 Nigeria GTL China Coal GTL Shell Bintulu GTL Cellulose ethanol for ground use Ocean Bio...Bintulu GTL Ocean Bio-fuel Factories Bio-butanol for ground use Future Energy Source Resurgence in Nuclear Power Bio-jet tests done ASTM Spec...High energy deoxygenated bio-jet fuel from algae PSU coal derived JP-8 B-52 emissions Scoping study HBR TF emissions New bio- fuel impacts Adv

  6. Engineered glass seals for solid-oxide fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Surdoval, Wayne; Lara-Curzio, Edgar; Stevenson, Jeffry; Muth, Joseph Thomas; Armstrong, Beth L.; Shyam, Amit; Trejo, Rosa M.; Wang, Yanli; Chou, Yeong Shyung; Shultz, Travis Ray

    2017-02-07

    A seal for a solid oxide fuel cell includes a glass matrix having glass percolation therethrough and having a glass transition temperature below 650.degree. C. A deformable second phase material is dispersed in the glass matrix. The second phase material can be a compliant material. The second phase material can be a crushable material. A solid oxide fuel cell, a precursor for forming a seal for a solid oxide fuel cell, and a method of making a seal for a solid oxide fuel cell are also disclosed.

  7. A Comparison of Materials Issues for Cermet and Graphite-Based NTP Fuels

    Science.gov (United States)

    Stewart, Mark E.; Schnitzler, Bruce G.

    2013-01-01

    This paper compares material issues for cermet and graphite fuel elements. In particular, two issues in NTP fuel element performance are considered here: ductile to brittle transition in relation to crack propagation, and orificing individual coolant channels in fuel elements. Their relevance to fuel element performance is supported by considering material properties, experimental data, and results from multidisciplinary fluid/thermal/structural simulations. Ductile to brittle transition results in a fuel element region prone to brittle fracture under stress, while outside this region, stresses lead to deformation and resilience under stress. Poor coolant distribution between fuel element channels can increase stresses in certain channels. NERVA fuel element experimental results are consistent with this interpretation. An understanding of these mechanisms will help interpret fuel element testing results.

  8. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  9. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  10. Automatic Control Systems (ACS for Generation and Sale of Electric Power Under Conditions of Industry-Sector Liberalization

    Directory of Open Access Journals (Sweden)

    Yu. Petrusha

    2013-01-01

    Full Text Available Possible risks pertaining to transition of electric-power industry to market relations have been considered in the paper. The paper presents an integrated ACS for generation and sale of electric power as an improvement of methodology for organizational and technical management. The given system is based on integration of operating Automatic Dispatch Control System (ADCS and developing Automatic Electricity Meter Reading System (AEMRS. The paper proposes to form an inter-branch sector of ACS PLC (Automatic Control System for Prolongation of Life Cycle users which is oriented on provision of development strategy.

  11. AC Zeeman Effect of Atom%原子的交流塞曼效应

    Institute of Scientific and Technical Information of China (English)

    邢爱堂

    1999-01-01

    The formula of level shifts in AC Zeeman effect is derived on the base of a simple semiclassical method. The theoretical predictions of this formula are qualitatively in good agreement with the phenomena observed in AC Zeeman experiment. Furthermore,two important properties of AC Zeeman effect are predicted in theory:the level shifts in AC Zeeman effect of atom are the transient courses concurring with transition;the level shifts have saturation property.%用一种简单的半经典方法推导出了交流塞曼效应中的能级移动公式.从这一公式得到的结果与实验中观察到的现象是一致的,而且从理论上预言了交流塞曼效应的2个重要性质:原子交流塞曼效应中的能级移动是与跃迁同时发生的瞬态过程;能级移动具有饱和性.

  12. A novel wireless power and data transmission AC to DC converter for an implantable device.

    Science.gov (United States)

    Liu, Jhao-Yan; Tang, Kea-Tiong

    2013-01-01

    This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz.

  13. AC Conductivity and Dielectric Relaxation Behavior of Sb2S3 Bulk Material

    Science.gov (United States)

    Abd El-Rahman, K. F.; Darwish, A. A. A.; Qashou, Saleem I.; Hanafy, T. A.

    2016-07-01

    The Sb2S3 bulk material was used for next-generation anode for lithium-ion batteries. Alternative current (AC) conductivity, dielectric properties and electric modulus of Sb2S3 have been investigated. The measurements were carried out in the frequency range from 40 Hz to 5 MHz and temperature range from 293 K to 453 K. The direct current (DC) conductivity, σ DC, shows an activated behavior and the calculated activation energy is 0.50 eV. The AC conductivity, σ AC, was found to increase with the increase of temperature and frequency. The conduction mechanism of σ AC was controlled by the correlated barrier hopping model. The behavior of the dielectric constant, ɛ', and dielectric loss index, ɛ'', reveal that the polarization process of Sb2S3 is dipolar in nature. The behavior of both ɛ' and ɛ'' reveals that bulk Sb2S3 has no ferroelectric or piezoelectric phase transition. The dielectric modulus, M, gives a simple method for evaluating the activation energy of the dielectric relaxation. The calculated activation energy from M is 0.045 eV.

  14. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  15. Dicty_cDB: FCL-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC21 (Link to dictyBase) - - - Contig-U15479-1 FCL-AC21E ...(Link to Original site) - - - - - - FCL-AC21E 632 Show FCL-AC21 Library FCL (Link to library) Clone ID FCL-AC2... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC21Q.Seq.d/ Representative seq. ID FCL-AC2...1E (Link to Original site) Representative DNA sequence >FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC2...M/SL/SLG7-D/SLG773Q.Seq.d/ 1205 0.0 FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC21

  16. Tessellations & Transitions.

    Science.gov (United States)

    Cassidy, Joan

    1998-01-01

    Describes two sixth-grade lessons on the work of M. C. Escher: (1) the first lesson instructs students on tessellations, or tiles that interlock in a repeated pattern; (2) the second lesson explores Escher's drawings of transitions from two- to three-dimensional space. (DSK)

  17. AC impedance spectroscopy on copper phthalocyanine thin films

    Science.gov (United States)

    Robinson, Kyle P.

    Impedance spectroscopy is used to study copper phthalocyanine thin films in order to disentangle the contributions of the crystal and the unavoidable grain boundaries. The spectroscopy data is fit with an equivalent circuit model to determine resistance, capacitance, and activation energy for different grain morphologies. The copper phthalocyanine thin films are deposited via thermal evaporation on platinum interdigitated electrodes on glass substrates at different temperatures from 300 to 530 K with constant thickness of 22 nm. AC measurements, implementing a precision LCR meter are taken from 20Hz - 2 MHz, and at measurement temperatures from 25 - 90 °C. Stabilizing current by subjecting samples to 5 days in the dark, the impedance spectrum can be represented by Cole-Cole plots, which show either one or two peaks. The two maxima may be attributed to the crystalline bulk and grain boundaries of the film. We observe that the grain boundary resistance component changes by three orders of magnitude when varying the grain morphology, and the capacitance changes by one order of magnitude. The resistance of the grain boundary shows a minimum near the phase transition temperature of 450 K, followed by an increase in resistance for samples deposited at higher temperatures. The capacitance on the other hand, shows a maximum near the phase transition temperature. Similarly, the activation energy for the grain boundary peaks at 1.29 +/- 0.12 eV at the same phase-transition tempemture, whereas the crystalline bulk component has a constant activation energy of 0.36 +/- 0.08 eV for all sample of different grain sizes. Additional data taken using a perpendicular configuration for a 30 nm thick cobalt phthalocyanine thin film shows a double peak. The low temperature measurements for these samples are interpreted to have two contributions from micro-shorts and crystalline bulk.

  18. HTGR Fuel performance basis

    Energy Technology Data Exchange (ETDEWEB)

    Shamasundar, B.I.; Stansfield, O.M.; Jensen, D.D.

    1982-05-01

    The safety characteristics of the high-temperature gas-cooled reactor (HTGR) during normal and accident conditions are determined in part by HTGR fuel performance. During normal operation, less than 0.1% fuel failure occurs, primarily from defective particles. This low fuel failure fraction limits circulating activity to acceptable levels. During severe accidents, the radiological consequence is influenced by high-temperature fuel particle behavior. An empirical fuel failure model, supported by recent experimental data, is presented. The onset of significant fuel particle failure occurs at temperatures in excess of 1600/sup 0/C, and complete fuel failure occurs at 2660/sup 0/C. This indicates that the fuel is more retentive at higher temperatures than previously assumed. The more retentive nature of the fuel coupled with the high thermal capacitance of the core results in slow release of fission products from the core during severe accidents.

  19. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  20. Surface area considerations for corroding N reactor fuel

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, A.B. Jr.; Pitner, A.L.

    1996-06-01

    The N Reactor fuel is corroding at sites where the Zircaloy cladding was damaged when the fuel was discharged from the reactor. Corroding areas are clearly visible on the fuel stored in open cans in the K East Basin. There is a need to estimate the area of the corroding uranium to analyze aspects of fuel behavior as it is transitioned. from current wet storage to dry storage. In this report, the factors that contribute to {open_quotes}true{close_quotes} surface area are analyzed in terms of what is currently known about the N Reactor fuel. Using observations from a visual examinations of the fuel in the K East wet storage facility, a value for the corroding geometric area is estimated. Based on observations of corroding uranium and surface roughness values for other metals, a surface roughness factor is also estimated and applied to the corroding K East fuel to provide an estimated {open_quotes}true{close_quotes} surface area. While the estimated area may be modified as additional data become available from fuel characterization studies, the estimate provides a basis to assess effects of exposed uranium metal surfaces on fuel behavior in operations involved in transitioning from wet to dry storage, during shipment and staging, conditioning, and dry interim storage.

  1. Utilization of spent PWR fuel-advanced nuclear fuel cycle of PWR/CANDU synergism

    Institute of Scientific and Technical Information of China (English)

    HUO Xiao-Dong; XIE Zhong-Sheng

    2004-01-01

    High neutron economy, on line refueling and channel design result in the unsurpassed fuel cycle flexibility and variety for CANDU reactors. According to the Chinese national conditions that China has both PWR and CANDU reactors and the closed cycle policy of reprocessing the spent PWR fuel is adopted, one of the advanced nuclear fuel cycles of PWR/CANDU synergism using the reprocessed uranium of spent PWR fuel in CANDU reactor is proposed, which will save the uranium resource (~22.5%), increase the energy output (~41%), decrease the quantity of spent fuels to be disposed (~2/3) and lower the cost of nuclear power. Because of the inherent flexibility of nuclear fuel cycle in CANDU reactor, and the low radiation level of recycled uranium(RU), which is acceptable for CANDU reactor fuel fabrication, the transition from the natural uranium to the RU can be completed without major modification of the reactor core structure and operation mode. It can be implemented in Qinshan Phase Ⅲ CANDU reactors with little or no requirement of big investment in new design. It can be expected that the reuse of recycled uranium of spent PWR fuel in CANDU reactor is a feasible and desirable strategy in China.

  2. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  3. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  4. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  5. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  6. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  7. [Electricity generation by the microbial fuel cells using carbon nanotube as the anode].

    Science.gov (United States)

    Liang, Peng; Fan, Ming-zhi; Cao, Xiao-xin; Huang, Xia; Peng, Yin-ming; Wang, Shuo; Gong, Qian-ming; Liang, Ji

    2008-08-01

    The characteristic of anode plays an important role in the performance of the microbial fuel cell (MFC). Thus, carbon nanotube (CN), flexible graphite (FG) and activated carbon (AC) were used as anode material in this study, and the performances of three MFCs (CN-MFC, FG-MFC and AC-MFC) were studied. The results show that CN is a kind of suitable material to be used as anode in the MFC. The maximal power densities of CN-MFC, FG-MFC and AC-MFC are 402,354 and 274 mW/m2, respectively. The CN-MFC shows a higher power density and coulombic efficiency compared with FG-MFC and AC-MFC. The CN-anode can reduce the internal resistance obviously. The internal resistances of CN-MFC, AC-MFC and FG-MFC are 263, 301 and 381 omega, respectively. The protein contents on the CN-anode, AC-anode and FG-anode are 149, 132 and 92 microg/cm2 after stable operation, and there is a positive relation between the protein content and internal resistance. The conductivity of the three types of MFCs from high to low was FG-MFC, CN-MFC and AC-MFC, which was accordant with the ohmic resistance. The stable times of CN-MFC, FG-MFC and AC-MFC, which were needed to measure the internal resistances, were 1800, 1200 and 300 s respectively.

  8. Technological Change During the Energy Transition

    NARCIS (Netherlands)

    van der Meijden, G.C.; Smulders, Sjak A.

    2014-01-01

    The energy transition from fossil fuels to alternative energy sources has important consequences for technological change and resource extraction. We examine these consequences by incorporating a non-renewable resource and an alternative energy source in a market economy model of endogenous growth t

  9. Materials for fuel cells

    Directory of Open Access Journals (Sweden)

    Sossina M Haile

    2003-03-01

    Full Text Available Because of their potential to reduce the environmental impact and geopolitical consequences of the use of fossil fuels, fuel cells have emerged as tantalizing alternatives to combustion engines. Like a combustion engine, a fuel cell uses some sort of chemical fuel as its energy source but, like a battery, the chemical energy is directly converted to electrical energy, without an often messy and relatively inefficient combustion step. In addition to high efficiency and low emissions, fuel cells are attractive for their modular and distributed nature, and zero noise pollution. They will also play an essential role in any future hydrogen fuel economy.

  10. Enhanced Activated Carbon Cathode Performance for Microbial Fuel Cell by Blending Carbon Black

    KAUST Repository

    Zhang, Xiaoyuan

    2014-02-04

    Activated carbon (AC) is a useful and environmentally sustainable catalyst for oxygen reduction in air-cathode microbial fuel cells (MFCs), but there is great interest in improving its performance and longevity. To enhance the performance of AC cathodes, carbon black (CB) was added into AC at CB:AC ratios of 0, 2, 5, 10, and 15 wt % to increase electrical conductivity and facilitate electron transfer. AC cathodes were then evaluated in both MFCs and electrochemical cells and compared to reactors with cathodes made with Pt. Maximum power densities of MFCs were increased by 9-16% with CB compared to the plain AC in the first week. The optimal CB:AC ratio was 10% based on both MFC polarization tests and three electrode electrochemical tests. The maximum power density of the 10% CB cathode was initially 1560 ± 40 mW/m2 and decreased by only 7% after 5 months of operation compared to a 61% decrease for the control (Pt catalyst, 570 ± 30 mW/m2 after 5 months). The catalytic activities of Pt and AC (plain or with 10% CB) were further examined in rotating disk electrode (RDE) tests that minimized mass transfer limitations. The RDE tests showed that the limiting current of the AC with 10% CB was improved by up to 21% primarily due to a decrease in charge transfer resistance (25%). These results show that blending CB in AC is a simple and effective strategy to enhance AC cathode performance in MFCs and that further improvement in performance could be obtained by reducing mass transfer limitations. © 2014 American Chemical Society.

  11. Transfer of Plutonium-Uranium Extraction Plant and N Reactor irradiated fuel for storage at the 105-KE and 105-KW fuel storage basins, Hanford Site, Richland Washington

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-07-01

    The U.S. Department of Energy (DOE) needs to remove irradiated fuel from the Plutonium-Uranium Extraction (PUREX) Plant and N Reactor at the Hanford Site, Richland, Washington, to stabilize the facilities in preparation for decontamination and decommissioning (D&D) and to reduce the cost of maintaining the facilities prior to D&D. DOE is proposing to transfer approximately 3.9 metric tons (4.3 short tons) of unprocessed irradiated fuel, by rail, from the PUREX Plant in the 200 East Area and the 105 N Reactor (N Reactor) fuel storage basin in the 100 N Area, to the 105-KE and 105-KW fuel storage basins (K Basins) in the 100 K Area. The fuel would be placed in storage at the K Basins, along with fuel presently stored, and would be dispositioned in the same manner as the other existing irradiated fuel inventory stored in the K Basins. The fuel transfer to the K Basins would consolidate storage of fuels irradiated at N Reactor and the Single Pass Reactors. Approximately 2.9 metric tons (3.2 short tons) of single-pass production reactor, aluminum clad (AC) irradiated fuel in four fuel baskets have been placed into four overpack buckets and stored in the PUREX Plant canyon storage basin to await shipment. In addition, about 0.5 metric tons (0.6 short tons) of zircaloy clad (ZC) and a few AC irradiated fuel elements have been recovered from the PUREX dissolver cell floors, placed in wet fuel canisters, and stored on the canyon deck. A small quantity of ZC fuel, in the form of fuel fragments and chips, is suspected to be in the sludge at the bottom of N Reactor`s fuel storage basin. As part of the required stabilization activities at N Reactor, this sludge would be removed from the basin and any identifiable pieces of fuel elements would be recovered, placed in open canisters, and stored in lead lined casks in the storage basin to await shipment. A maximum of 0.5 metric tons (0.6 short tons) of fuel pieces is expected to be recovered.

  12. A nuclear reactor core fuel reload optimization using artificial ant colony connective networks

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Alan M.M. de [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: alanmmlima@yahoo.com.br; Schirru, Roberto [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: schirru@lmp.ufrj.br; Carvalho da Silva, Fernando [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: fernando@con.ufrj.br; Medeiros, Jose Antonio Carlos Canedo [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: canedo@lmp.ufrj.br

    2008-09-15

    The core of a nuclear Pressurized Water Reactor (PWR) may be reloaded every time the fuel burn-up is such that it is not more possible to maintain the reactor operating at nominal power. The nuclear core fuel reload optimization problem consists in finding a pattern of burned-up and fresh-fuel assemblies that maximize the number of full operational days. This is an NP-Hard problem, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Moreover, the problem is non-linear and its search space is highly discontinuous and multi-modal. Ant Colony System (ACS) is an optimization algorithm based on artificial ants that uses the reinforcement learning technique. The ACS was originally developed to solve the Traveling Salesman Problem (TSP), which is conceptually similar to the nuclear core fuel reload problem. In this work a parallel computational system based on the ACS, called Artificial Ant Colony Networks is introduced to solve the core fuel reload optimization problem.

  13. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  14. Transition Operators

    CERN Document Server

    Alcock-Zeilinger, Judith

    2016-01-01

    In this paper, we give a generic algorithm of the transition operators between Hermitian Young projection operators corresponding to equivalent irreducible representations of SU(N), using the compact expressions of Hermitian Young projection operators derived in a companion paper. We show that the Hermitian Young projection operators together with their transition operators constitute a fully orthogonal basis for the algebra of invariants of $V^{\\otimes m}$ that exhibits a systematically simplified multiplication table. We discuss the full algebra of invariants over $V^{\\otimes 3}$ and $V^{\\otimes 4}$ as explicit examples. In our presentation we make use of various standard concepts such as Young projection operators, Clebsch-Gordan operators, and invariants (in birdtrack notation). We tie these perspectives together and use them to shed light on each other.

  15. DUPIC fuel compatibility assessment

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hang Bok; Rho, G. H.; Park, J. W. [and others

    2000-03-01

    The purpose of this study is to assess the compatibility of DUPIC(Direct Use of Spent PWR Fuel in CANDU Reactors) fuel with the current CANDU 6 reactor, which is one of the technology being developed to utilize the spent PWR fuel in CANDU reactors. The phase 1 study of this project includes the feasibility analysis on applicability of the current core design method, the feasibility analysis on operation of the DUPIC fuel core, the compatibility analysis on individual reactor system, the sensitivity analysis on the fuel composition, and the economic analysis on DUPIC fuel cycle. The results of the validation calculations have confirmed that the current core analysis system is acceptable for the feasibility study of the DUPIC fuel compatibility analysis. The results of core simulations have shown that both natural uranium and DUPIC fuel cores are almost the same from the viewpoint of the operational performance. For individual reactor system including reactively devices, the functional requirements of each system are satisfied in general. However, because of the pronounced power flattening in the DUPIC core, the radiation damage on the critical components increases, which should be investigated more in the future. The DUPIC fuel composition heterogeneity dose not to impose any serious effect on the reactor operation if the fuel composition is adjusted. The economics analysis has been performed through conceptual design studies on the DUPIC fuel fabrication, fuel handling in a plant, and spent fuel disposal, which has shown that the DUPIC fuel cycle is comparable to the once-trough fuel cycle considering uncertainties associated with unit costs of the fuel cycle components. The results of Phase 1 study have shown that it is feasible to use the DUPIC fuel in CANDU reactors without major changes in hardware. However further studies are required to confirm the safety of the reactor under accident condition.

  16. Lazy AC-Pattern Matching for Rewriting

    OpenAIRE

    Walid Belkhir; Alain Giorgetti

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  17. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  18. Lazy AC-Pattern Matching for Rewriting

    Directory of Open Access Journals (Sweden)

    Walid Belkhir

    2012-04-01

    Full Text Available We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  19. The Hubble Legacy Archive ACS Grism Data

    CERN Document Server

    Kuemmel, M; Fosbury, R; Haase, J; Hook, R N; Kuntschner, H; Lombardi, M; Micol, A; Nilsson, K K; Stoehr, F; Walsh, J R

    2011-01-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 \\mu$m, with a dispersion of $40 \\ \\AA / pixel$ and a resolution of $\\sim 80\\ \\AA$ for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47,919 datasets (65% of the total number of extracted spect...

  20. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  1. The Elum Project: A Network of UK Sites to Understand Land-Use Transitions to Bioenergy and Their Implications for Greenhouse Gas Balance and Carbon Cycling

    Science.gov (United States)

    Harris, Z. M.; Alberti, G.; Bottoms, E.; Rowe, R.; Parmar, K.; Marshall, R.; Elias, D.; Smith, P.; Dondini, M.; Pogson, M.; Richards, M.; Finch, J.; Ineson, P.; Keane, B.; Perks, M.; Wilkinson, M.; Yamulki, S.; Donnison, I.; Farrar, K.; Massey, A.; McCalmont, J.; Drewer, J.; Sohi, S.; McNamara, N.; Taylor, G.

    2014-12-01

    Rising anthropogenic greenhouse gas (GHG) emissions coupled with an increasing need to address energy security are resulting in the development of cleaner, more sustainable alternatives to traditional fossil fuel sources. Bioenergy crops have been proposed to be able to mitigate the effects of climate change as well as provide increased energy security. The aim of this project is to assess the impact of land conversion to second generation non-food bioenergy crops on GHG balance for several land use transitions, including from arable, grassland and forest. A network of 6 sites was established across the UK to assess the processes underpinning GHG balance and to provide input data to a model being used to assess the sustainability of different land use transitions. Monthly analysis of soil GHGs shows that carbon dioxide contributes most to the global warming potential of these bioenergy crops, irrespective of transition. Nitrous oxide emissions were low for all crops except arable cropping and methane emissions were very low for all sites. Nearly all sites have shown a significant decrease in CO2 flux from the control land use. Eddy flux approaches, coupled with soil assessments show that for the transition from grassland to SRC willow there is a significant reduction in GHG emissions from soil and a negative net ecosystem exchange due to increased GPP and ecosystem respiration. These results suggest for this land use transition to bioenergy in a UK specific context, there may be a net benefit for ecosystem GHG exchange of transition to bioenergy Finally we are developing a meta-modelling tool to allow land use managers to make location-specific, informed decisions about land use change to bioenergy. This work is based on the Ecosystem Land Use Modelling & Soil Carbon GHG Flux Trial (ELUM) project, which was commissioned and funded by the Energy Technologies Institute (ETI). This project is co-ordinated by the Centre for Ecology & Hydrology (www.elum.ac.uk).

  2. FUEL CELL ELECTRODE MATERIALS

    Science.gov (United States)

    FUEL CELL ELECTRODE MATERIALS. RAW MATERIAL SELECTION INFLUENCES POLARIZATION BUT IS NOT A SINGLE CONTROLLING FACTOR. AVAILABLE...DATA INDICATES THAT AN INTERRELATIONSHIP OF POROSITY, AVERAGE PORE VOLUME, AND PERMEABILITY CONTRIBUTES TO ELECTRODE FUEL CELL BEHAVIOR.

  3. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  4. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  5. Navy Fuel Specification Standardization

    Science.gov (United States)

    1992-04-01

    surfaced periodically to convert further to a single-fuel operation, i.e., one fuel for both aircraft and ship propulsion /power systems. This study...lead to the development of a single distillate fuel for ship propulsion , resulting eventually in the MIL-F-16884 Naval Distillate Fuel (NDF) used today...for both aircraft and ship propulsion /power systems. This report summarizes a study to consider this problem in light of current systems and

  6. Direct hydrocarbon fuel cells

    Science.gov (United States)

    Barnett, Scott A.; Lai, Tammy; Liu, Jiang

    2010-05-04

    The direct electrochemical oxidation of hydrocarbons in solid oxide fuel cells, to generate greater power densities at lower temperatures without carbon deposition. The performance obtained is comparable to that of fuel cells used for hydrogen, and is achieved by using novel anode composites at low operating temperatures. Such solid oxide fuel cells, regardless of fuel source or operation, can be configured advantageously using the structural geometries of this invention.

  7. Alternative Fuels Data Center

    Energy Technology Data Exchange (ETDEWEB)

    None

    2013-06-01

    Fact sheet describes the Alternative Fuels Data Center, which provides information, data, and tools to help fleets and other transportation decision makers find ways to reduce petroleum consumption through the use of alternative and renewable fuels, advanced vehicles, and other fuel-saving measures.

  8. Modeling: driving fuel cells

    Directory of Open Access Journals (Sweden)

    Michael Francis

    2002-05-01

    Fuel cells were invented in 1839 by Sir William Grove, a Welsh judge and gentleman scientist, as a result of his experiments on the electrolysis of water. To put it simply, fuel cells are electrochemical devices that take hydrogen gas from fuel, combine it with oxygen from the air, and generate electricity and heat, with water as the only by-product.

  9. Effects of Air Conditioner Use on Real-World Fuel Economy

    Energy Technology Data Exchange (ETDEWEB)

    Huff, Shean P [ORNL; West, Brian H [ORNL; Thomas, John F [ORNL

    2013-01-01

    Vehicle data were acquired on-road and on a chassis dynamometer to assess fuel consumption under several steady cruise conditions and at idle. Data were gathered for various air conditioner (A/C) settings and with the A/C off and the windows open. Two vehicles were used in the comparisonstudy: a 2009 Ford Explorer and a 2009 Toyota Corolla. At steady speeds between 64.4 and 112.7 kph (40 and 70 mph), both vehicles consumed more fuel with the A/C on at maximum cooling load (compressor at 100% duty cycle) than when driving with the windows down. The Explorer maintained this trend beyond 112.7 kph (70 mph), while the Corolla fuel consumption with the windows down matched that of running the A/C at 120.7 kph (75 mph), and exceeded it at 128.7 kph (80 mph). The largest incremental fuel consumption rate penalty due to air conditioner use occurred was nearly constant with a weakslight trend of increasing consumption with increasing compressor (and vehicle) speed. Lower consumption is seenobserved at idle for both vehicles, likely due to the low compressor speed at this operating point

  10. To Evaluate Zero Emission Propulsion and Support Technology for Transit Buses

    Energy Technology Data Exchange (ETDEWEB)

    Kevin Chandler; Leslie Eudy

    2006-11-01

    This report provides evaluation results for prototype fuel cell transit buses operating at Santa Clara Valley Transportation Authority (VTA) in San Jose, California, in partnership with the San Mateo County Transit District in San Carlos, California. VTA has been operating three fuel cell transit buses in extra revenue service since February 28, 2005. This report provides descriptions of the equipment used, early experiences, and evaluation results from the operation of the buses and the supporting hydrogen infrastructure from March 2005 through July 2006.

  11. Transit space

    DEFF Research Database (Denmark)

    Raahauge, Kirsten Marie

    2008-01-01

    This article deals with representations of one specific city, Århus, Denmark, especially its central district. The analysis is based on anthropological fieldwork conducted in Skåde Bakker and Fedet, two well-off neighborhoods. The overall purpose of the project is to study perceptions of space...... and the interaction of cultural, social, and spatial organizations, as seen from the point of view of people living in Skåde Bakker and Fedet. The focus is on the city dwellers’ representations of the central district of Århus with specific reference to the concept of transit space. When applied to various Århusian...

  12. Conformational Transitions

    Science.gov (United States)

    Czerminski, Ryszard; Roitberg, Adrian; Choi, Chyung; Ulitsky, Alexander; Elber, Ron

    1991-10-01

    Two computational approaches to study plausible conformations of biological molecules and the transitions between them are presented and discussed. The first approach is a new search algorithm which enhances the sampling of alternative conformers using a mean field approximation. It is argued and demonstrated that the mean field approximation has a small effect on the location of the minima. The method is a combination of the LES protocol (Locally Enhanced Sampling) and simulated annealing. The LES method was used in the past to study the diffusion pathways of ligands from buried active sites in myoglobin and leghemoglobin to the exterior of the protein. The present formulation of LES and its implementation in a Molecular Dynamics program is described. An application for side chain placement in a tetrapeptide is presented. The computational effort associated with conformational searches using LES grows only linearly with the number of degrees of freedom, whereas in the exact case the computational effort grows exponentially. Such saving is of course associated with a mean field approximation. The second branch of studies pertains to the calculation of reaction paths in large and flexible biological systems. An extensive mapping of minima and barriers for two different tetrapeptides is calculated from the known minima and barriers of alanine tetrapeptide which we calculated recently.1 The tetrapeptides are useful models for the formation of secondary structure elements since they are the shortest possible polymers of this type which can still form a complete helical turn. The tetrapeptides are isobutyryl-val(χ1=60)-ala-ala and isobutyryl-val(χ1=-60)-ala-ala. Properties of the hundreds of minima and of the hundreds intervening barriers are discussed. Estimates for thermal transition times between the many conformers (and times to explore the complete phase space) are calculated and compared. It is suggested that the most significant effect of the side chain size is

  13. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  14. Alternative aviation turbine fuels

    Science.gov (United States)

    Grobman, J.

    1977-01-01

    The efficient utilization of fossil fuels by future jet aircraft may necessitate the broadening of current aviation turbine fuel specifications. The most significant changes in specifications would be an increased aromatics content and a higher final boiling point in order to minimize refinery energy consumption and costs. These changes would increase the freezing point and might lower the thermal stability of the fuel and could cause increased pollutant emissions, increased smoke and carbon formation, increased combustor liner temperatures, and poorer ignition characteristics. This paper discusses the effects that broadened specification fuels may have on present-day jet aircraft and engine components and the technology required to use fuels with broadened specifications.

  15. Texas Hydrogen Highway Fuel Cell Hybrid Bus and Fueling Infrastructure Technology Showcase - Final Scientific/Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Hitchcock, David

    2012-06-29

    The Texas Hydrogen Highway project has showcased a hydrogen fuel cell transit bus and hydrogen fueling infrastructure that was designed and built through previous support from various public and private sector entities. The aim of this project has been to increase awareness among transit agencies and other public entities on these transportation technologies, and to place such technologies into commercial applications, such as a public transit agency. The initial project concept developed in 2004 was to show that a skid-mounted, fully-integrated, factory-built and tested hydrogen fueling station could be used to simplify the design, and lower the cost of fueling infrastructure for fuel cell vehicles. The approach was to design, engineer, build, and test the integrated fueling station at the factory then install it at a site that offered educational and technical resources and provide an opportunity to showcase both the fueling station and advanced hydrogen vehicles. The two primary technology components include: Hydrogen Fueling Station: The hydrogen fueling infrastructure was designed and built by Gas Technology Institute primarily through a funding grant from the Texas Commission on Environmental Quality. It includes hydrogen production, clean-up, compression, storage, and dispensing. The station consists of a steam methane reformer, gas clean-up system, gas compressor and 48 kilograms of hydrogen storage capacity for dispensing at 5000 psig. The station is skid-mounted for easy installation and can be relocated if needed. It includes a dispenser that is designed to provide temperaturecompensated fills using a control algorithm. The total station daily capacity is approximately 50 kilograms. Fuel Cell Bus: The transit passenger bus built by Ebus, a company located in Downey, CA, was commissioned and acquired by GTI prior to this project. It is a fuel cell plug-in hybrid electric vehicle which is ADA compliant, has air conditioning sufficient for Texas operations

  16. Fuel cells : a viable fossil fuel alternative

    Energy Technology Data Exchange (ETDEWEB)

    Paduada, M.

    2007-02-15

    This article presented a program initiated by Natural Resources Canada (NRCan) to develop proof-of-concept of underground mining vehicles powered by fuel cells in order to eliminate emissions. Recent studies on American and Canadian underground mines provided the basis for estimating the operational cost savings of switching from diesel to fuel cells. For the Canadian mines evaluated, the estimated ventilation system operating cost reductions ranged from 29 per cent to 75 per cent. In order to demonstrate the viability of a fuel cell-powered vehicle, NRCan has designed a modified Caterpillar R1300 loader with a 160 kW hybrid power plant in which 3 stacks of fuel cells deliver up to 90 kW continuously, and a nickel-metal hydride battery provides up to 70 kW. The battery subsystem transiently boosts output to meet peak power requirements and also accommodates regenerative braking. Traction for the loader is provided by a brushless permanent magnet traction motor. The hydraulic pump motor is capable of a 55 kW load continuously. The loader's hydraulic and traction systems are operated independently. Future fuel cell-powered vehicles designed by the program may include a locomotive and a utility vehicle. Future mines running their operations with hydrogen-fueled equipment may also gain advantages by employing fuel cells in the operation of handheld equipment such as radios, flashlights, and headlamps. However, the proton exchange membrane (PEM) fuel cells used in the project are prohibitively expensive. The catalytic content of a fuel cell can add hundreds of dollars per kW of electric output. Production of catalytic precious metals will be strongly connected to the scale of use and acceptance of fuel cells in vehicles. In addition, the efficiency of hydrogen production and delivery is significantly lower than the well-to-tank efficiency of many conventional fuels. It was concluded that an adequate hydrogen infrastructure will be required for the mining industry

  17. AC Electric Field Activated Shape Memory Polymer Composite

    Science.gov (United States)

    Kang, Jin Ho; Siochi, Emilie J.; Penner, Ronald K.; Turner, Travis L.

    2011-01-01

    Shape memory materials have drawn interest for applications like intelligent medical devices, deployable space structures and morphing structures. Compared to other shape memory materials like shape memory alloys (SMAs) or shape memory ceramics (SMCs), shape memory polymers (SMPs) have high elastic deformation that is amenable to tailored of mechanical properties, have lower density, and are easily processed. However, SMPs have low recovery stress and long response times. A new shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive fillers to enhance its thermo-mechanical characteristics. A new composition of shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive functionalized graphene sheets (FGS) to enhance its thermo-mechanical characteristics. The elastic modulus of LaRC-SMPC is approximately 2.7 GPa at room temperature and 4.3 MPa above its glass transition temperature. Conductive FGSs-doped LaRC-SMPC exhibited higher conductivity compared to pristine LaRC SMP. Applying an electric field at between 0.1 Hz and 1 kHz induced faster heating to activate the LaRC-SMPC s shape memory effect relative to applying DC electric field or AC electric field at frequencies exceeding1 kHz.

  18. A viable electrode material for use in microbial fuel cells for tropical regions

    DEFF Research Database (Denmark)

    Offei, Felix; Thygesen, Anders; Mensah, Moses;

    2016-01-01

    Electrode materials are critical for microbial fuel cells (MFC) since they influence the construction and operational costs. This study introduces a simple and efficient electrode material in the form of palm kernel shell activated carbon (AC) obtained in tropical regions. The novel introduction...... of this material is also targeted at introducing an inexpensive and durable electrode material, which can be produced in rural communities to improve the viability of MFCs. The maximum voltage and power density obtained (under 1000 Ω load) using an H-shaped MFC with AC as both anode and cathode electrode material...... was 0.66 V and 1.74 W/m3, respectively. The power generated by AC was as high as 86% of the value obtained with the extensively used carbon paper. Scanning electron microscopy and Denaturing Gradient Gel Electrophoresis (DGGE) analysis of AC anode biofilms confirmed that electrogenic bacteria were...

  19. Power generation using an activated carbon and metal mesh cathode in a microbial fuel cell

    KAUST Repository

    Zhang, Fang

    2009-11-01

    An inexpensive activated carbon (AC) air cathode was developed as an alternative to a platinum-catalyzed electrode for oxygen reduction in a microbial fuel cell (MFC). AC was cold-pressed with a polytetrafluoroethylene (PTFE) binder to form the cathode around a Ni mesh current collector. This cathode construction avoided the need for carbon cloth or a metal catalyst, and produced a cathode with high activity for oxygen reduction at typical MFC current densities. Tests with the AC cathode produced a maximum power density of 1220 mW/m2 (normalized to cathode projected surface area; 36 W/m3 based on liquid volume) compared to 1060 mW/m2 obtained by Pt catalyzed carbon cloth cathode. The Coulombic efficiency ranged from 15% to 55%. These findings show that AC is a cost-effective material for achieving useful rates of oxygen reduction in air cathode MFCs. © 2009 Elsevier B.V. All rights reserved.

  20. Reduced Toxicity Fuel Satellite Propulsion System Including Catalytic Decomposing Element with Hydrogen Peroxide

    Science.gov (United States)

    Schneider, Steven J. (Inventor)

    2002-01-01

    A reduced toxicity fuel satellite propulsion system including a reduced toxicity propellant supply for consumption in an axial class thruster and an ACS class thruster. The system includes suitable valves and conduits for supplying the reduced toxicity propellant to the ACS decomposing element of an ACS thruster. The ACS decomposing element is operative to decompose the reduced toxicity propellant into hot propulsive gases. In addition the system includes suitable valves and conduits for supplying the reduced toxicity propellant to an axial decomposing element of the axial thruster. The axial decomposing element is operative to decompose the reduced toxicity propellant into hot gases. The system further includes suitable valves and conduits for supplying a second propellant to a combustion chamber of the axial thruster, whereby the hot gases and the second propellant auto-ignite and begin the combustion process for producing thrust.

  1. Experimental needs for water cooled reactors. Reactor and nuclear fuel; Les besoins experimentaux pour les reacteurs a eau legere. Reacteur et combustible

    Energy Technology Data Exchange (ETDEWEB)

    Waeckel, N. [Electricite de France (EDF/SEPTEN), 69 - Villeurbanne (France); Beguin, S. [Electricite de France (EDF/SEPTEN), 50 - Cherbourg (France); Assedo [AREVA Framatome ANP, 92 - Paris La Defense (France)

    2005-07-01

    In order to improve the competitiveness of nuclear reactors, the trend will be to increase the fuel burn-up, the fuel enrichment, the length of the irradiation cycle and the global thermal power of the reactor. In all cases the fuel rod will be more acted upon. Experimental programs involving research reactors able to irradiate in adequate conditions instrumented fuel rods will stay necessary for the validation of new practices or new nuclear fuel materials in normal or accidental conditions. (A.C.)

  2. American Fuel Cell Bus Project Evaluation. Second Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2015-09-01

    This report presents results of the American Fuel Cell Bus (AFCB) Project, a demonstration of fuel cell electric buses operating in the Coachella Valley area of California. The prototype AFCB was developed as part of the Federal Transit Administration's (FTA's) National Fuel Cell Bus Program. Through the non-profit consortia CALSTART, a team led by SunLine Transit Agency and BAE Systems developed a new fuel cell electric bus for demonstration. SunLine added two more AFCBs to its fleet in 2014 and another in 2015. FTA and the AFCB project team are collaborating with the U.S. Department of Energy (DOE) and DOE's National Renewable Energy Laboratory to evaluate the buses in revenue service. This report summarizes the performance results for the buses through June 2015.

  3. Performance and emissions analysis on using acetone–gasoline fuel blends in spark-ignition engine

    OpenAIRE

    2016-01-01

    In this study, new blended fuels were formed by adding 3–10 vol. % of acetone into a regular gasoline. According to the best of the author's knowledge, it is the first time that the influence of acetone blends has been studied in a gasoline-fueled engine. The blended fuels were tested for their energy efficiencies and pollutant emissions using SI (spark-ignition) engine with single-cylinder and 4-stroke. Experimental results showed that the AC3 (3 vol.% acetone + 97 vol.% gasoline) blended fu...

  4. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  5. Frequency-driven quantum oscillations in a graphene layer under circularly polarized ac fields

    Energy Technology Data Exchange (ETDEWEB)

    Vega Monroy, R., E-mail: ricardovega@mail.uniatlantico.edu.co; Martinez Castro, O.; Salazar Cohen, G.

    2015-06-19

    In this paper we predict a new type of quantum oscillations driven by the frequency of a circularly polarized ac field in a monolayer of graphene placed inside an optical cavity. We show that the displacement of the structure of photon-dressed electron states near the Fermi level and the electron transitions, from extended states to bound photon-dressed electron states inside an energy gap, lead to a periodic change of singularities in the electron density of states, resulting in quantum oscillations in thermodynamic, transport and other properties in graphene.

  6. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  7. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  8. Oxy-fuel combustion of solid fuels

    DEFF Research Database (Denmark)

    Toftegaard, Maja Bøg; Brix, Jacob; Jensen, Peter Arendt

    2010-01-01

    Oxy-fuel combustion is suggested as one of the possible, promising technologies for capturing CO2 from power plants. The concept of oxy-fuel combustion is removal of nitrogen from the oxidizer to carry out the combustion process in oxygen and, in most concepts, recycled flue gas to lower the flame...... temperature. The flue gas produced thus consists primarily of carbon dioxide and water. Much research on the different aspects of an oxy-fuel power plant has been performed during the last decade. Focus has mainly been on retrofits of existing pulverized-coal-fired power plant units. Green-field plants which...... provide additional options for improvement of process economics are however likewise investigated. Of particular interest is the change of the combustion process induced by the exchange of carbon dioxide and water vapor for nitrogen as diluent. This paper reviews the published knowledge on the oxy-fuel...

  9. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    Directory of Open Access Journals (Sweden)

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  10. Fuel safety research 1999

    Energy Technology Data Exchange (ETDEWEB)

    Uetsuka, Hiroshi (ed.) [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2000-07-01

    In April 1999, the Fuel Safety Research Laboratory was newly established as a result of reorganization of the Nuclear Safety Research Center, JAERI. The laboratory was organized by combining three laboratories, the Reactivity Accident Laboratory, the Fuel Reliability Laboratory, and a part of the Sever Accident Research Laboratory. Consequently, the Fuel Safety Research Laboratory is now in charge of all the fuel safety research in JAERI. Various types of experimental and analytical researches are conducted in the laboratory by using the unique facilities such as the Nuclear Safety Research Reactor (NSRR), the Japan Material Testing Reactor (JMTR), the Japan Research Reactor 3 (JRR-3) and hot cells in JAERI. The laboratory consists of five research groups corresponding to each research fields. They are; (a) Research group of fuel behavior under the reactivity initiated accident conditions (RIA group). (b) Research group of fuel behavior under the loss-of-coolant accident conditions (LOCA group). (c) Research group of fuel behavior under the normal operation conditions (JMTR/BOCA group). (d) Research group of fuel behavior analysis (FEMAXI group). (e) Research group of FP release/transport behavior from irradiated fuel (VEGA group). This report summarizes the outline of research activities and major outcomes of the research executed in 1999 in the Fuel Safety Research Laboratory. (author)

  11. Fuel related risks; Braenslerisker

    Energy Technology Data Exchange (ETDEWEB)

    Englund, Jessica; Sernhed, Kerstin; Nystroem, Olle; Graveus, Frank (Grontmij AB, (Sweden))

    2012-02-15

    The project, within which this work report was prepared, aimed to complement the Vaermeforsk publication 'Handbook of fuels' on fuel related risks and measures to reduce the risks. The fuels examined in this project where the fuels included in the first version of the handbook from 2005 plus four additional fuels that will be included in the second and next edition of the handbook. Following fuels were included: woodfuels (sawdust, wood chips, powder, briquettes), slash, recycled wood, salix, bark, hardwood, stumps, straw, reed canary grass, hemp, cereal, cereal waste, olive waste, cocoa beans, citrus waste, shea, sludge, forest industrial sludge, manure, Paper Wood Plastic, tyre, leather waste, cardboard rejects, meat and bone meal, liquid animal and vegetable wastes, tall oil pitch, peat, residues from food industry, biomal (including slaughterhouse waste) and lignin. The report includes two main chapters; a general risk chapter and a chapter of fuel specific risks. The first one deals with the general concept of risk, it highlights laws and rules relevant for risk management and it discuss general risks that are related to the different steps of fuel handling, i.e. unloading, storing, processing the fuel, transportation within the facility, combustion and handling of ashes. The information that was used to produce this chapter was gathered through a literature review, site visits, and the project group's experience from risk management. The other main chapter deals with fuel-specific risks and the measures to reduce the risks for the steps of unloading, storing, processing the fuel, internal transportation, combustion and handling of the ashes. Risks and measures were considered for all the biofuels included in the second version in the handbook of fuels. Information about the risks and risk management was gathered through interviews with people working with different kinds of fuels in electricity and heat plants in Sweden. The information from

  12. An Institutional Approach to Understanding Energy Transitions

    Science.gov (United States)

    Koster, Auriane Magdalena

    Energy is a central concern of sustainability because how we produce and consume energy affects society, economy, and the environment. Sustainability scientists are interested in energy transitions away from fossil fuels because they are nonrenewable, increasingly expensive, have adverse health effects, and may be the main driver of climate change. They see an opportunity for developing countries to avoid the negative consequences fossil-fuel-based energy systems, and also to increase resilience, by leap-frogging-over the centralized energy grid systems that dominate the developed world. Energy transitions pose both challenges and opportunities. Obstacles to transitions include 1) an existing, centralized, complex energy-grid system, whose function is invisible to most users, 2) coordination and collective-action problems that are path dependent, and 3) difficulty in scaling up RE technologies. Because energy transitions rely on technological and social innovations, I am interested in how institutional factors can be leveraged to surmount these obstacles. The overarching question that underlies my research is: What constellation of institutional, biophysical, and social factors are essential for an energy transition? My objective is to derive a set of "design principles," that I term institutional drivers, for energy transitions analogous to Ostrom's institutional design principles. My dissertation research will analyze energy transitions using two approaches: applying the Institutional Analysis and Development Framework and a comparative case study analysis comprised of both primary and secondary sources. This dissertation includes: 1) an analysis of the world's energy portfolio; 2) a case study analysis of five countries; 3) a description of the institutional factors likely to promote a transition to renewable-energy use; and 4) an in-depth case study of Thailand's progress in replacing nonrenewable energy sources with renewable energy sources. My research will

  13. Electrothermally driven flows in ac electrowetting.

    Science.gov (United States)

    García-Sánchez, Pablo; Ramos, Antonio; Mugele, Frieder

    2010-01-01

    Mixing within sessile drops can be enhanced by generating internal flow patterns using ac electrowetting. While for low ac frequencies, the flow patterns have been attributed to oscillations of the drop surface, we provide here the driving mechanism of the hitherto unexplained high-frequency flows. We show that: (1) the electric field in the liquid bulk becomes important, leading to energy dissipation due to Joule heating and a temperature increase of several degrees Celsius, and (2) the fluid flow at these frequencies is generated by electrothermal effect, i.e., gradients in temperature give rise to gradients in conductivity and permittivity, the electric field acting on these inhomogeneities induces an electrical body force that generates the flow. We solved numerically the equations for the electric, temperature and flow fields. The temperature is obtained from a convection-diffusion equation where Joule heating is introduced as a source term. From the solution of the electric field and the temperature, we compute the electrical force that acts as a body force in Stokes equations. Our numerical results agree with previous experimental observations.

  14. Cascading failures in ac electricity grids

    Science.gov (United States)

    Rohden, Martin; Jung, Daniel; Tamrakar, Samyak; Kettemann, Stefan

    2016-09-01

    Sudden failure of a single transmission element in a power grid can induce a domino effect of cascading failures, which can lead to the isolation of a large number of consumers or even to the failure of the entire grid. Here we present results of the simulation of cascading failures in power grids, using an alternating current (AC) model. We first apply this model to a regular square grid topology. For a random placement of consumers and generators on the grid, the probability to find more than a certain number of unsupplied consumers decays as a power law and obeys a scaling law with respect to system size. Varying the transmitted power threshold above which a transmission line fails does not seem to change the power-law exponent q ≈1.6 . Furthermore, we study the influence of the placement of generators and consumers on the number of affected consumers and demonstrate that large clusters of generators and consumers are especially vulnerable to cascading failures. As a real-world topology, we consider the German high-voltage transmission grid. Applying the dynamic AC model and considering a random placement of consumers, we find that the probability to disconnect more than a certain number of consumers depends strongly on the threshold. For large thresholds the decay is clearly exponential, while for small ones the decay is slow, indicating a power-law decay.

  15. Transport AC Losses in Striated YBCO Coated Conductors (Postprint)

    Science.gov (United States)

    2012-02-01

    AFRL-RZ-WP-TP-2012-0124 TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) G.A. Levin and P.N. Barnes Mechanical Energy...TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) 5a. CONTRACT NUMBER In-house 5b. GRANT NUMBER 5c. PROGRAM ELEMENT...2006. 14. ABSTRACT DC current-voltage characteristics and transport ac losses of striated and non-striated Y1Ba2Cu3O7-δ ( YBCO ) coated conductors

  16. Direct Fuel Injector Temporal Measurements

    Science.gov (United States)

    2014-10-01

    optimize engine performance and emissions. Fuel injectors contain an actuator, pintle (or needle), and nozzle. The most common actuator is a solenoid ...Introduction Fuel injectors have a long history in metering fuel in modern engines by either port fuel injection (PFI) or direct fuel injection (DFI...Compared with a carburetor, fuel injectors have more accurate fuel delivering capability, thus giving engineers and technicians more flexibility to

  17. Enhanced Oxygen and Hydroxide Transport in a Cathode Interface by Efficient Antibacterial Property of a Silver Nanoparticle-Modified, Activated Carbon Cathode in Microbial Fuel Cells.

    Science.gov (United States)

    Li, Da; Qu, Youpeng; Liu, Jia; Liu, Guohong; Zhang, Jie; Feng, Yujie

    2016-08-17

    A biofilm growing on an air cathode is responsible for the decreased performance of microbial fuel cells (MFCs). For the undesired biofilm to be minimized, silver nanoparticles were synthesized on activated carbon as the cathodic catalyst (Ag/AC) in MFCs. Ag/AC enhanced maximum power density by 14.6% compared to that of a bare activated carbon cathode (AC) due to the additional silver catalysis. After operating MFCs over five months, protein content on the Ag/AC cathode was only 38.3% of that on the AC cathode, which resulted in a higher oxygen concentration diffusing through the Ag/AC cathode. In addition, a lower pH increment (0.2 units) was obtained near the Ag/AC catalyst surface after biofouling compared to 0.8 units of the AC cathode, indicating that less biofilm on the Ag/AC cathode had a minor resistance on hydroxide transported from the catalyst layer interfaces to the bulk solution. Therefore, less decrements of the Ag/AC activity and MFC performance were obtained. This result indicated that accelerated transport of oxygen and hydroxide, benefitting from the antibacterial property of the cathode, could efficiently maintain higher cathode stability during long-term operation.

  18. Development of a method to estimate the lifespan of proton exchange membrane fuel cell using electrochemical impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ju-hyung; Lee, Jong-Hak; Choi, Woojin [Department of Electrical Engineering, Soongsil University, 1-1 Sangdo-dong, Dongjak-gu, Seoul 156-743 (Korea); Park, Kyung-Won [Department of Chemical/Environmental Engineering, Soongsil University, 1-1 Sangdo-dong, Dongjak-gu, Seoul 156-743 (Korea); Sun, Hee-Young [Samsung Advanced Institute of Technology, Mt. 14-1, Nongseo-dong, Giheung-gu, Yongin-si, Gyeonggi-do 446-712 (Korea); Oh, Jae-Hyuk [Samsung Electronics, 416 Maetan-dong, Youngtong-gu, Suwon-si, Gyeonggi-do 443-370 (Korea)

    2010-09-15

    This paper proposes a new method for estimating the state and lifespan of fuel cells in operation by fuel cell equivalent impedance modeling by electrochemical impedance spectroscopy (EIS) and observing degradation. The performance change of fuel cells takes place in the form of changes in each parameter value comprising an equivalent AC impedance circuit; monitoring such changes allows for the prediction of the state and lifespan of a fuel cell. In the experiments, the AC impedance of high-temperature proton exchange membrane (PEM) fuel cells was measured at constant time intervals during their continuous operation for over 2200 h. The expression for the lifespan of a fuel cell was deduced by curve fitting the changes in each parameter to a polynomial. Electric double layer capacitance and charge transfer resistance, which show the reduction reaction of the cathode, were used as major parameters for judging the degradation; a method of using time constants is proposed to more accurately estimate the degree of degradation. In addition, an algorithm that can evaluate the soundness and lifespan of a fuel cell is proposed; it compares the measured time constant of the fuel cell being tested with that of average lifespan fuel cell. (author)

  19. The impact of personal background and school contextual factors on academic competence and mental health functioning across the primary-secondary school transition.

    Directory of Open Access Journals (Sweden)

    Sharmila Vaz

    Full Text Available Students negotiate the transition to secondary school in different ways. While some thrive on the opportunity, others are challenged. A prospective longitudinal design was used to determine the contribution of personal background and school contextual factors on academic competence (AC and mental health functioning (MHF of 266 students, 6-months before and after the transition to secondary school. Data from 197 typically developing students and 69 students with a disability were analysed using hierarchical linear regression modelling. Both in primary and secondary school, students with a disability and from socially disadvantaged backgrounds gained poorer scores for AC and MHF than their typically developing and more affluent counterparts. Students who attended independent and mid-range sized primary schools had the highest concurrent AC. Those from independent primary schools had the lowest MHF. The primary school organisational model significantly influenced post-transition AC scores; with students from Kindergarten--Year 7 schools reporting the lowest scores, while those from the Kindergarten--Year 12 structure without middle school having the highest scores. Attending a school which used the Kindergarten--Year 12 with middle school structure was associated with a reduction in AC scores across the transition. Personal background factors accounted for the majority of the variability in post-transition AC and MHF. The contribution of school contextual factors was relatively minor. There is a potential opportunity for schools to provide support to disadvantaged students before the transition to secondary school, as they continue to be at a disadvantage after the transition.

  20. Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing

    CERN Document Server

    Gottardi, Luciano; de Korte, Piet A J; Hartog, Roland Den; Dirks, Bob; Popescu, Manuela; Hoevers, Henk F C; Bruijn, Marcel; Borderias, Maria Parra; Takei, Y

    2016-01-01

    We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDMconfiguration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/RN < 0.5). The measured energy resolution at 5.89keV is 2.7eV for DC bias and 3.7eV for AC bias, while the baseline resolution is 2.8eV and 3.3eV, respectively.

  1. Evaluation of a.c. conductivity behaviour of graphite filled polysulphide modified epoxy composites

    Indian Academy of Sciences (India)

    Navin Chand; Deepak Jain

    2004-06-01

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled and unfilled epoxy composites. It was observed that the dielectric constant, tan and a.c. conductivity increase with increasing temperature. Near the transition temperature the materials show anomalous behaviour for the observed properties. Peaks of dielectric constant, tan and a.c. conductivity were observed to shift towards lower temperature with increasing frequency. Clear relaxation (tan ) peaks around 169°C were observed in epoxy resin, which shifted to lower temperature side on increasing the frequency. Addition of 2.91 wt% graphite shifted the tan peaks towards higher temperature side by creating hindrances to the rotation of polymer dipoles. Addition of 2.91 wt% graphite leads to an increased relaxation time of dipoles in polysulphide epoxy from 1.44 × 10-5-3.92 × 10-5 (s) at 90°C by creating the hindrance to the rotation of dipoles.

  2. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  3. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  4. JSC Case Study: Fleet Experience with E-85 Fuel

    Science.gov (United States)

    Hummel, Kirck

    2009-01-01

    JSC has used E-85 as part of an overall strategy to comply with Presidential Executive Order 13423 and the Energy Policy Act. As a Federal fleet, we are required to reduce our petroleum consumption by 2 percent per year, and increase the use of alternative fuels in our vehicles. With the opening of our onsite dispenser in October 2004, JSC became the second federal fleet in Texas and the fifth NASA center to add E-85 fueling capability. JSC has a relatively small number of GSA Flex Fuel fleet vehicles at the present time (we don't include personal vehicles, or other contractor's non-GSA fleet), and there were no reasonably available retail E-85 fuel stations within a 15-minute drive or within five miles (one way). So we decided to install a small 1000 gallon onsite tank and dispenser. It was difficult to obtain a supplier due to our low monthly fuel consumption, and our fuel supplier contract has changed three times in less than five years. We experiences a couple of fuel contamination and quality control issues. JSC obtained good information on E-85 from the National Ethanol Vehicle Coalition (NEVC). We also spoke with Defense Energy Support Center, (DESC), Lawrence Berkeley Laboratory, and US Army Fort Leonard Wood. E-85 is a liquid fuel that is dispensed into our Flexible Fuel Vehicles identically to regular gasoline, so it was easy for our vehicle drivers to make the transition.

  5. Fuel cell generator with fuel electrodes that control on-cell fuel reformation

    Science.gov (United States)

    Ruka, Roswell J.; Basel, Richard A.; Zhang, Gong

    2011-10-25

    A fuel cell for a fuel cell generator including a housing including a gas flow path for receiving a fuel from a fuel source and directing the fuel across the fuel cell. The fuel cell includes an elongate member including opposing first and second ends and defining an interior cathode portion and an exterior anode portion. The interior cathode portion includes an electrode in contact with an oxidant flow path. The exterior anode portion includes an electrode in contact with the fuel in the gas flow path. The anode portion includes a catalyst material for effecting fuel reformation along the fuel cell between the opposing ends. A fuel reformation control layer is applied over the catalyst material for reducing a rate of fuel reformation on the fuel cell. The control layer effects a variable reformation rate along the length of the fuel cell.

  6. HYDROGEN COMMERCIALIZATION: TRANSPORTATION FUEL FOR THE 21ST CENTURY

    Energy Technology Data Exchange (ETDEWEB)

    APOLONIO DEL TORO

    2008-05-27

    Since 1999, SunLine Transit Agency has worked with the U.S. Department of Energy (DOE), U.S. Department of Defense (DOD), and the U.S. Department of Transportation (DOT) to develop and test hydrogen infrastructure, fuel cell buses, a heavy-duty fuel cell truck, a fuel cell neighborhood electric vehicle, fuel cell golf carts and internal combustion engine buses operating on a mixture of hydrogen and compressed natural gas (CNG). SunLine has cultivated a rich history of testing and demonstrating equipment for leading industry manufacturers in a pre-commercial environment. Visitors to SunLine's "Clean Fuels Mall" from around the world have included government delegations and agencies, international journalists and media, industry leaders and experts and environmental and educational groups.

  7. Installation of Ohio's First Electrolysis-Based Hydrogen Fueling Station

    Science.gov (United States)

    Scheidegger, Brianne T.; Lively, Michael L.

    2012-01-01

    This paper describes progress made towards the installation of a hydrogen fueling station in Northeast Ohio. In collaboration with several entities in the Northeast Ohio area, the NASA Glenn Research Center is installing a hydrogen fueling station that uses electrolysis to generate hydrogen on-site. The installation of this station is scheduled for the spring of 2012 at the Greater Cleveland Regional Transit Authority s Hayden bus garage in East Cleveland. This will be the first electrolysis-based hydrogen fueling station in Ohio.

  8. Wide Operating Voltage Range Fuel Cell Battery Charger

    DEFF Research Database (Denmark)

    Hernandez Botella, Juan Carlos; Mira Albert, Maria del Carmen; Sen, Gokhan

    2014-01-01

    DC-DC converters for fuel cell applications require wide voltage range operation due to the unique fuel cell characteristic curve. Primary parallel isolated boost converter (PPIBC) is a boost derived topology for low voltage high current applications reaching an efficiency figure up to 98...... by two the converter input-to-output voltage gain. This allows covering the conditions when the fuel cell stack operates in the activation region (maximum output voltage) and increases the degrees of freedom for converter optimization. The transition between operating modes is studied because represents...

  9. Solid electrolytic fuel cell

    Energy Technology Data Exchange (ETDEWEB)

    Sakai, Masayasu; Yamauchi, Yasuhiro; Kamisaka, Mitsuo; Notomi, Kei.

    1989-04-21

    Concerning a solid electrolytic fuel cell with a gas permeable substrate pipe, a fuel electrode installed on this substrate pipe and an air electrode which is laminated on this fuel electrode with the electrolyte in between, the existing fuel cell of this kind uses crystals of CaMnO3, etc. for the material of the air electrode, but its electric resistance is big and in order to avert this, it is necessary to make the film thickness of the air electrode big. However, in such a case, the entry of the air into its inside worsens and the cell performance cannot develop satisfactorily. In view of the above, in order to obtain a high performance solid electrolytic fuel cell which can improve electric conductivity without damaging diffusion rate of the air, this invention proposes with regard to the aforementioned solid electrolytic fuel cell to install a heat resistant and conductive member inside the above air electrode. 6 figs.

  10. HTPEM Fuel Cell Impedance

    DEFF Research Database (Denmark)

    Vang, Jakob Rabjerg

    As part of the process to create a fossil free Denmark by 2050, there is a need for the development of new energy technologies with higher efficiencies than the current technologies. Fuel cells, that can generate electricity at higher efficiencies than conventional combustion engines, can...... potentially play an important role in the energy system of the future. One of the fuel cell technologies, that receives much attention from the Danish scientific community is high temperature proton exchange membrane (HTPEM) fuel cells based on polybenzimidazole (PBI) with phosphoric acid as proton conductor....... This type of fuel cell operates at higher temperature than comparable fuel cell types and they distinguish themselves by high CO tolerance. Platinum based catalysts have their efficiency reduced by CO and the effect is more pronounced at low temperature. This Ph.D. Thesis investigates this type of fuel...

  11. Toward sustainable fuel cells

    DEFF Research Database (Denmark)

    Stephens, Ifan; Rossmeisl, Jan; Chorkendorff, Ib

    2016-01-01

    A quarter of humanity's current energy consumption is used for transportation (1). Low-temperature hydrogen fuel cells offer much promise for replacing this colossal use of fossil fuels with renewables; these fuel cells produce negligible emissions and have a mileage and filling time equal...... to a regular gasoline car. However, current fuel cells require 0.25 g of platinum (Pt) per kilowatt of power (2) as catalysts to drive the electrode reactions. If the entire global annual production of Pt were devoted to fuel cell vehicles, fewer than 10 million vehicles could be produced each year, a mere 10......% of the annual automotive vehicle production. Lowering the Pt loading in a fuel cell to a sustainable level requires the reactivity of Pt to be tuned so that it accelerates oxygen reduction more effectively (3). Two reports in this issue address this challenge (4, 5)....

  12. Spiral cooled fuel nozzle

    Energy Technology Data Exchange (ETDEWEB)

    Fox, Timothy; Schilp, Reinhard

    2012-09-25

    A fuel nozzle for delivery of fuel to a gas turbine engine. The fuel nozzle includes an outer nozzle wall and a center body located centrally within the nozzle wall. A gap is defined between an inner wall surface of the nozzle wall and an outer body surface of the center body for providing fuel flow in a longitudinal direction from an inlet end to an outlet end of the fuel nozzle. A turbulating feature is defined on at least one of the central body and the inner wall for causing at least a portion of the fuel flow in the gap to flow transverse to the longitudinal direction. The gap is effective to provide a substantially uniform temperature distribution along the nozzle wall in the circumferential direction.

  13. SAVANNAH RIVER NATIONAL LABORATORYREGENERATIVE FUEL CELL PROJECT

    Energy Technology Data Exchange (ETDEWEB)

    Motyka, T

    2008-11-11

    A team comprised of governmental, academic and industrial partners led by the Savannah River National Laboratory developed and demonstrated a regenerative fuel cell system for backup power applications. Recent market assessments have identified emergency response and telecommunication applications as promising near-term markets for fuel cell backup power systems. The Regenerative Fuel Cell System (RFC) consisted of a 2 kg-per-day electrolyzer, metal-hydride based hydrogen storage units and a 5 kW fuel cell. Coupling these components together created a system that can produce and store its own energy from the power grid much like a rechargeable battery. A series of test were conducted to evaluate the performance of the RFC system under both steady-state and transit conditions that might be encountered in typical backup power applications. In almost all cases the RFC functioned effectively. Test results from the demonstration project will be used to support recommendations for future fuel cell and hydrogen component and system designs and support potential commercialization activities. In addition to the work presented in this report, further testing of the RFC system at the Center for Hydrogen Research in Aiken County, SC is planned including evaluating the system as a renewable system coupled with a 20kW-peak solar photovoltaic array.

  14. Texas Hydrogen Highway Fuel Cell Hybrid Bus and Fueling Infrastructure Technology Showcase - Final Scientific/Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Hitchcock, David

    2012-06-29

    The Texas Hydrogen Highway project has showcased a hydrogen fuel cell transit bus and hydrogen fueling infrastructure that was designed and built through previous support from various public and private sector entities. The aim of this project has been to increase awareness among transit agencies and other public entities on these transportation technologies, and to place such technologies into commercial applications, such as a public transit agency. The initial project concept developed in 2004 was to show that a skid-mounted, fully-integrated, factory-built and tested hydrogen fueling station could be used to simplify the design, and lower the cost of fueling infrastructure for fuel cell vehicles. The approach was to design, engineer, build, and test the integrated fueling station at the factory then install it at a site that offered educational and technical resources and provide an opportunity to showcase both the fueling station and advanced hydrogen vehicles. The two primary technology components include: Hydrogen Fueling Station: The hydrogen fueling infrastructure was designed and built by Gas Technology Institute primarily through a funding grant from the Texas Commission on Environmental Quality. It includes hydrogen production, clean-up, compression, storage, and dispensing. The station consists of a steam methane reformer, gas clean-up system, gas compressor and 48 kilograms of hydrogen storage capacity for dispensing at 5000 psig. The station is skid-mounted for easy installation and can be relocated if needed. It includes a dispenser that is designed to provide temperaturecompensated fills using a control algorithm. The total station daily capacity is approximately 50 kilograms. Fuel Cell Bus: The transit passenger bus built by Ebus, a company located in Downey, CA, was commissioned and acquired by GTI prior to this project. It is a fuel cell plug-in hybrid electric vehicle which is ADA compliant, has air conditioning sufficient for Texas operations

  15. Liquid fuel cells.

    Science.gov (United States)

    Soloveichik, Grigorii L

    2014-01-01

    The advantages of liquid fuel cells (LFCs) over conventional hydrogen-oxygen fuel cells include a higher theoretical energy density and efficiency, a more convenient handling of the streams, and enhanced safety. This review focuses on the use of different types of organic fuels as an anode material for LFCs. An overview of the current state of the art and recent trends in the development of LFC and the challenges of their practical implementation are presented.

  16. Fuel safety research 2001

    Energy Technology Data Exchange (ETDEWEB)

    Uetsuka, Hiroshi (ed.) [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-11-01

    The Fuel Safety Research Laboratory is in charge of research activity which covers almost research items related to fuel safety of water reactor in JAERI. Various types of experimental and analytical researches are being conducted by using some unique facilities such as the Nuclear Safety Research Reactor (NSRR), the Japan Material Testing Reactor (JMTR), the Japan Research Reactor 3 (JRR-3) and the Reactor Fuel Examination Facility (RFEF) of JAERI. The research to confirm the safety of high burn-up fuel and MOX fuel under accident conditions is the most important item among them. The laboratory consists of following five research groups corresponding to each research fields; Research group of fuel behavior under the reactivity initiated accident conditions (RIA group). Research group of fuel behavior under the loss-of-coolant accident conditions (LOCA group). Research group of fuel behavior under the normal operation conditions (JMTR/BOCA group). Research group of fuel behavior analysis (FEMAXI group). Research group of radionuclides release and transport behavior from irradiated fuel under severe accident conditions (VEGA group). The research conducted in the year 2001 produced many important data and information. They are, for example, the fuel behavior data under BWR power oscillation conditions in the NSRR, the data on failure-bearing capability of hydrided cladding under LOCA conditions and the FP release data at very high temperature in steam which simulate the reactor core condition during severe accidents. This report summarizes the outline of research activities and major outcomes of the research executed in 2001 in the Fuel Safety Research Laboratory. (author)

  17. Fuel Tank Technology

    Science.gov (United States)

    1989-11-01

    structures b) - Equal thermic inertia c) - Equal fluid volume d) - Equal pressure variation on both wings at the change of the room temperature - This...individual fuel sections. Each fuel section is further ccmpartmentated by metall tank shear walls and tank floors into three individual fuel cells to...plate Dy a stretch forming process, and the metallic tank floors . The air intake segments extend from one bulkhead to the other, thus reducing assembly

  18. Planning the HEU to LEU Transition for the NBSR

    Energy Technology Data Exchange (ETDEWEB)

    Hanson, A.L.; Diamond, D.

    2011-10-24

    A study has been carried out to understand how the NIST research reactor (NBSR) might be converted from using high-enriched uranium (HEU) to using low-enriched uranium (LEU) fuel. An LEU fuel design had previously been determined which provides an equilibrium core with the desirable fuel cycle length—a very important parameter for maintaining the experimental, scientific program supported by the NBSR. In the present study two options for getting to the equilibrium state are considered. One option starts with the loading of an entire core of fresh fuel. This was determined to be unacceptable. The other option makes use of the current fuel management scheme wherein four fresh fuel elements are loaded at the beginning of each cycle. However, it is shown that without some alterations to the fuel cycle, none of the transition cores containing both HEU and LEU fuel have sufficient excess reactivity to enable reactor operation for the required amount of time. It was determined that operating the first mixed cycle for a sufficiently reduced length of time provides the excess reactivity which enables subsequent transition cycles to be run for the desired number of days.

  19. Fuels Processing Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — NETL’s Fuels Processing Laboratory in Morgantown, WV, provides researchers with the equipment they need to thoroughly explore the catalytic issues associated with...

  20. Fuel cell catalyst degradation

    DEFF Research Database (Denmark)

    Arenz, Matthias; Zana, Alessandro

    2016-01-01

    Fuel cells are an important piece in our quest for a sustainable energy supply. Although there are several different types of fuel cells, the by far most popular is the proton exchange membrane fuel cell (PEMFC). Among its many favorable properties are a short start up time and a high power density...... increasing focus. Activity of the catalyst is important, but stability is essential. In the presented perspective paper, we review recent efforts to investigate fuel cell catalysts ex-situ in electrochemical half-cell measurements. Due to the amount of different studies, this review has no intention to give...

  1. Spin reorientation transition process in single crystal NdFeO3

    Science.gov (United States)

    Song, Gaibei; Jiang, Junjie; Kang, Baojuan; Zhang, Jincang; Cheng, Zhenxiang; Ma, Guohong; Cao, Shixun

    2015-06-01

    The spin reorientation transition in single crystal NdFeO3 is studied using AC magnetic susceptibility, hysteresis loops, and polarized terahertz (THz) time domain spectroscopy measurements. Different frequency dependence behaviors of AC susceptibility reflect that the dynamic response of magnetization inside the spin reorientation region differs from the phase outside the transition region. The magnetization hysteresis loops at different temperatures reveal that domains formed during the spin reorientation process, which coincides with the abrupt increase of AC magnetic susceptibility during the transition. In addition, temperature dependent THz wave excitation of quasi-antiferromagnetic mode indicates the process of spin reorientation as a continuous rotation of Fe3+ spins rather than a mixed phase of Γ4 and Γ2.

  2. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  3. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Science.gov (United States)

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  4. Modeling and control of fuel cell based distributed generation systems

    Science.gov (United States)

    Jung, Jin Woo

    This dissertation presents circuit models and control algorithms of fuel cell based distributed generation systems (DGS) for two DGS topologies. In the first topology, each DGS unit utilizes a battery in parallel to the fuel cell in a standalone AC power plant and a grid-interconnection. In the second topology, a Z-source converter, which employs both the L and C passive components and shoot-through zero vectors instead of the conventional DC/DC boost power converter in order to step up the DC-link voltage, is adopted for a standalone AC power supply. In Topology 1, two applications are studied: a standalone power generation (Single DGS Unit and Two DGS Units) and a grid-interconnection. First, dynamic model of the fuel cell is given based on electrochemical process. Second, two full-bridge DC to DC converters are adopted and their controllers are designed: an unidirectional full-bridge DC to DC boost converter for the fuel cell and a bidirectional full-bridge DC to DC buck/boost converter for the battery. Third, for a three-phase DC to AC inverter without or with a Delta/Y transformer, a discrete-time state space circuit model is given and two discrete-time feedback controllers are designed: voltage controller in the outer loop and current controller in the inner loop. And last, for load sharing of two DGS units and power flow control of two DGS units or the DGS connected to the grid, real and reactive power controllers are proposed. Particularly, for the grid-connected DGS application, a synchronization issue between an islanding mode and a paralleling mode to the grid is investigated, and two case studies are performed. To demonstrate the proposed circuit models and control strategies, simulation test-beds using Matlab/Simulink are constructed for each configuration of the fuel cell based DGS with a three-phase AC 120 V (L-N)/60 Hz/50 kVA and various simulation results are presented. In Topology 2, this dissertation presents system modeling, modified space

  5. Mechanism of Transition-Metal Nanoparticle Catalytic Graphene Cutting.

    Science.gov (United States)

    Ma, Liang; Wang, Jinlan; Yip, Joanne; Ding, Feng

    2014-04-03

    Catalytic cutting by transition-metal (TM) particles is a promising method for the synthesizing of high-quality graphene quantum dots and nanoribbons with smooth edges. Experimentally, it is observed that the cutting always results in channels with zigzag (ZZ) or armchair (AC) edges. However, the driving force that is responsible for such a cutting behavior remains a puzzle. Here, by calculating the interfacial formation energies of the TM-graphene edges with ab initio method, we show that the surface of a catalyst particle tends to be aligned along either AC or ZZ direction of the graphene lattice, and thus the cutting of graphene is guided as such. The different cutting behaviors of various catalysts are well-explained based on the competition between TM-passivated graphene edges and the etching-agent-terminated ones. Furthermore, the kinetics of graphene catalytic cutting along ZZ and AC directions, respectively, are explored at the atomic level.

  6. Fuel Cells: Reshaping the Future

    Science.gov (United States)

    Toay, Leo

    2004-01-01

    In conjunction with the FreedomCAR (Cooperative Automotive Research) and Fuel Initiative, President George W. Bush has pledged nearly two billion dollars for fuel cell research. Chrysler, Ford, and General Motors have unveiled fuel cell demonstration vehicles, and all three of these companies have invested heavily in fuel cell research. Fuel cell…

  7. Fessenheim: 30 years of nuclear fuel operation; Fessenheim: 30 ans d'exploitation du combustible nucleaire

    Energy Technology Data Exchange (ETDEWEB)

    Abgrall, G. [Centrale de Fessenheim, EDF, 68 - Dessenheim (France)

    2008-03-15

    Fessenheim units 1 and 2 are the first two 900 MW PWR put into operation in France (1977). This article reviews 30 years of change, optimization and feedback experience from Fessenheim, concerning: -) fuel assemblies (particularly the design of some components like grids, ends and guide tubes), -) the reload fuel management (to get a higher unloading burn-up), -) the refueling machine and tools (heavy modifications to reduce the human factor), and -) work organization (work shifts and staff training). (A.C.)

  8. Correlation between AC and DC transport properties of Mn substituted cobalt ferrite

    Science.gov (United States)

    Supriya, Sweety; Kumar, Sunil; Kar, Manoranjan

    2016-12-01

    The CoFe2-xMnxO4 compound is prepared by following the sol gel technique. The structural analysis through XRD and Rietveld has been confirmed for the single cubic phase having F d 3 ¯ m space group for CoFe2-xMnxO4 and also verified it through Raman spectroscopy measurements. The tetrahedral site observed to be red shifted with increase in Mn concentration in cobalt ferrite. All the XRD patterns have been analyzed by employing the Rietveld refinement technique. The particle size was found to be in the range of 30-40 nm. The electrical properties of polycrystalline CoFe2-xMnxO4 for x = 0.00, 0.10, 0.15, and 0.2, spinel ferrite was investigated by impedance spectroscopy. The influence of doping, frequency and temperature on the electrical transport properties of the CoFe2-xMnxO4 for x = 0.00, 0.10, 0.15, and 0.20 were investigated. The magnitude of Z' and Z″ decreases with increase in temperature. Only one semicircle is observed in each Cole Cole plot which reveals that ac conductivity is dominated by grains. The grain resistance and grain boundary resistance both were found to decrease as a function of temperature. Temperature variation of DC electrical conductivity follows the Arrhenius relationship. A detailed analysis of electrical parameters provides assistance in connecting information regarding the conduction mechanism as well as determination of both dielectric and magnetic transition temperatures in the substituted cobalt ferrite. Detailed analysis of ac impedance and DC resistivity measurement reveals that, the magnetic ordering temperature in the Mn substituted cobalt ferrite does not respond to the frequency of ac electrical signal; however, it responds to the DC resistivity. The correlation between ac impedance and DC resistivity has been established.

  9. EVermont Renewable Hydrogen Production and Transportation Fueling System

    Energy Technology Data Exchange (ETDEWEB)

    Garabedian, Harold T.

    2008-03-30

    A great deal of research funding is being devoted to the use of hydrogen for transportation fuel, particularly in the development of fuel cell vehicles. When this research bears fruit in the form of consumer-ready vehicles, will the fueling infrastructure be ready? Will the required fueling systems work in cold climates as well as they do in warm areas? Will we be sure that production of hydrogen as the energy carrier of choice for our transit system is the most energy efficient and environmentally friendly option? Will consumers understand this fuel and how to handle it? Those are questions addressed by the EVermont Wind to Wheels Hydrogen Project: Sustainable Transportation. The hydrogen fueling infrastructure consists of three primary subcomponents: a hydrogen generator (electrolyzer), a compression and storage system, and a dispenser. The generated fuel is then used to provide transportation as a motor fuel. EVermont Inc., started in 1993 by then governor Howard Dean, is a public-private partnership of entities interested in documenting and advancing the performance of advanced technology vehicles that are sustainable and less burdensome on the environment, especially in areas of cold climates, hilly terrain and with rural settlement patterns. EVermont has developed a demonstration wind powered hydrogen fuel producing filling system that uses electrolysis, compression to 5000 psi and a hydrogen burning vehicle that functions reliably in cold climates. And that fuel is then used to meet transportation needs in a hybrid electric vehicle whose internal combustion engine has been converted to operate on hydrogen Sponsored by the DOE EERE Hydrogen, Fuel Cells & Infrastructure Technologies (HFC&IT) Program, the purpose of the project is to test the viability of sustainably produced hydrogen for use as a transportation fuel in a cold climate with hilly terrain and rural settlement patterns. Specifically, the project addresses the challenge of building a renewable

  10. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  11. The AC and DC Conductivity of Nanocomposites

    Directory of Open Access Journals (Sweden)

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  12. Fuzzy efficiency optimization of AC induction motors

    Science.gov (United States)

    Jani, Yashvant; Sousa, Gilberto; Turner, Wayne; Spiegel, Ron; Chappell, Jeff

    1993-01-01

    This paper describes the early states of work to implement a fuzzy logic controller to optimize the efficiency of AC induction motor/adjustable speed drive (ASD) systems running at less than optimal speed and torque conditions. In this paper, the process by which the membership functions of the controller were tuned is discussed and a controller which operates on frequency as well as voltage is proposed. The membership functions for this dual-variable controller are sketched. Additional topics include an approach for fuzzy logic to motor current control which can be used with vector-controlled drives. Incorporation of a fuzzy controller as an application-specific integrated circuit (ASIC) microchip is planned.

  13. Transcranial alternating current stimulation (tACS

    Directory of Open Access Journals (Sweden)

    Andrea eAntal

    2013-06-01

    Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.

  14. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  15. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV......) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  16. Profitable use of bio fuels

    Energy Technology Data Exchange (ETDEWEB)

    Ekelund, Mats [Strateco Develoment AB, Vega (Sweden)], e-mail: mats.e@strateco.se

    2012-11-01

    Traditionally, the transportation industry has been opposed to any new legislation and when rather stringent emission legislation occurred, they objected just as they did when new fuels came on the agenda. On very short notice, Taxi Stockholm lost 20 % of their business when the County decided to award all public transportation contracts to a competitor. It was time to change plans instead of complaining and to take advantage of new opportunities - 'The first mover advantage'. Making the use of bio fuels into a profitable business takes a change of a standard 'business model' to do and there is still much room others to do the same. With a new CEO, an active marketing department and active individuals among the Board of Directors, Taxi Stockholm massaged a strategy where more business and private customers would be attracted by justifying the green leaf on every cab. All initiatives were publically announced and Taxi Stockholm broke new ice by putting a ban on spike tires - a decision which the vice Mayor made part of her ruling for the whole city. The Ban on gasoline and diesel cars were announced and such a statement attracted business from a loyalty point of view and from companies that had a 'Green Transport Policy' to live up to. Taxi Stockholm has seen growth and profitability grow since and credit the green policy on bio fuels such as bio gas and ethanol for most of it. Preem, Stockholm Transit, Volvo and other market driven operators have all seen markets grow from green initiatives.

  17. Resistivity and AC calorimetry measurements on CeNiGe{sub 2} under pressure

    Energy Technology Data Exchange (ETDEWEB)

    Holmes, A.T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan)]. E-mail: alex@djebel.mp.es.osaka-u.ac.jp; Muramatsu, T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Miyake, A. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Kaczorowski, D. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wroclaw (Poland); Bukowski, Z. [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wroclaw (Poland); Kagayama, T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Shimizu, K. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan)

    2007-03-15

    We present resistivity and AC calorimetry measurements of single crystalline CeNiGe{sub 2} under high pressure and low temperature in a diamond anvil cell. CeNiGe{sub 2} is a highly anisotropic, antiferromagnetic Kondo system at ambient pressure, located close to the boundary with non-magnetic systems. It has two ordering temperatures, T{sub N1}=3.9K and T{sub N2}=3.2K, which are suppressed under pressure. Between 0.7 and 1.4GPa only a single transition was identified, with T{sub N} reaching 1.9K by 1.4 GPa. At 1.9GPa two transitions could again be seen by AC calorimetry at 2.0 and 1.3K, accompanied by a qualitative change in the behaviour of the resistivity. The Sommerfeld coefficient showed a maximum of 755mJmol{sup -1}K{sup -2} at 1.4GPa, up from 448mJmol{sup -1}K{sup -2} at close to ambient pressure. The residual resistivity was found to decrease sharply above 1.4GPa after an initial increase with pressure.

  18. Glass Transition Temperature Depression at the Percolation Threshold in Carbon Nanotube-Epoxy Resin and Polypyrrole-Epoxy Resin Composites

    OpenAIRE

    Barrau, Sophie; Demont, Philippe; Maraval, Céline; Bernès, Alain; Lacabanne, Colette

    2005-01-01

    The glass transition temperatures of conducting composites, obtained by blending carbon nanotubes (CNTs) or polypyrrole (PPy) particles with epoxy resin, were investigated by using both differential scanning calorimetry (DSC) and dynamical mechanical thermal analysis (DMTA). For both composites, dc and ac conductivity measurements revealed an electrical percolation threshold at which the glass transition temperature and mechanical modulus of the composites pass through a minimum.

  19. Robust low frequency current ripple elimination algorithm for grid-connected fuel cell systems with power balancing technique

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jong-Soo; Choe, Gyu-Yeong; Lee, Byoung-Kuk [School of Information and Communication Engineering, Sungkyunkwan University, 300 Cheoncheon-dong, Jangan-gu, Suwon, Gyeonggi-do 440-746 (Korea, Republic of); Kang, Hyun-Soo [R and D Center, Advanced Drive Technology (ADT) Company, 689-26 Geumjeong-dong, Gunpo-si, Gyeonggi-do 435-862 (Korea, Republic of)

    2011-05-15

    The low frequency current ripple in grid-connected fuel cell systems is generated from dc-ac inverter operation, which generates 60 Hz fundamental component, and gives harmful effects on fuel cell stack itself, such as making cathode surface responses slower, causing an increase of more than 10% in the fuel consumption, creating oxygen starvation, causing a reduction in the operating lifetime, and incurring a nuisance tripping such as overload situation. With these reasons, low frequency current ripple makes fuel cell system unstable and lifetime of fuel cell stack itself short. This paper presents a fast and robust control algorithm to eliminate low frequency current ripple in grid-connected fuel cell systems. Compared with the conventional methods, in the proposed control algorithm, dc link voltage controller is shifted from dc-dc converter to dc-ac inverter, resulting that dc-ac inverter handles dc link voltage control and output current control simultaneously with help of power balancing technique. The results indicate that the proposed algorithm can not only completely eliminate current ripple but also significantly reduce the overshoot or undershoot during transient states without any extra hardware. The validity of the proposed algorithm is verified by computer simulations and also by experiments with a 1 kW laboratory prototype. (author)

  20. Framing car fuel efficiency : linearity heuristic for fuel consumption and fuel-efficiency ratings

    NARCIS (Netherlands)

    Schouten, T.M.; Bolderdijk, J.W.; Steg, L.

    2014-01-01

    People are sensitive to the way information on fuel efficiency is conveyed. When the fuel efficiency of cars is framed in terms of fuel per distance (FPD; e.g. l/100 km), instead of distance per units of fuel (DPF; e.g. km/l), people have a more accurate perception of potential fuel savings. People

  1. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  2. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can accurately produce...... the correct volt-sec average at its output, while simultaneously achieving inductive voltage boosting. More interestingly, these performance features are achieved with no increase in the number of semiconductor commutations, and hence no increase in switching losses. The proposed converter therefore offers...

  3. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  4. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  5. The topological AC effect on noncommutative phase space

    CERN Document Server

    Li, K; Li, Kang; Wang, Jianhua

    2006-01-01

    The Aharonov-Casher (AC) effect in non-commutative(NC) quantum mechanics is studied. Instead of using the star product method, we use a generalization of Bopp's shift method. After solving the Dirac equations both on noncommutative space and noncommutative phase space by the new method, we obtain the corrections to AC phase on NC space and NC phase space respectively.

  6. Considerations for an Ac Dipole for the LHC

    CERN Document Server

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  7. Equivalent circuit models for ac impedance data analysis

    Science.gov (United States)

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  8. A remark on Kov\\'acs' vanishing theorem

    CERN Document Server

    Fujino, Osamu

    2012-01-01

    We give an alternative proof of Kov\\'acs' vanishing theorem. Our proof is based on the standard arguments of the minimal model theory. We do not need the notion of Du Bois pairs. We reduce Kov\\'acs' vanishing theorem to the well-known relative Kawamata--Viehweg--Nadel vanishing theorem.

  9. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  10. Precursors of Short GRBs Registered by SPI-ACS/INTEGRAL

    Science.gov (United States)

    Minaev, P.; Pozanenko, A.

    2016-10-01

    We have searched for precursors in light curves of short gamma-ray bursts registered by SPI-ACS/INTEGRAL in 2002-2014. The portion of short bursts with precursor activity will be less than 0.4% from all short bursts registered by SPI-ACS.

  11. Effect of electric fields on the stabilization of premixed laminar bunsen flames at low AC frequency: Bi-ionic wind effect

    KAUST Repository

    Kim, Minkuk

    2012-03-01

    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally by applying AC electric fields at low frequency below 60. Hz together with DC in the single electrode configuration. The blowoff velocity has been measured for varying AC voltage and frequency. A transition frequency between low and high frequency regimes has been identified near 40-50. Hz, where AC electric fields have minimal effect on flame stabilization. In the low frequency regime, the blowoff velocity decreased linearly with AC voltage such that the flames became less stable. This was consistent with the DC result, implying the influence of the ionic wind effect. The variation of blowoff velocity with AC frequency showed a non-monotonic behavior in that the velocity decreased and then increased, exhibiting minimum blowoff velocity near 6-8. Hz. Based on the molecular kinetic theory, the developing degree of ionic wind was derived. By considering the ionic wind effects arising from both positive and negative ions in a flame zone, the bi-ionic wind effect successfully explained the non-monotonic behavior of blowoff velocity with AC frequency in the low frequency regime. © 2011 The Combustion Institute.

  12. Electrochemical Performance and Stability of the Cathode for Solid Oxide Fuel Cells. I. Cross Validation of Polarization Measurements by Impedance Spectroscopy and Current-Potential Sweep

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Xiao Dong; Pederson, Larry R.; Templeton, Jared W.; Stevenson, Jeffry W.

    2009-12-09

    The aim of this paper is to address three issues in solid oxide fuel cells: (1) cross-validation of the polarization of a single cell measured using both dc and ac approaches, (2) the precise determination of the total areal specific resistance (ASR), and (3) understanding cathode polarization with LSCF cathodes. The ASR of a solid oxide fuel cell is a dynamic property, meaning that it changes with current density. The ASR measured using ac impedance spectroscopy (low frequency interception with real Z´ axis of ac impedance spectrum) matches with that measured from a dc IV sweep (the tangent of dc i-V curve). Due to the dynamic nature of ASR, we found that an ac impedance spectrum measured under open circuit voltage or on a half cell may not represent cathode performance under real operating conditions, particularly at high current density. In this work, the electrode polarization was governed by the cathode activation polarization; the anode contribution was negligible.

  13. New switching pattern for AC/AC converters with RB-IGBTs for offshore wind parks

    OpenAIRE

    Mogstad, Anne Berit

    2008-01-01

    Offshore wind power has an increasing interest in the research community and among the politicians. Therefore it is important to find the right solutions to meet the environmental and commercial requirements to give offshore wind power a promising future. This thesis are proposing a new converter topology for offshore wind parks. Since the topology is based on DC transmission in stead of AC transmission it is better suited for use in this type of parks. All the converters are located in the w...

  14. www.FuelEconomy.gov

    Data.gov (United States)

    U.S. Environmental Protection Agency — FuelEconomy.gov provides comprehensive information about vehicles' fuel economy. The official U.S. government site for fuel economy information, it is operated by...

  15. Methanol Oxidation on Model Elemental and Bimetallic Transition Metal Surfaces

    DEFF Research Database (Denmark)

    Tritsaris, G. A.; Rossmeisl, J.

    2012-01-01

    Direct methanol fuel cells are a key enabling technology for clean energy conversion. Using density functional theory calculations, we study the methanol oxidation reaction on model electrodes. We discuss trends in reactivity for a set of monometallic and bimetallic transition metal surfaces, flat...... sites on the surface and to screen for novel bimetallic surfaces of enhanced activity. We suggest platinum copper surfaces as promising anode catalysts for direct methanol fuel cells....

  16. Are Solar Fuels Sustainable?

    NARCIS (Netherlands)

    Meuwese, Anne

    2012-01-01

    Summary The combined problems of too little fossil fuels to supply the world’s future energy needs and the possible negative environmental effects of carbon dioxide emissions which are coupled to their usage has led to the development of fuels based on s

  17. MICROBIAL FUEL CELL

    DEFF Research Database (Denmark)

    2008-01-01

    A novel microbial fuel cell construction for the generation of electrical energy. The microbial fuel cell comprises: (i) an anode electrode, (ii) a cathode chamber, said cathode chamber comprising an in let through which an influent enters the cathode chamber, an outlet through which an effluent...

  18. Solar fuel generator

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, Nathan S.; West, William C.

    2017-01-17

    The disclosure provides conductive membranes for water splitting and solar fuel generation. The membranes comprise an embedded semiconductive/photoactive material and an oxygen or hydrogen evolution catalyst. Also provided are chassis and cassettes containing the membranes for use in fuel generation.

  19. CO2-Neutral Fuels

    Science.gov (United States)

    Goede, Adelbert; van de Sanden, Richard

    2016-06-01

    Mimicking the biogeochemical cycle of System Earth, synthetic hydrocarbon fuels are produced from recycled CO2 and H2O powered by renewable energy. Recapturing CO2 after use closes the carbon cycle, rendering the fuel cycle CO2 neutral. Non-equilibrium molecular CO2 vibrations are key to high energy efficiency.

  20. CO2-Neutral Fuels

    NARCIS (Netherlands)

    Goede, A.; van de Sanden, M. C. M.

    2016-01-01

    Mimicking the biogeochemical cycle of System Earth, synthetic hydrocarbon fuels are produced from recycled CO2 and H2O powered by renewable energy. Recapturing CO2 after use closes the carbon cycle, rendering the fuel cycle CO2 neutral. Non-equilibrium molecular CO2 vibrations are key to high energy

  1. Portable Fuel Quality Analyzer

    Science.gov (United States)

    2014-01-27

    other transportation industries, such as trucking. The PFQA could also be used in fuel blending operations performed at petroleum, ethanol and biodiesel plants. ...JAN 2014 2. REPORT TYPE Project Summary 3. DATES COVERED 29-07-2013 to 27-01-2014 4. TITLE AND SUBTITLE PORTABLE FUEL QUALITY ANALYZER

  2. PLATINUM AND FUEL CELLS

    Science.gov (United States)

    Platinum requirements for fuel cell vehicles (FCVS) have been identified as a concern and possible problem with FCV market penetration. Platinum is a necessary component of the electrodes of fuel cell engines that power the vehicles. The platinum is deposited on porous electrodes...

  3. Improved hybrid rocket fuel

    Science.gov (United States)

    Dean, David L.

    1995-01-01

    McDonnell Douglas Aerospace, as part of its Independent R&D, has initiated development of a clean burning, high performance hybrid fuel for consideration as an alternative to the solid rocket thrust augmentation currently utilized by American space launch systems including Atlas, Delta, Pegasus, Space Shuttle, and Titan. It could also be used in single stage to orbit or as the only propulsion system in a new launch vehicle. Compared to solid propellants based on aluminum and ammonium perchlorate, this fuel is more environmentally benign in that it totally eliminates hydrogen chloride and aluminum oxide by products, producing only water, hydrogen, nitrogen, carbon oxides, and trace amounts of nitrogen oxides. Compared to other hybrid fuel formulations under development, this fuel is cheaper, denser, and faster burning. The specific impulse of this fuel is comparable to other hybrid fuels and is between that of solids and liquids. The fuel also requires less oxygen than similar hybrid fuels to produce maximum specific impulse, thus reducing oxygen delivery system requirements.

  4. Fuel cells: Operating flexibly

    Science.gov (United States)

    Lee, Young Moo

    2016-09-01

    Fuel cells typically function well only in rather limited temperature and humidity ranges. Now, a proton exchange membrane consisting of ion pair complexes is shown to enable improved fuel cell performance under a wide range of conditions that are unattainable with conventional approaches.

  5. Solar Fuel Generator

    Science.gov (United States)

    Lewis, Nathan S. (Inventor); West, William C. (Inventor)

    2017-01-01

    The disclosure provides conductive membranes for water splitting and solar fuel generation. The membranes comprise an embedded semiconductive/photoactive material and an oxygen or hydrogen evolution catalyst. Also provided are chassis and cassettes containing the membranes for use in fuel generation.

  6. Bioethanol: fuel or feedstock?

    DEFF Research Database (Denmark)

    Rass-Hansen, Jeppe; Falsig, Hanne; Jørgensen, Betina

    2007-01-01

    Increasing amounts of bioethanol are being produced from fermentation of biomass, mainly to counteract the continuing depletion of fossil resources and the consequential escalation of oil prices. Today, bioethanol is mainly utilized as a fuel or fuel additive in motor vehicles, but it could also ...

  7. Evaluation of Fuel-Cell Range Extender Impact on Hybrid Electrical Vehicle Performance

    DEFF Research Database (Denmark)

    Jensen, Hans-Christian Becker; Schaltz, Erik; Koustrup, Per Sune

    2013-01-01

    of a vehicle with an internal combustion engine (ICE). Fuel cells (FCs) can be added to an EV as an additional energy source. These are faster to refill and will therefore facilitate the transition from vehicles running on fossil fuel to electricity. Different EV setups with FC strategies are presented...

  8. Structure and dynamics of hydrogen in nanocomposite solid acids for fuel cell applications

    NARCIS (Netherlands)

    Chan, W.K.

    2011-01-01

    The transition to sustainable energy sources is inevitable. A possible future scenario could be the hydrogen economy, where the fuel cell plays an important role in the conversion of hydrogen back to electricity. The technology behind the fuel cell however, still has significant room for improvement

  9. Performance optimization and microbiological analysis of microbial fuel cell

    Directory of Open Access Journals (Sweden)

    Yajun WANG

    2016-06-01

    Full Text Available In order to improve the operation performance of microbial fuel cells, improved the degradation rate of nitrate and the power output of microbial fuel cell, a typical single chamber air-cathode microbial fuel cell (AC-MFC is inoculated and operated with urban sewage treatment plant clarifier sludge as inoculum source and sodium nitrate as electron acceptor. It is successfully started by synthetic wastewater containing a phosphate buffered nutrient solution (PBS, 50 mmol/L and sodium acetate (1 g/L. After successful starting, the four factors of carbon source, C/N, nitrate concentration and temperature are considered to optimize the operation performance of MFC. The test result shows that the operation performance of MFC is best under the conditions of anhydrous sodium acetate as carbon source, C/N of 5∶1, 200 mg/L nitrate concentration and at 30 ℃, and the degradation rate of nitrate reaches more than 90% and the voltage of MFC is 0.462 V. After 6 cycles of operation, the voltage and power density of MFC reaches 0.62 V and 4.53 W /m2. AC impedance analysis indicates that the MFC resistance is 130 Ω. Scanning electron microscopy of electrode surface illustrates that the number of microbial species are significantly increased. The results indicate that MFC can be an effective technology for nitrate contained wastewater treatment and energy production.

  10. Satellite Attitude Control System Design considering the Fuel Slosh Dynamics

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Gadelha de Souza

    2014-01-01

    Full Text Available The design of the satellite attitude control system (ACS becomes more complex when the satellite structure has different type of components like, flexible solar panels, antennas, mechanical manipulators, and tanks with fuel. A crucial interaction can occur between the fuel slosh motion and the satellite rigid motion during translational and/or rotational manoeuvre since these interactions can change the satellite centre of mass position damaging the ACS pointing accuracy. Although, a well-designed controller can suppress such disturbances quickly, the controller error pointing may be limited by the minimum time necessary to suppress such disturbances thus affecting the satellite attitude acquisition. As a result, the design of the satellite controller needs to explore the limits between the conflicting requirements of performance and robustness. This paper investigates the effects of the interaction between the liquid motion (slosh and the satellite dynamics in order to predict what the damage to the controller performance and robustness is. The fuel slosh dynamics is modelled by a pendulum which parameters are identified using the Kalman filter technique. This information is used to design the satellite controller by the linear quadratic regulator (LQR and linear quadratic Gaussian (LQG methods to perform a planar manoeuvre assuming thrusters are actuators.

  11. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  12. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  13. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  14. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  15. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  16. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    Institute of Scientific and Technical Information of China (English)

    房绪鹏

    2006-01-01

    提出了一种新型AC/AC变流器电路--单相电压型Z源AC/AC变流器;介绍了其电路拓扑、工作原理、控制方法等;给出了相应的仿真和实验结果.仿真和实验证实了该电路拓扑的合理性和优越性.

  17. Symposium on Energy Storage Materials Energy and Fuel Division, 246th ACS National Meeting

    Science.gov (United States)

    2015-04-17

    SooYeon Lim, Ramazan Kahraman, Yousung Jung, Jangwook Choi.   2:05 pm 449 Development of high energy density Li­organic redox flow battery Wei  Wang , Wu...entrapped catalysts Qiang Gu, Bruce Tatarchuk.   9:00 am 507 Natural cellulose fiber as substrate for supercapacitor with extra ion diffusion pathway Zhe ...Yun Hu  Wednesday, September 11, 2013  449 ­ Development of high energy density Li­organic redox flow battery Wei  Wang , wei.wang@pnnl.gov, Wu Xu

  18. Hydrogen Fuel Quality

    Energy Technology Data Exchange (ETDEWEB)

    Rockward, Tommy [Los Alamos National Laboratory

    2012-07-16

    For the past 6 years, open discussions and/or meetings have been held and are still on-going with OEM, Hydrogen Suppliers, other test facilities from the North America Team and International collaborators regarding experimental results, fuel clean-up cost, modeling, and analytical techniques to help determine levels of constituents for the development of an international standard for hydrogen fuel quality (ISO TC197 WG-12). Significant progress has been made. The process for the fuel standard is entering final stages as a result of the technical accomplishments. The objectives are to: (1) Determine the allowable levels of hydrogen fuel contaminants in support of the development of science-based international standards for hydrogen fuel quality (ISO TC197 WG-12); and (2) Validate the ASTM test method for determining low levels of non-hydrogen constituents.

  19. Rejuvenation of automotive fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Yu Seung; Langlois, David A.

    2016-08-23

    A process for rejuvenating fuel cells has been demonstrated to improve the performance of polymer exchange membrane fuel cells with platinum/ionomer electrodes. The process involves dehydrating a fuel cell and exposing at least the cathode of the fuel cell to dry gas (nitrogen, for example) at a temperature higher than the operating temperature of the fuel cell. The process may be used to prolong the operating lifetime of an automotive fuel cell.

  20. An Ac transposon system based on maize chromosome 4S for isolating long-distance-transposed Ac tags in the maize genome.

    Science.gov (United States)

    Wang, Fei; Li, Zhaoying; Fan, Jun; Li, Pengfei; Hu, Wei; Wang, Gang; Xu, Zhengkai; Song, Rentao

    2010-12-01

    Transposon tagging is an important tool for gene isolation and functional studies. In maize, several transposon-tagging systems have been developed, mostly using Activator/Dissociation (Ac/Ds) and Mutator systems. Here, we establish another Ac-based transposon system with the donor Ac tightly linked with sugary1 (su1) on maize chromosome 4S. Newly transposed Ac (tr-Acs) were detected based on a negative dosage effect, and long-distance-transposed Ac events were identified and isolated from the donor Ac by a simple backcross scheme. In this study, we identified 208 independent long-distance-transposed Ac lines. Thirty-one flanking sequences of these tr-Acs were isolated and localized in the maize genome. As found in previous studies, the tr-Acs preferentially inserted into genic sequences. The distribution of tr-Acs is not random. In our study, the tr-Acs preferentially transposed into chromosomes 1, 2, 9 and 10. We discuss the preferential distribution of tr-Acs from Ac systems. Our system is complementary to two other Ac-based regional-mutagenesis systems in maize, and the combined use of these systems will achieve an even and high-density distribution of Ac elements throughout the maize genome for functional-genomics studies.

  1. Structural Transitions in Topologically Constrained DNA

    Science.gov (United States)

    Leger, J.; Romano, G.; Sarkar, A.; Robert, J.; Bourdieu, L.; Chatenay, D.; Marko, J. F.

    2000-03-01

    We propose a theoretical explanation for results of recent single molecule micromanipulation experiments (Leger et al, PRL 83, 1066, 1999) on double-stranded DNA with fixed linking number. The topological constraint leads to novel structural transitions, including a shift of the usual 60 pN B-form to S-form transition force plateau up to a force of 100 pN when linking is fixed at zero. Our model needs five distinct states to explain the four different observed transitions. The various constant-force plateaus observed for different fixed values of linking correspond to a mixture of different pairs of states, weighted to satisfy the topological constraint. Our model allows us to conclude that sufficiently overtwisted DNA (positive linkage number) undergoes a transition from B-form DNA to a mixture of S-form and P-form DNA at a force plateau near 45 pN, and then to homogeneous P-form DNA at a force plateau near 110 pN. A similar two-step transition occurs for undertwisted DNA, and by analysing the twisting necessary to produce pure S-form DNA we conclude that the S-state has helix repeat of 38 bp. Support from the Whitaker Foundation, the NSF, the ACS-PRF and Research Corporation is gratefully acknowledged.

  2. Creating a fuels baseline and establishing fire frequency relationships to develop a landscape management strategy at the Savannah River Site.

    Energy Technology Data Exchange (ETDEWEB)

    Parresol, Bernard R; Shea, Dan; Ottmar, Roger

    2006-03-15

    USDA Forest Service Proceedings RMRS-P-41. pp 351-366. Abstract—The Savannah River Site is a Department of Energy Nuclear Defense Facility and a National Environmental Research Park located in the upper coastal plain of South Carolina. Prescribed burning is conducted on 15,000 to 20,000 ac annually. We modifi ed standard forest inventory methods to incorporate a complete assessment of fuel components on 622 plots, assessing coarse woody debris, ladder fuels, and the litter and duff layers. Because of deficiencies in south-wide data on litter-duff bulk densities, which are the fuels most often consumed in prescribed fires, we developed new bulk density relationships. Total surface fuel loading across the landscape ranged from 0.8 to 48.7 tons/ac. The variables basal area, stand age, and site index were important in accounting for variability in ladder fuel, coarse woody debris, and litter-duff for pine types. For a given pine stand condition, litter-duff loading decreased in direct proportion to the number of burns in the preceding thirty years. Ladder fuels for loblolly and longleaf increased in direct proportion to the years since the last prescribed burn. The pattern of fuel loading on the SRS reflects stand dynamics, stand management and fire management. It is suggested that the Forest Inventory and Analysis Program can easily modify sampling protocols to incorporate collection of fuels data.

  3. Simulated coal-gas fueled carbonate fuel cell power plant system verification. Final report, September 1990--June 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-01

    This report summarizes work performed under U.S. Department of Energy, Morgantown Energy Technology Center (DOE/METC) Contract DE-AC-90MC27168 for September 1990 through March 1995. Energy Research Corporation (ERC), with support from DOE, EPRI, and utilities, has been developing a carbonate fuel cell technology. ERC`s design is a unique direct fuel cell (DFC) which does not need an external fuel reformer. An alliance was formed with a representative group of utilities and, with their input, a commercial entry product was chosen. The first 2 MW demonstration unit was planned and construction begun at Santa Clara, CA. A conceptual design of a 10OMW-Class dual fuel power plant was developed; economics of natural gas versus coal gas use were analyzed. A facility was set up to manufacture 2 MW/yr of carbonate fuel cell stacks. A 100kW-Class subscale power plant was built and several stacks were tested. This power plant has achieved an efficiency of {approximately}50% (LHV) from pipeline natural gas to direct current electricity conversion. Over 6,000 hours of operation including 5,000 cumulative hours of stack operation were demonstrated. One stack was operated on natural gas at 130 kW, which is the highest carbonate fuel cell power produced to date, at 74% fuel utilization, with excellent performance distribution across the stack. In parallel, carbonate fuel cell performance has been improved, component materials have been proven stable with lifetimes projected to 40,000 hours. Matrix strength, electrolyte distribution, and cell decay rate have been improved. Major progress has been achieved in lowering stack cost.

  4. Alternate-Fueled Flight: Halophytes, Algae, Bio-, and Synthetic Fuels

    Science.gov (United States)

    Hendricks, R. C.

    2012-01-01

    Synthetic and biomass fueling are now considered to be near-term aviation alternate fueling. The major impediment is a secure sustainable supply of these fuels at reasonable cost. However, biomass fueling raises major concerns related to uses of common food crops and grasses (some also called "weeds") for processing into aviation fuels. These issues are addressed, and then halophytes and algae are shown to be better suited as sources of aerospace fuels and transportation fueling in general. Some of the history related to alternate fuels use is provided as a guideline for current and planned alternate fuels testing (ground and flight) with emphasis on biofuel blends. It is also noted that lessons learned from terrestrial fueling are applicable to space missions. These materials represent an update (to 2009) and additions to the Workshop on Alternate Fueling Sustainable Supply and Halophyte Summit at Twinsburg, Ohio, October 17 to 18, 2007.

  5. Low contaminant formic acid fuel for direct liquid fuel cell

    Science.gov (United States)

    Masel, Richard I.; Zhu, Yimin; Kahn, Zakia; Man, Malcolm

    2009-11-17

    A low contaminant formic acid fuel is especially suited toward use in a direct organic liquid fuel cell. A fuel of the invention provides high power output that is maintained for a substantial time and the fuel is substantially non-flammable. Specific contaminants and contaminant levels have been identified as being deleterious to the performance of a formic acid fuel in a fuel cell, and embodiments of the invention provide low contaminant fuels that have improved performance compared to known commercial bulk grade and commercial purified grade formic acid fuels. Preferred embodiment fuels (and fuel cells containing such fuels) including low levels of a combination of key contaminants, including acetic acid, methyl formate, and methanol.

  6. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  7. Direct Methanol Fuel Cell, DMFC

    Directory of Open Access Journals (Sweden)

    Amornpitoksuk, P.

    2003-09-01

    Full Text Available Direct Methanol Fuel Cell, DMFC is a kind of fuel cell using methanol as a fuel for electric producing. Methanol is low cost chemical substance and it is less harmful than that of hydrogen fuel. From these reasons it can be commercial product. The electrocatalytic reaction of methanol fuel uses Pt-Ru metals as the most efficient catalyst. In addition, the property of membrane and system designation are also effect to the fuel cell efficient. Because of low power of methanol fuel cell therefore, direct methanol fuel cell is proper to use for the energy source of small electrical devices and vehicles etc.

  8. How can we ensure the energy transition? Comment assurer la transition energetique?

    Energy Technology Data Exchange (ETDEWEB)

    Rojey, Alexandre

    2007-07-01

    With a continuously growing energy demand, the present energy model is clearly unsustainable due to the decline of fossil fuel resources and the risks of climate change A transition towards a sustainable model is therefore needed. However, there are no immediate alternatives leading to a sharp reduction in the use of fossil fuels, which are expected to maintain a major role for many years. The energy transition will therefore require a long time period The risks of climate change will require urgent measures and the 'carbon transition' has to be achieved more rapidly than the energy transition itself. A whole set of solutions will be needed in the technical but also economic and regulatory areas, for achieving a successful transition: energy conservation, diversification of energy . sources, reduction of the carbon content of the energy mix, CO{sub 2}, capture and storage. Hybrid options will be favoured. The paper describes the main features of the upcoming transition and the actions which are required. (auth)

  9. Operation Cost Minimization of Droop-Controlled AC Microgrids Using Multiagent-Based Distributed Control

    DEFF Research Database (Denmark)

    Li, Chendan; Savaghebi, Mehdi; Guerrero, Josep M.

    2016-01-01

    Recently, microgrids are attracting increasing research interest as promising technologies to integrate renewable energy resources into the distribution system. Although many works have been done on droop control applied to microgrids, they mainly focus on achieving proportional power sharing based...... on the power rating of the power converters. With various primary source for the distributed generator (DG), factors that are closely related to the operation cost, such as fuel cost of the generators and losses should be taken into account in order to improve the efficiency of the whole system. In this paper......, a multiagent-based distributed method is proposed to minimize the operation cost in AC microgrids. In the microgrid, each DG is acting as an agent which regulates the power individually using a novel power regulation method based on frequency scheduling. An optimal power command is obtained through carefully...

  10. Thermal hysteresis of Morin transition in hematite particles.

    Science.gov (United States)

    Suber, L; Imperatori, P; Mari, A; Marchegiani, G; Mansilla, M Vasquez; Fiorani, D; Plunkett, W R; Rinaldi, D; Cannas, C; Ennas, G; Peddis, D

    2010-07-14

    Rhombohedral shaped, single crystal hematite particles with narrow size distribution (D(TEM) = 93 +/- 2 nm) were prepared by hydrolysis of iron chloride and polymerisation in water. The results of field dependent magnetization measurements at different warming-cooling rates and ac susceptibility measurements at varying frequencies are reported and discussed. Thermal hysteresis (DeltaT(M)) associated with the Morin transition and field dependence of the Morin temperature (T(M)) are observed in warming-cooling cycles (DeltaT(M) = 25 and 13 K for H = 0.1 and 3 T, respectively) due to the first order phase transition. A frequency dependence of ac susceptibility is observed above T(M), as a result of the relaxation of the magnetic moment of hematite particles in the weak-ferromagnetic phase.

  11. City of Chula Vista hydrogen fuel cell bus demonstration project

    Energy Technology Data Exchange (ETDEWEB)

    Gustafson, B.; Bamberger, B.

    1996-10-01

    Hydrogen as an energy carrier and fuel has potential for various uses including electricity, commercial, residential, transportation, and industrial. It is an energy carrier that can be produced from a variety of primary sources and potentially can accomplish these various uses while significantly reducing pollution by substituting for or reducing the use of fossil fuels. One of the most immediate and potentially viable roles for hydrogen as an energy carrier will be its use as a transportation fuel, especially in densely populated urban areas where automotive emissions contribute significantly to air pollution. The Department of Energy`s commitment to research and development of hydrogen as an alternative fuel, and California`s Zero Emission Vehicle (ZEV) requirements, both provide the impetus and favorable circumstance for demonstrating hydrogen as a transportation fuel on an urban bus system. The purpose of this project is to demonstrate the feasibility of using solid polymer fuel cells in a hydrogen-powered electric drive system for an urban transit bus application. Fuel cell buses use hydrogen fuel and oxygen from the air to produce electrical power with the only byproduct being pure water. Proton Exchange Membrane (PEM) fuel cells are proposed for this project. Current evidence suggests that fuel cells, which rely on hydrogen and a process known as proton exchange to generate their power, appear to have an infinite life span. All exhaust pollution is completely eliminated, resulting in a Zero Emission Vehicle (ZEV). An urban bus system offers the potential for developing a market for the production of hydrogen propulsion technology due to extensive vehicular use in densely populated areas experiencing pollution from numerous sources, and because the central garaging facilities or the bus system facilitates fueling and maintenance functions.

  12. Comparison of the Accuracy and Speed of Transient Mobile A/C System Simulation Models: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Kiss, T.; Lustbader, J.

    2014-03-01

    The operation of air conditioning (A/C) systems is a significant contributor to the total amount of fuel used by light- and heavy-duty vehicles. Therefore, continued improvement of the efficiency of these mobile A/C systems is important. Numerical simulation has been used to reduce the system development time and to improve the electronic controls, but numerical models that include highly detailed physics run slower than desired for carrying out vehicle-focused drive cycle-based system optimization. Therefore, faster models are needed even if some accuracy is sacrificed. In this study, a validated model with highly detailed physics, the 'Fully-Detailed' model, and two models with different levels of simplification, the 'Quasi-Transient' and the 'Mapped- Component' models, are compared. The Quasi-Transient model applies some simplifications compared to the Fully-Detailed model to allow faster model execution speeds. The Mapped-Component model is similar to the Quasi-Transient model except instead of detailed flow and heat transfer calculations in the heat exchangers, it uses lookup tables created with the Quasi-Transient model. All three models are set up to represent the same physical A/C system and the same electronic controls. Speed and results of the three model versions are compared for steady state and transient operation. Steady state simulated data are also compared to measured data. The results show that the Quasi-Transient and Mapped-Component models ran much faster than the Fully-Detailed model, on the order of 10- and 100-fold, respectively. They also adequately approach the results of the Fully-Detailed model for steady-state operation, and for drive cycle-based efficiency predictions

  13. PyTransit: Transit light curve modeling

    Science.gov (United States)

    Parviainen, Hannu

    2015-05-01

    PyTransit implements optimized versions of the Giménez and Mandel & Agol transit models for exoplanet transit light-curves. The two models are implemented natively in Fortran with OpenMP parallelization, and are accessed by an object-oriented python interface. PyTransit facilitates the analysis of photometric time series of exoplanet transits consisting of hundreds of thousands of data points, and of multipassband transit light curves from spectrophotometric observations. It offers efficient model evaluation for multicolour observations and transmission spectroscopy, built-in supersampling to account for extended exposure times, and routines to calculate the projected planet-to-star distance for circular and eccentric orbits, transit durations, and more.

  14. Janus particle microshuttle: 1D directional self-propulsion modulated by AC electrical field

    Directory of Open Access Journals (Sweden)

    Jiliang Chen

    2014-03-01

    Full Text Available A catalytic Janus particle is capable of gaining energy from the surrounding fuel solution to drive itself to move continuously, which has an important impact in different fields, especially the field of micro-systems. However, the randomness of self-propulsion at the microscale restricts its use in practice. Achieving a directed self-propelled movement would greatly promote the application of the Janus particle. We proved experimentally that an AC electric field was an effective way to suppress Brownian motion and control the direction of self-propelled movement. The self-propulsion and dielectrophoretic response of a 2μm Janus particle were observed and the related basic data were collected. Interdigital electrodes, 20 μm in width, were energized in pulsed style to modulate the self-propulsion, which resulted in a shuttle-style motion in which a single Janus particle moved to and fro inside the strip electrode. The change of direction depends on its unique position: the catalyst side is always pointed outward and the orientation angle relative to the electrode is about 60°. Numerical simulation also proved that this position is reasonable. The present study could be beneficial with regard to self-propulsion and AC electrokinetics of the Janus particle.

  15. Reactivity descriptors for direct methanol fuel cell anode catalysts

    DEFF Research Database (Denmark)

    Ferrin, Peter; Nilekar, Anand Udaykumar; Greeley, Jeff

    2008-01-01

    We have investigated the anode reaction in direct methanol fuel cells using a database of adsorption free energies for 16 intermediates on 12 close-packed transition metal surfaces calculated with periodic, self-consistent, density functional theory (DFT-GGA). This database, combined with a simple...

  16. Government failings on energy efficiency and fuel poverty

    Energy Technology Data Exchange (ETDEWEB)

    Warren, A. [Association for the Conservation of Energy (United Kingdom)

    2008-09-15

    The author delivered this year's Melchett Lecture as part of the EI's Energy in transition event in July, having been awarded the 72nd Melchett Award about the organizing for energy efficiency and the Government's current failing on fuel poverty strategy. 3 figs.

  17. Metallic fuels for advanced reactors

    Science.gov (United States)

    Carmack, W. J.; Porter, D. L.; Chang, Y. I.; Hayes, S. L.; Meyer, M. K.; Burkes, D. E.; Lee, C. B.; Mizuno, T.; Delage, F.; Somers, J.

    2009-07-01

    In the framework of the Generation IV Sodium Fast Reactor Program, the Advanced Fuel Project has conducted an evaluation of the available fuel systems supporting future sodium cooled fast reactors. This paper presents an evaluation of metallic alloy fuels. Early US fast reactor developers originally favored metal alloy fuel due to its high fissile density and compatibility with sodium. The goal of fast reactor fuel development programs is to develop and qualify a nuclear fuel system that performs all of the functions of a conventional fast spectrum nuclear fuel while destroying recycled actinides. This will provide a mechanism for closure of the nuclear fuel cycle. Metal fuels are candidates for this application, based on documented performance of metallic fast reactor fuels and the early results of tests currently being conducted in US and international transmutation fuel development programs.

  18. 2009 Fuel Cell Market Report

    Energy Technology Data Exchange (ETDEWEB)

    Vincent, Bill [Breakthrough Technologies Inst., Washington, DC (United States); Gangi, Jennifer [Breakthrough Technologies Inst., Washington, DC (United States); Curtin, Sandra [Breakthrough Technologies Inst., Washington, DC (United States); Delmont, Elizabeth [Breakthrough Technologies Inst., Washington, DC (United States)

    2010-11-01

    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of fuel is supplied. Moreover, fuel cells do not burn fuel, making the process quiet, pollution-free and two to three times more efficient than combustion. Fuel cell systems can be a truly zero-emission source of electricity, if the hydrogen is produced from non-polluting sources. Global concerns about climate change, energy security, and air pollution are driving demand for fuel cell technology. More than 630 companies and laboratories in the United States are investing $1 billion a year in fuel cells or fuel cell component technologies. This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general.

  19. Hydrogen vehicle fueling station

    Energy Technology Data Exchange (ETDEWEB)

    Daney, D.E.; Edeskuty, F.J.; Daugherty, M.A. [Los Alamos National Lab., NM (United States)] [and others

    1995-09-01

    Hydrogen fueling stations are an essential element in the practical application of hydrogen as a vehicle fuel, and a number of issues such as safety, efficiency, design, and operating procedures can only be accurately addressed by a practical demonstration. Regardless of whether the vehicle is powered by an internal combustion engine or fuel cell, or whether the vehicle has a liquid or gaseous fuel tank, the fueling station is a critical technology which is the link between the local storage facility and the vehicle. Because most merchant hydrogen delivered in the US today (and in the near future) is in liquid form due to the overall economics of production and delivery, we believe a practical refueling station should be designed to receive liquid. Systems studies confirm this assumption for stations fueling up to about 300 vehicles. Our fueling station, aimed at refueling fleet vehicles, will receive hydrogen as a liquid and dispense it as either liquid, high pressure gas, or low pressure gas. Thus, it can refuel any of the three types of tanks proposed for hydrogen-powered vehicles -- liquid, gaseous, or hydride. The paper discusses the fueling station design. Results of a numerical model of liquid hydrogen vehicle tank filling, with emphasis on no vent filling, are presented to illustrate the usefulness of the model as a design tool. Results of our vehicle performance model illustrate our thesis that it is too early to judge what the preferred method of on-board vehicle fuel storage will be in practice -- thus our decision to accommodate all three methods.

  20. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Directory of Open Access Journals (Sweden)

    Henrik H. El Ali

    2012-10-01

    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  1. Measurement of AC loss of superconductors by vaporizing method

    Energy Technology Data Exchange (ETDEWEB)

    Wakabayashi, Hiroshi; Isono, Takaaki; Matsui, Kunihiro; Fujisaki, Reishi; Nunoya, Yoshihiko; Koizumi, Norikiyo; Takahashi, Yoshikazu; Tsuji, Hiroshi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1995-07-01

    In Japan Atomic Energy Research Institute, the development of superconducting pulse conductors for next period nuclear fusion reactors has been carried out. For these conductors, the rated current of 46 kA and the rated magnetic field of 13T are demanded. When the pulse excitation of superconductors is carried out, AC loss arises, and the temperature of the superconductors rises, and when it exceeds a certain value, the superconducting state cannot be maintained. Therefore, the AC loss of pulse conductors must be limited to a low value. It is difficult to evaluate the AC loss of superconductors by calculation, therefore, it is evaluated by actual measurement. There are magnetizing method and vaporizing method for measuring the AC loss. This time, the equipment for measuring the AC loss of 40 kA class superconductors by vaporizing method which measures the helium gas quantity vaporizing at the time of AC loss occurrence was designed and manufactured for the first time. The method of measuring the AC loss, the structure of the measuring equipment, the helium gas recovering part and the measuring part, the countermeasures for preventing helium gas leakage, the resistance heater for calibration, and the results of measurement are reported. (K.I.)

  2. Heating subsurface formations by oxidizing fuel on a fuel carrier

    Energy Technology Data Exchange (ETDEWEB)

    Costello, Michael; Vinegar, Harold J.

    2012-10-02

    A method of heating a portion of a subsurface formation includes drawing fuel on a fuel carrier through an opening formed in the formation. Oxidant is supplied to the fuel at one or more locations in the opening. The fuel is combusted with the oxidant to provide heat to the formation.

  3. Design package for fuel retrieval system fuel handling tool modification

    Energy Technology Data Exchange (ETDEWEB)

    TEDESCHI, D.J.

    1999-03-17

    This is a design package that contains the details for a modification to a tool used for moving fuel elements during loading of MCO Fuel Baskets for the Fuel Retrieval System. The tool is called the fuel handling tool (or stinger). This document contains requirements, development design information, tests, and test reports.

  4. Design package for fuel retrieval system fuel handling tool modification

    Energy Technology Data Exchange (ETDEWEB)

    TEDESCHI, D.J.

    1998-11-09

    This is a design package that contains the details for a modification to a tool used for moving fuel elements during loading of MCO Fuel Baskets for the Fuel Retrieval System. The tool is called the fuel handling tool (or stinger). This document contains requirements, development design information, tests, and test reports.

  5. Compatibility Studies of Hydrogen Peroxide and a New Hypergolic Fuel Blend

    Science.gov (United States)

    Baldridge, Jennifer; Villegas, Yvonne

    2002-01-01

    Several preliminary materials compatibility studies have been conducted to determine the practicality of a new hypergolic fuel system. Hypergolic fuel ignites spontaneously as the oxidizer decomposes and releases energy in the presence of the fuel. The bipropellant system tested consists of high-test hydrogen peroxide (HTP) and a liquid fuel blend consisting of a hydrocarbon fuel, an ignition enhancer and a transition metal catalyst. In order for further testing of the new fuel blend to take place, some basic materials compatibility and HTP decomposition studies must be accomplished. The thermal decomposition rate of HTP was tested using gas evolution and isothermal microcalorimetry (IMC). Materials were analyzed for compatibility with hydrogen peroxide including a study of the affect welding has on stainless steel elemental composition and its relation to HTP decomposition. Compatibility studies of valve materials in the fuel blend were performed to determine the corrosion resistance of the materials.

  6. Fuel nozzle tube retention

    Energy Technology Data Exchange (ETDEWEB)

    Cihlar, David William; Melton, Patrick Benedict

    2017-02-28

    A system for retaining a fuel nozzle premix tube includes a retention plate and a premix tube which extends downstream from an outlet of a premix passage defined along an aft side of a fuel plenum body. The premix tube includes an inlet end and a spring support feature which is disposed proximate to the inlet end. The premix tube extends through the retention plate. The spring retention feature is disposed between an aft side of the fuel plenum and the retention plate. The system further includes a spring which extends between the spring retention feature and the retention plate.

  7. Tanker Fuel Efficiency: Saving Through Receiver Fuel Planning

    Science.gov (United States)

    2014-06-13

    synthetic paraffinic kerosene (SPK). SPK is made from coal, natural gas or natural biomass. Hydro-treated renewable jet fuel (HRJ) and alcohol -to-jet...never made its way to their tanks . The cost of carrying this fuel exceeds $5 million. Additionally, some receivers took 13.8 million pounds of fuel ...extra fuel . This extra fuel at landing costs the Air Force money in CoW carrying costs. Any amount of fuel remaining in the tanker’s fuel tanks after

  8. Ammonia as a Suitable Fuel for Fuel Cells

    OpenAIRE

    Lan, Rong; Tao, Shanwen

    2014-01-01

    Ammonia, an important basic chemical, is produced at a scale of 150 million tons per year. Half of hydrogen produced in chemical industry is used for ammonia production. Ammonia containing 17.5 wt% hydrogen is an ideal carbon-free fuel for fuel cells. Compared to hydrogen, ammonia has many advantages. In this mini-review, the suitability of ammonia as fuel for fuel cells, the development of different types of fuel cells using ammonia as the fuel and the potential applications of ammonia fuel ...

  9. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  10. Faint Galaxies in deep ACS observations

    CERN Document Server

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L

    2003-01-01

    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  11. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  12. Cyclotron production of Ac-225 for targeted alpha therapy.

    Science.gov (United States)

    Apostolidis, C; Molinet, R; McGinley, J; Abbas, K; Möllenbeck, J; Morgenstern, A

    2005-03-01

    The feasibility of producing Ac-225 by proton irradiation of Ra-226 in a cyclotron through the reaction Ra-226(p,2n)Ac-225 has been experimentally demonstrated for the first time. Proton energies were varied from 8.8 to 24.8 MeV and cross-sections were determined by radiochemical analysis of reaction yields. Maximum yields were reached at incident proton energies of 16.8 MeV. Radiochemical separation of Ac-225 from the irradiated target yielded a product suitable for targeted alpha therapy of cancer.

  13. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  14. Recurrent Security Gaps In 802.11ac Routers

    OpenAIRE

    Mohammed Farik; ABM Shawkat Ali

    2015-01-01

    Abstract In comparison to earlier IEEE 802.11 standard abgn routers todays popular 802.11ac standard routers have enhanced security. However 802.11ac router still has major security vulnerabilities. The novelty of this paper is that we not only highlight multiple security vulnerabilities in 802.11ac router technologies that still have not been secured since the earlier standards but also present some new ideas with solutions. We believe that our line of thoughts on security vulnerabilities ga...

  15. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  16. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  17. Trends in catalytic NO decomposition over transition metal surfaces

    DEFF Research Database (Denmark)

    Falsig, Hanne; Bligaard, Thomas; Rass-Hansen, Jeppe

    2007-01-01

    The formation of NOx from combustion of fossil and renewable fuels continues to be a dominant environmental issue. We take one step towards rationalizing trends in catalytic activity of transition metal catalysts for NO decomposition by combining microkinetic modelling with density functional...... theory calculations. We show specifically why the key problem in using transition metal surfaces to catalyze direct NO decomposition is their significant relative overbinding of atomic oxygen compared to atomic nitrogen....

  18. Fuel Cell Power Plants Renewable and Waste Fuels

    Science.gov (United States)

    2011-01-13

    Fuel Cell Power Plants Renewable and Waste Fuels DOE-DOD Workshop Washington, DC. January 13, 2011 reliable, efficient, ultra-clean Report...2011 2. REPORT TYPE 3. DATES COVERED 00-00-2011 to 00-00-2011 4. TITLE AND SUBTITLE Fuel Cell Power Plants Renewable and Waste Fuels 5a. CONTRACT...Approved for public release; distribution unlimited 13. SUPPLEMENTARY NOTES presented at the DOE-DOD Waste-to-Energy using Fuel Cells Workshop held

  19. Organic fuel cells and fuel cell conducting sheets

    Science.gov (United States)

    Masel, Richard I.; Ha, Su; Adams, Brian

    2007-10-16

    A passive direct organic fuel cell includes an organic fuel solution and is operative to produce at least 15 mW/cm.sup.2 when operating at room temperature. In additional aspects of the invention, fuel cells can include a gas remover configured to promote circulation of an organic fuel solution when gas passes through the solution, a modified carbon cloth, one or more sealants, and a replaceable fuel cartridge.

  20. HIGH EFFICIENCY, LOW EMISSIONS, SOLID OXIDE FUEL CELL SYSTEMS FOR MULTIPLE APPLICATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Sara Ward; Michael A. Petrik

    2004-07-28

    Technology Management Inc. (TMI), teamed with the Ohio Office of Energy Efficiency and Renewable Energy, has engineered, constructed, and demonstrated a stationary, low power, multi-module solid oxide fuel cell (SOFC) prototype system operating on propane and natural gas. Under Phase I, TMI successfully operated two systems in parallel, in conjunction with a single DC-AC inverter and battery bus, and produced net AC electricity. Phase II testing expanded to include alternative and renewable fuels typically available in rural regions of Ohio. The commercial system is expected to have ultra-low pollution, high efficiency, and low noise. The TMI SOFC uses a solid ceramic electrolyte operating at high temperature (800-1000 C) which electrochemically converts gaseous fuels (hydrogen or mixed gases) and oxygen into electricity. The TMI system design oxidizes fuel primarily via electrochemical reactions and uses no burners (which pollute and consume fuel)--resulting in extremely clean exhaust. The use of proprietary sulfur tolerant materials developed by TMI allows system operation without additional fuel pre-processing or sulfur removal. Further, the combination of high operating temperatures and solid state operation increases the potential for higher reliability and efficiencies compared to other types of fuel cells. Applications for the TMI SOFC system cover a wide range of transportation, building, industrial, and military market sectors. A generic technology, fuel cells have the potential to be embodied into multiple products specific to Department of Energy (DOE) Office of Energy Efficiency and Renewable Energy (EERE) program areas including: Fuel Cells and Microturbines, School Buildings, Transportation, and Bioenergy. This program focused on low power stationary applications using a multi-module system operating on a range of common fuels. By producing clean electricity more efficiently (thus using less fuel), fuel cells have the triple effect of cleaning up the

  1. Thermal Stability of Otto Fuel Prepolymer

    Science.gov (United States)

    Tompa, Albert S.; Sandagger, Karrie H.; Bryant, William F., Jr.; McConnell, William T.; Lacot, Fernando; Carr, Walter A.

    2000-01-01

    Otto Fuel II contains a nitrate ester, plasticizer, and 2-NDPA as a stabilizer. Otto Fuel with stabilizers from three vendors was investigated by dynamic and isothermal DSC using samples sealed in a glass ampoule and by Isothermal Microcalorimetry (IMC) using 10 gram samples aged at 75 C for 35 days. DSC kinetics did not show differences between the stabilizer; the samples had an activation energy of 36.7 +/- 0.6 kcal/mol. However, IMC analysis was sensitive enough to detect small differences between the stabilizer, namely energy of interaction values of 7 to 14 Joules. DSC controlled cooling and heating at 5 C/min from 30 to -60 to 40 C experiments were similar and showed a crystallization peak at -48 +/- 1 C during cooling, and upon heating there was a glass transition temperature step at approx. -54 +/- 0.5 C and a melting peak at -28 +/- 0.4 C.

  2. Advanced Fuels Campaign 2012 Accomplishments

    Energy Technology Data Exchange (ETDEWEB)

    Not Listed

    2012-11-01

    The Advanced Fuels Campaign (AFC) under the Fuel Cycle Research and Development (FCRD) program is responsible for developing fuels technologies to support the various fuel cycle options defined in the DOE Nuclear Energy Research and Development Roadmap, Report to Congress, April 2010. The fiscal year 2012 (FY 2012) accomplishments are highlighted below. Kemal Pasamehmetoglu is the National Technical Director for AFC.

  3. Seventh Edition Fuel Cell Handbook

    Energy Technology Data Exchange (ETDEWEB)

    NETL

    2004-11-01

    Provides an overview of fuel cell technology and research projects. Discusses the basic workings of fuel cells and their system components, main fuel cell types, their characteristics, and their development status, as well as a discussion of potential fuel cell applications.

  4. BIOCHEMICAL FUEL CELLS.

    Science.gov (United States)

    used to evaluate kinetics of alcoholic fermentation . Evaluation of results indicated that 1% ethanol can be generated in 1 hour. One per cent ethanol is the minimum fuel concentration required for this system. (Author)

  5. Hydrogen as a fuel

    Energy Technology Data Exchange (ETDEWEB)

    1979-01-01

    A panel of the Committee on Advanced Energy Storage Systems of the Assembly of Engineering has examined the status and problems of hydrogen manufacturing methods, hydrogen transmission and distribution networks, and hydrogen storage systems. This examination, culminating at a time when rapidly changing conditions are having noticeable impact on fuel and energy availability and prices, was undertaken with a view to determining suitable criteria for establishing the pace, timing, and technical content of appropriate federally sponsored hydrogen R and D programs. The increasing urgency to develop new sources and forms of fuel and energy may well impact on the scale and timing of potential future hydrogen uses. The findings of the panel are presented. Chapters are devoted to hydrogen sources, hydrogen as a feedstock, hydrogen transport and storage, hydrogen as a heating fuel, automotive uses of hydrogen, aircraft use of hydrogen, the fuel cell in hydrogen energy systems, hydrogen research and development evaluation, and international hydrogen programs.

  6. Alternative fuel information sources

    Energy Technology Data Exchange (ETDEWEB)

    1994-06-01

    This short document contains a list of more than 200 US sources of information (Name, address, phone number, and sometimes contact) related to the use of alternative fuels in automobiles and trucks. Electric-powered cars are also included.

  7. Nuclear Fuel Reprocessing

    Energy Technology Data Exchange (ETDEWEB)

    Michael F. Simpson; Jack D. Law

    2010-02-01

    This is an a submission for the Encyclopedia of Sustainable Technology on the subject of Reprocessing Spent Nuclear Fuel. No formal abstract was required for the article. The full article will be attached.

  8. Fuels and Lubricants Facility

    Data.gov (United States)

    Federal Laboratory Consortium — Modern naval aircraft and turbine-powered craft require reliable and high-quality fuels and lubricants to satisfy the demands imposed upon them for top performance...

  9. Single-Phase Four Switch Z-Source AC-AC Converters%单相四开关Z源AC-AC变换器

    Institute of Scientific and Technical Information of China (English)

    汤雨; 谢少军; 张超华

    2007-01-01

    提出了一种单相四开关Z源AC-AC变换器,它包括电压型与电流型两类.与传统脉宽调制AC-AC变换器相比,它具有如下特点:输出电压范围宽且可升可降,输出电压与输入电压可同相或反相,冲击和谐波电流小,可靠性高.针对AC-AC变换器中固有的开关管换流问题,提出了一种适用于单相四开关Z源AC-AC变换器的换流方案,无需外加缓冲吸收电路即可实现开关管的安全换流.以电压型单相四开关Z源AC-AC变换器为例,对其进行了理论分析、仿真和原理试验研究.实验结果证实了Z源变换器的特性及换流方案的可行性.

  10. Nuclear fuel element

    Science.gov (United States)

    Meadowcroft, Ronald Ross; Bain, Alastair Stewart

    1977-01-01

    A nuclear fuel element wherein a tubular cladding of zirconium or a zirconium alloy has a fission gas plenum chamber which is held against collapse by the loops of a spacer in the form of a tube which has been deformed inwardly at three equally spaced, circumferential positions to provide three loops. A heat resistant disc of, say, graphite separates nuclear fuel pellets within the cladding from the plenum chamber. The spacer is of zirconium or a zirconium alloy.

  11. TARDEC Assured Fuels Initiative

    Science.gov (United States)

    2008-05-07

    Objectives • Develop and build two microchannel reactors − FT reactor : convert CO + H2 to long-chain hydrocarbons − Hydrocracker: upgrade FT wax to...present depending on the FT reactor conditions and catalyst used and subsequent upgrade-to-finished fuel processing • Lack of aromatics impacts fuel... Microchannel Processing Technology (MPT) The Technology • Stacks of closely spaced thin plates form microchannels • Process fluids pass through

  12. Solar fuels generator

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, Nathan S.; Spurgeon, Joshua M.

    2016-10-25

    The solar fuels generator includes an ionically conductive separator between a gaseous first phase and a second phase. A photoanode uses one or more components of the first phase to generate cations during operation of the solar fuels generator. A cation conduit is positioned provides a pathway along which the cations travel from the photoanode to the separator. The separator conducts the cations. A second solid cation conduit conducts the cations from the separator to a photocathode.

  13. Environmentally safe aviation fuels

    Science.gov (United States)

    Liberio, Patricia D.

    1995-01-01

    In response to the Air Force directive to remove Ozone Depleting Chemicals (ODC's) from military specifications and Defense Logistics Agency's Hazardous Waste Minimization Program, we are faced with how to ensure a quality aviation fuel without using such chemicals. Many of these chemicals are found throughout the fuel and fuel related military specifications and are part of test methods that help qualify the properties and quality of the fuels before they are procured. Many years ago there was a directive for military specifications to use commercially standard test methods in order to provide standard testing in private industry and government. As a result the test methods used in military specifications are governed by the American Society of Testing and Materials (ASTM). The Air Force has been very proactive in the removal or replacement of the ODC's and hazardous materials in these test methods. For example, ASTM D3703 (Standard Test Method for Peroxide Number of Aviation Turbine Fuels), requires the use of Freon 113, a known ODC. A new rapid, portable hydroperoxide test for jet fuels similar to ASTM D3703 that does not require the use of ODC's has been developed. This test has proved, in limited testing, to be a viable substitute method for ASTM D3703. The Air Force is currently conducting a round robin to allow the method to be accepted by ASTM and therefore replace the current method. This paper will describe the Air Force's initiatives to remove ODC's and hazardous materials from the fuel and fuel related military specifications that the Air Force Wright Laboratory.

  14. Vibrating fuel grapple. [LMFBR

    Science.gov (United States)

    Chertock, A.J.; Fox, J.N.; Weissinger, R.B.

    A reactor refueling method is described which utilizes a vibrating fuel grapple for removing spent fuel assemblies from a reactor core. It incorporates a pneumatic vibrator in the grapple head which allows additional withdrawal capability without exceeding the allowable axial force limit. The only moving part in the vibrator is a steel ball, pneumatically driven by a gas, such as argon, around a track, with centrifugal force created by the ball being transmitted through the grapple to the assembly handling socket.

  15. Second- and First-Order Phase Transitions in CDT

    CERN Document Server

    Ambjorn, J; Jurkiewicz, J; Loll, R

    2012-01-01

    Causal Dynamical Triangulations (CDT) is a proposal for a theory of quantum gravity, which implements a path-integral quantization of gravity as the continuum limit of a sum over piecewise flat spacetime geometries. We use Monte Carlo simulations to analyse the phase transition lines bordering the physically interesting de Sitter phase of the four-dimensional CDT model. Using a range of numerical criteria, we present strong evidence that the so-called A-C transition is first order, while the B-C transition is second order. The presence of a second-order transition may be related to an ultraviolet fixed point of quantum gravity and thus provide the key to probing physics at and possibly beyond the Planck scale.

  16. Magic Wavelength for the Hydrogen 1S-2S Transition

    Science.gov (United States)

    Kawasaki, Akio

    2016-05-01

    The state of the art precision measurement of the transition frequencies of neutral atoms is performed with atoms trapped by the magic wavelength optical lattice that cancels the ac Stark shift of the transitions. Trapping with magic wavelength lattice is also expected to improve the precision of the hydrogen 1S-2S transition frequency, which so far has been measured only with the atomic beam. In this talk, I discuss the magic wavelength for the hydrogen 1S-2S transition, and the possibility of implementing the optical lattice trapping for hydrogen. Optical trapping of hydrogen also opens the way to perform magnetic field free spectroscopy of antihydrogen for the test of CPT theorem.

  17. Thermal breeder fuel enrichment zoning

    Science.gov (United States)

    Capossela, Harry J.; Dwyer, Joseph R.; Luce, Robert G.; McCoy, Daniel F.; Merriman, Floyd C.

    1992-01-01

    A method and apparatus for improving the performance of a thermal breeder reactor having regions of higher than average moderator concentration are disclosed. The fuel modules of the reactor core contain at least two different types of fuel elements, a high enrichment fuel element and a low enrichment fuel element. The two types of fuel elements are arranged in the fuel module with the low enrichment fuel elements located between the high moderator regions and the high enrichment fuel elements. Preferably, shim rods made of a fertile material are provided in selective regions for controlling the reactivity of the reactor by movement of the shim rods into and out of the reactor core. The moderation of neutrons adjacent the high enrichment fuel elements is preferably minimized as by reducing the spacing of the high enrichment fuel elements and/or using a moderator having a reduced moderating effect.

  18. EPRI fuel cladding integrity program

    Energy Technology Data Exchange (ETDEWEB)

    Yang, R. [Electric Power Research Institute, Palo Alto, CA (United States)

    1997-01-01

    The objectives of the EPRI fuel program is to supplement the fuel vendor research to assure that utility economic and operational interests are met. To accomplish such objectives, EPRI has conducted research and development efforts to (1) reduce fuel failure rates and mitigate the impact of fuel failures on plant operation, (2) provide technology to extend burnup and reduce fuel cycle cost. The scope of R&D includes fuel and cladding. In this paper, only R&D related to cladding integrity will be covered. Specific areas aimed at improving fuel cladding integrity include: (1) Fuel Reliability Data Base; (2) Operational Guidance for Defective Fuel; (3) Impact of Water Chemistry on Cladding Integrity; (4) Cladding Corrosion Data and Model; (5) Cladding Mechanical Properties; and (6) Transient Fuel Cladding Response.

  19. Alternative Fuels: Research Progress

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi

    2013-01-01

    Full Text Available Chapter 1: Pollutant Emissions and Combustion Characteristics of Biofuels and Biofuel/Diesel Blends in Laminar and Turbulent Gas Jet Flames. R. N. Parthasarathy, S. R. Gollahalli Chapter 2: Sustainable Routes for The Production of Oxygenated High-Energy Density Biofuels from Lignocellulosic Biomass. Juan A. Melero, Jose Iglesias, Gabriel Morales, Marta Paniagua Chapter 3: Optical Investigations of Alternative-Fuel Combustion in an HSDI Diesel Engine. T. Huelser, M. Jakob, G. Gruenefeld, P. Adomeit, S. Pischinger Chapter 4: An Insight into Biodiesel Physico-Chemical Properties and Exhaust Emissions Based on Statistical Elaboration of Experimental Data. Evangelos G. Giakoumis Chapter 5: Biodiesel: A Promising Alternative Energy Resource. A.E. Atabani Chapter 6: Alternative Fuels for Internal Combustion Engines: An Overview of the Current Research. Ahmed A. Taha, Tarek M. Abdel-Salam, Madhu Vellakal Chapter 7: Investigating the Hydrogen-Natural Gas Blends as a Fuel in Internal Combustion Engine. ?lker YILMAZ Chapter 8: Conversion of Bus Diesel Engine into LPG Gaseous Engine; Method and Experiments Validation. M. A. Jemni , G. Kantchev , Z. Driss , R. Saaidia , M. S. Abid Chapter 9: Predicting the Combustion Performance of Different Vegetable Oils-Derived Biodiesel Fuels. Qing Shu, ChangLin Yu Chapter 10: Production of Gasoline, Naphtha, Kerosene, Diesel, and Fuel Oil Range Fuels from Polypropylene and Polystyrene Waste Plastics Mixture by Two-Stage Catalytic Degradation using ZnO. Moinuddin Sarker, Mohammad Mamunor Rashid

  20. Hydrogen fuel - Universal energy

    Science.gov (United States)

    Prince, A. G.; Burg, J. A.

    The technology for the production, storage, transmission, and consumption of hydrogen as a fuel is surveyed, with the physical and chemical properties of hydrogen examined as they affect its use as a fuel. Sources of hydrogen production are described including synthesis from coal or natural gas, biomass conversion, thermochemical decomposition of water, and electrolysis of water, of these only electrolysis is considered economicially and technologically feasible in the near future. Methods of production of the large quantities of electricity required for the electrolysis of sea water are explored: fossil fuels, hydroelectric plants, nuclear fission, solar energy, wind power, geothermal energy, tidal power, wave motion, electrochemical concentration cells, and finally ocean thermal energy conversion (OTEC). The wind power and OTEC are considered in detail as the most feasible approaches. Techniques for transmission (by railcar or pipeline), storage (as liquid in underwater or underground tanks, as granular metal hydride, or as cryogenic liquid), and consumption (in fuel cells in conventional power plants, for home usage, for industrial furnaces, and for cars and aircraft) are analyzed. The safety problems of hydrogen as a universal fuel are discussed, noting that they are no greater than those for conventional fuels.

  1. Nalco Fuel Tech

    Energy Technology Data Exchange (ETDEWEB)

    Michalak, S.

    1995-12-31

    The Nalco Fuel Tech with its seat at Naperville (near Chicago), Illinois, is an engineering company working in the field of technology and equipment for environmental protection. A major portion of NALCO products constitute chemical materials and additives used in environmental protection technologies (waste-water treatment plants, water treatment, fuel modifiers, etc.). Basing in part on the experience, laboratories and RD potential of the mother company, the Nalco Fuel Tech Company developed and implemented in the power industry a series of technologies aimed at the reduction of environment-polluting products of fuel combustion. The engineering solution of Nalco Fuel Tech belong to a new generation of environmental protection techniques developed in the USA. They consist in actions focused on the sources of pollutants, i.e., in upgrading the combustion chambers of power engineering plants, e.g., boilers or communal and/or industrial waste combustion units. The Nalco Fuel Tech development and research group cooperates with leading US investigation and research institutes.

  2. Motor Fuel Excise Taxes

    Energy Technology Data Exchange (ETDEWEB)

    2015-09-01

    A new report from the National Renewable Energy Laboratory (NREL) explores the role of alternative fuels and energy efficient vehicles in motor fuel taxes. Throughout the United States, it is common practice for federal, state, and local governments to tax motor fuels on a per gallon basis to fund construction and maintenance of our transportation infrastructure. In recent years, however, expenses have outpaced revenues creating substantial funding shortfalls that have required supplemental funding sources. While rising infrastructure costs and the decreasing purchasing power of the gas tax are significant factors contributing to the shortfall, the increased use of alternative fuels and more stringent fuel economy standards are also exacerbating revenue shortfalls. The current dynamic places vehicle efficiency and petroleum use reduction polices at direct odds with policies promoting robust transportation infrastructure. Understanding the energy, transportation, and environmental tradeoffs of motor fuel tax policies can be complicated, but recent experiences at the state level are helping policymakers align their energy and environmental priorities with highway funding requirements.

  3. Effect of proton-conduction in electrolyte on electric efficiency of multi-stage solid oxide fuel cells.

    Science.gov (United States)

    Matsuzaki, Yoshio; Tachikawa, Yuya; Somekawa, Takaaki; Hatae, Toru; Matsumoto, Hiroshige; Taniguchi, Shunsuke; Sasaki, Kazunari

    2015-07-28

    Solid oxide fuel cells (SOFCs) are promising electrochemical devices that enable the highest fuel-to-electricity conversion efficiencies under high operating temperatures. The concept of multi-stage electrochemical oxidation using SOFCs has been proposed and studied over the past several decades for further improving the electrical efficiency. However, the improvement is limited by fuel dilution downstream of the fuel flow. Therefore, evolved technologies are required to achieve considerably higher electrical efficiencies. Here we present an innovative concept for a critically-high fuel-to-electricity conversion efficiency of up to 85% based on the lower heating value (LHV), in which a high-temperature multi-stage electrochemical oxidation is combined with a proton-conducting solid electrolyte. Switching a solid electrolyte material from a conventional oxide-ion conducting material to a proton-conducting material under the high-temperature multi-stage electrochemical oxidation mechanism has proven to be highly advantageous for the electrical efficiency. The DC efficiency of 85% (LHV) corresponds to a net AC efficiency of approximately 76% (LHV), where the net AC efficiency refers to the transmission-end AC efficiency. This evolved concept will yield a considerably higher efficiency with a much smaller generation capacity than the state-of-the-art several tens-of-MW-class most advanced combined cycle (MACC).

  4. PUREX transition project case study

    Energy Technology Data Exchange (ETDEWEB)

    Jasen, W.G.

    1996-04-15

    In December 1992, the US Department of Energy (DOE) directed that the Plutonium-Uranium Extraction (PUREX) Plant be shut down and deactivated because it was no longer needed to support the nation`s production of weapons-grade plutonium. The PUREX/UO{sub 2} Deactivation Project will establish a safe and environmentally secure configuration for the facility and preserve that configuration for 10 years. The 10-year span is used to predict future maintenance requirements and represents the estimated time needed to define, authorize, and initiate the follow-on decontamination and decommissioning activities. Accomplishing the deactivation project involves many activities. Removing major hazards, such as excess chemicals, spent fuel, and residual plutonium are major goals of the project. The scope of the PUREX Transition Project is described within.

  5. Deep desulfurization of hydrocarbon fuels

    Science.gov (United States)

    Song, Chunshan [State College, PA; Ma, Xiaoliang [State College, PA; Sprague, Michael J [Calgary, CA; Subramani, Velu [State College, PA

    2012-04-17

    The invention relates to processes for reducing the sulfur content in hydrocarbon fuels such as gasoline, diesel fuel and jet fuel. The invention provides a method and materials for producing ultra low sulfur content transportation fuels for motor vehicles as well as for applications such as fuel cells. The materials and method of the invention may be used at ambient or elevated temperatures and at ambient or elevated pressures without the need for hydrogen.

  6. Outlook for alternative transportation fuels

    Energy Technology Data Exchange (ETDEWEB)

    Gushee, D.E. [Univ. of Illinois, Chicago, IL (United States)

    1996-12-31

    This presentation provides a brief review of regulatory issues and Federal programs regarding alternative fuel use in automobiles. A number of U.S. DOE initiatives and studies aimed at increasing alternative fuels are outlined, and tax incentives in effect at the state and Federal levels are discussed. Data on alternative fuel consumption and alternative fuel vehicle use are also presented. Despite mandates, tax incentives, and programs, it is concluded alternative fuels will have minimal market penetration. 7 refs., 5 tabs.

  7. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  8. Hydrolysis of polycarbonate catalyzed by ionic liquid [Bmim][Ac].

    Science.gov (United States)

    Song, Xiuyan; Liu, Fusheng; Li, Lei; Yang, Xuequn; Yu, Shitao; Ge, Xiaoping

    2013-01-15

    Hydrolysis of polycarbonate (PC) was studied using ionic liquid 1-butyl-3-methylimidazolium acetate ([Bmim][Ac]) as a catalyst. The influences of temperature, time, water dosage and [Bmim][Ac] dosage on the hydrolysis reaction were examined. Under the conditions of temperature 140°C, reaction time 3.0 h, m([Bmim][Ac]):m(PC)=1.5:1 and m(H(2)O):m(PC)=0.35:1, the conversion of PC was nearly 100% and the yield of bisphenol A (BPA) was over 96%. The ionic liquid could be reused up to 6 times without apparent decrease in the conversion of PC and yield of BPA. The kinetics of the reaction was also investigated. The results showed that the hydrolysis of PC in [Bmim][Ac] was a first-order kinetic reaction with an activation energy of 228 kJ/mol.

  9. Methanolysis of polycarbonate catalysed by ionic liquid [Bmim][Ac].

    Science.gov (United States)

    Liu, Fusheng; Li, Lei; Yu, Shitao; Lv, Zhiguo; Ge, Xiaoping

    2011-05-15

    The methanolysis of polycarbonate (PC) was studied using ionic liquid [Bmim][Ac] as a catalyst. The effects of temperature, time, methanol dosage and [Bmim][Ac] dosage on the methanolysis reaction were examined. It was shown that the conversion of PC was nearly 100%, and the yield of bisphenol A (BPA) was over 95% under the following conditions: m([Bmim][Ac]):m(PC) = 0.75:1;m(methanol):m(PC) = 0.75:1; a reaction temperature of 90 °C and a total time of 2.5h. The ionic liquid could be reused up to 6 times with no apparent decrease in the conversion of PC and yield of BPA. The kinetics of the reaction was also investigated. The results indicated that the methanolysis of PC in [Bmim][Ac] was a first-order kinetic reaction with an activation energy of 167 kJ/mol.

  10. Alternating current(AC) corrosion analyzed by electrochemical impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Ha, Tae Hyun; Kim, Dae Kyeong; Bae, Jeong Hyo; Lee, Hyun Goo; Lee, Sung Jin [Korea Electrotechnology Research Institute, Changwon (Korea, Republic of)

    2002-12-15

    So far, many research results on AC corrosion have been reported but each one is not consistent with another. In order to understand the characteristics and factors affecting on AC corrosion, Electrochemical impedance spectroscopy (E.I.S) was used and changes in kinetics and surface properties was analyzed. Generally, E.I.S. test has been used mainly for the diagnosis of the concrete corrosion and coating material. However, considering the outstanding functions of E.I.S. test, it can be adopted as a good method to study AC corrosion. Electrolyte resistance (R{sub sol}), double layer capacitance (C{sub dl}) and polarization resistance (R{sub p}) are the basic circuit elements. Using the model which is consist of these basic elements, various results of E.I.S. test can be interpreted. And through this method the mechanism and characteristics of AC corrosion can be explained

  11. ACS Algorithm in Discrete Ordinates for Pressure Vessel Dosimetry

    Directory of Open Access Journals (Sweden)

    Walters William

    2016-01-01

    Full Text Available The Adaptive Collision Source (ACS method can solve the Linear Boltzmann Equation (LBE more efficiently by adaptation of the angular quadrature order. This is similar to, and essentially an extension of, the first collision source method. Previously, the ACS methodology has been implemented into the TITAN discrete ordinates code, and has shown speedups of 2–4 on a simple test problem, with very little loss of accuracy (within a provided adaptive tolerance. This work examines the use of the ACS method for a more realistic problem: pressure vessel dosimetry with the VENUS-2 MOX-fuelled reactor dosimetry benchmark. The ACS method proved to be able to obtain accurate results while being approximately twice as efficient as using a constant quadrature in a standard source iteration scheme.

  12. Fabrication of alumina films with laminated structures by ac anodization

    Directory of Open Access Journals (Sweden)

    Hiroyo Segawa

    2014-01-01

    Full Text Available Anodization techniques by alternating current (ac are introduced in this review. By using ac anodization, laminated alumina films are fabricated. Different types of alumina films consisting of 50–200 nm layers were obtained by varying both the ac power supply and the electrolyte. The total film thickness increased with an increase in the total charge transferred. The thickness of the individual layers increased with the ac voltage; however, the anodization time had little effect on the film thickness. The laminated alumina films resembled the nacre structure of shells, and the different morphologies exhibited by bivalves and spiral shells could be replicated by controlling the rate of increase of the applied potentials.

  13. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  14. A hybrid electromechanical solid state switch for ac power control

    Science.gov (United States)

    1972-01-01

    Bidirectional thyristor coupled to a series of actuator driven electromechanical contacts generates hybrid electromechanical solid state switch for ac power control. Device is useful in power control applications where zero crossover switching is required.

  15. A precursor of β-delayed fission:230Ac

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  16. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  17. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  18. Development of the Field of Flexible AC Transmission Systems (FACTS)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Theoretical and technological development of large capacity power electronics and flexible AC transmission systems are one of the most important projects developed by Tsinghua University. The Flexible AC Transmission System (FACTS) technology which uses power electronics to improve the efficiency and quality of the electrical generation, transmission and distribution system is considered to be one of the most significant technological innovations for power systems in the 20th century. The advanced static var generator (ASVG) is a key FACTS device.

  19. The topological AC effect on non-commutative phase space

    Energy Technology Data Exchange (ETDEWEB)

    Li, Kang [Hangzhou Teachers College, Department of Physics, Hangzhou (China); The Abdus Salam International Center for Theoretical Physics, Trieste (Italy); Wang, Jianhua [Shaanxi University of Technology, Department of Physics, Hanzhong (China); The Abdus Salam International Center for Theoretical Physics, Trieste (Italy)

    2007-05-15

    The Aharonov-Casher (AC) effect in non-commutative (NC) quantum mechanics is studied. Instead of using the star product method, we use a generalization of Bopp's shift method. After solving the Dirac equations both on non-commutative space and non-commutative phase space by the new method, we obtain corrections to the AC phase on NC space and NC phase space, respectively. (orig.)

  20. Antifriction coatings based on a-C for biomedicine applications

    Science.gov (United States)

    Yurjev, Y. N.; Kiseleva, D. V.; Zaitcev, D. A.; Sidelev, D. V.; Korneva, O. S.

    2016-01-01

    This article reports on the investigation of mechanical properties of carbon films deposited by dual magnetron sputtering system with closed and mirror magnetic field. There is shown that a-C films with predominantly sp2-phase have relatively high hardness (up to 20 GPa) and low friction index (∼0.01). The influence of magnetic field on friction index is determined. The analysis of experimental data shows the obtained a-C samples can be used for biomedicine applications.