WorldWideScience

Sample records for ac transit fuel

  1. Alameda-Contra Costa Transit District (AC Transit) Fuel Cell Transit Buses: Preliminary Evaluation Results

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2007-03-01

    This report provides an evaluation of three prototype fuel cell-powered transit buses operating at AC Transit in Oakland, California, and six baseline diesel buses similar in design to the fuel cell buses.

  2. National Fuel Cell Bus Program: Accelerated Testing Evaluation Report and Appendices, Alameda-Contra Costa Transit District (AC Transit)

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 through October 2008. Evaluation results include implementation experience, fueling station operation, fuel cell bus operations at Golden Gate Transit, and evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and roadcalls).

  3. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  4. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  5. Connecticut Transit (CTTRANSIT) Fuel Cell Transit Bus: Preliminary Evaluation Results

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2008-10-01

    This report provides preliminary results from a National Renewable Energy Laboratory evaluation of a protoptye fuel cell transit bus operating at Connecticut Transit in Hartford. Included are descriptions of the planned fuel cell bus demonstration and equipment; early results and agency experience are also provided.

  6. Checklist for transition to new highway fuel(s).

    Energy Technology Data Exchange (ETDEWEB)

    Risch, C.; Santini, D.J. (Energy Systems)

    2011-12-15

    Transportation is vital to the U.S. economy and society. As such, U.S. Presidents have repeatedly stated that the nation needs to reduce dependence on petroleum, especially for the highway transportation sector. Throughout history, highway transportation fuel transitions have been completed successfully both in United States and abroad. Other attempts have failed, as described in Appendix A: Historical Highway Fuel Transitions. Planning for a transition is critical because the changes can affect our nation's ability to compete in the world market. A transition will take many years to complete. While it is tempting to make quick decisions about the new fuel(s) of choice, it is preferable and necessary to analyze all the pertinent criteria to ensure that correct decisions are made. Doing so will reduce the number of changes in highway fuel(s). Obviously, changes may become necessary because of occurrences such as significant technology breakthroughs or major world events. With any and all of the possible transitions to new fuel(s), the total replacement of gasoline and diesel fuels is not expected. These conventional fuels are envisioned to coexist with the new fuel(s) for decades, while the revised fuel and vehicle infrastructures are implemented. The transition process must analyze the needs of the primary 'players,' which consist of the customers, the government, the fuel industry, and the automotive industry. To maximize the probability of future successes, the prime considerations of these groups must be addressed. Section 2 presents a succinct outline of the Checklist. Section 3 provides a brief discussion about the groupings on the Checklist.

  7. Transition Towards a Sustainable Nuclear Fuel Cycle

    International Nuclear Information System (INIS)

    To support the evaluation of R and D needs and relevant technology requirements for future nuclear fuel cycles, the OECD/NEA WPFC Expert Group on Advanced Fuel Cycle Scenarios was created in 2010, replacing the WPFC Expert Group on Fuel Cycle Transition Scenario Studies (1) to assemble, organise and understand the scientific issues of advanced fuel cycles and (2) to provide a framework for assessing specific national needs related to the implementation of advanced fuel cycles. In this framework, a simulation of world transition scenarios towards possible future fuel cycles with fast reactors has been performed, using both a homogeneous and a heterogeneous approach involving different world regions. In fact, it has been found that a crucial feature of any world scenario study is to provide not only trends for an idealised 'homogeneous' description of the world, but also trends for different regions in the world, selected with simple criteria (mostly of geographical type), in order to apply different hypotheses to energy demand growth, different fuel cycle strategies and different reactor types implementation in the different regions. This approach was an attempt to avoid focusing on selected countries, in particular on those where no new spectacular energy demand growth is expected, but to provide trends and conclusions that account for the features of countries that will be major future players in the world's energy development. The heterogeneous approach considered a subdivision of the world in four main macro-regions (where countries have been grouped together according to their economic development dynamics). An original global electricity production envelope was used in simulations and a specific regional energy share was defined. In the regional approach two different fuel cycles were analysed: a once-through LWR cycle was used as the reference and a transition to fast reactor closed cycle to enable a better management of resources and minimisation of waste

  8. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2015

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States); Gikakis, Christina [Federal Transit Administration, Washington, DC (United States)

    2015-12-11

    This report, published annually, summarizes the progress of fuel cell electric bus (FCEB) development in the United States and discusses the achievements and challenges of introducing fuel cell propulsion in transit. Various stakeholders, including FCEB developers, transit agencies, and system integrators, have expressed the value of this annual status report, which provides a summary of results from evaluations performed by the National Renewable Energy Laboratory. The annual status report tracks the progress of the FCEB industry toward meeting technical targets, documents the lessons learned, and discusses the path forward for commercial viability of fuel cell technology for transit buses. The 2015 summary results primarily focus on the most recent year for each demonstration, from August 2014 through July 2015. The results for these buses account for more than 1,045,000 miles traveled and 83,000 hours of fuel cell power system operation. The primary results presented in the report are from two demonstrations of fuel-cell-dominant bus designs: the Zero Emission Bay Area Demonstration Group led by Alameda-Contra Costa Transit District (AC Transit) in California and the American Fuel Cell Bus Project at SunLine Transit Agency in California.

  9. A smooth transition to hydrogen transportation fuel

    Energy Technology Data Exchange (ETDEWEB)

    Berry, G.D.; Smith, J.R.; Schock, R.N.

    1995-04-14

    The goal of this work is to examine viable near-term infrastructure options for a transition to hydrogen fueled vehicles and to suggest profitable directions for technology development. The authors have focused in particular on the contrasting options of decentralized production using the existing energy distribution network, and centralized production of hydrogen with a large-scale infrastructure. Delivered costs have been estimated using best available industry cost and deliberately conservative economic assumptions. The sensitivities of these costs have then been examined for three small-scale scenarios: (1) electrolysis at the home for one car, and production at the small station scale (300 cars/day), (2) conventional alkaline electrolysis and (3) steam reforming of natural gas. All scenarios assume fueling a 300 mile range vehicle with 3.75 kg. They conclude that a transition appears plausible, using existing energy distribution systems, with home electrolysis providing fuel costing 7.5 to 10.5{cents}/mile, station electrolysis 4.7 to 7.1{cents}/mile, and steam reforming 3.7 to 4.7{cents}/mile. The average car today costs about 6{cents}/mile to fuel. Furthermore, analysis of liquid hydrogen delivered locally by truck from central processing plants can also be competitive at costs as low as 4{cents}/mile. These delivered costs are equal to $30 to $70 per GJ, LHV. Preliminary analysis indicates that electricity transmission costs favor this method of distributing energy, until very large (10 GW) hydrogen pipelines are installed. This indicates that significant hydrogen pipeline distribution will be established only when significant markets have developed.

  10. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2010

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.; Gigakis, C.

    2010-11-01

    This status report, fourth in a series of annual status reports from the U.S. Department of Energy's National Renewable Energy Laboratory, summarizes progress and accomplishments from demonstrations of fuel cell transit buses in the United States. This year's assessment report provides the results from the fifth year of operation of five Van Hool, ISE, and UTC Power fuel cell buses operating at AC Transit, SunLine, and CTTRANSIT. The achievements and challenges of this bus design, implementation, and operating are presented, with a focus on the next steps for implementing larger numbers and new and different designs of fuel cell buses. The major positive result from nearly five years of operation is the dramatic increase in reliability experienced for the fuel cell power system.

  11. Calculation of transition probabilities and ac Stark shifts in two-photon laser transitions of antiprotonic helium

    OpenAIRE

    HORI, MASAKI; Korobov, Vladimir I.

    2010-01-01

    Numerical ab initio variational calculations of the transition probabilities and ac Stark shifts in two-photon transitions of antiprotonic helium atoms driven by two counter-propagating laser beams are presented. We found that sub-Doppler spectroscopy is in principle possible by exciting transitions of the type (n,L)->(n-2,L-2) between antiprotonic states of principal and angular momentum quantum numbers n~L-1~35, first by using highly monochromatic, nanosecond laser beams of intensities 10^4...

  12. An overview of power electronics applications in fuel cell systems: DC and AC converters.

    Science.gov (United States)

    Ali, M S; Kamarudin, S K; Masdar, M S; Mohamed, A

    2014-01-01

    Power electronics and fuel cell technologies play an important role in the field of renewable energy. The demand for fuel cells will increase as fuel cells become the main power source for portable applications. In this application, a high-efficiency converter is an essential requirement and a key parameter of the overall system. This is because the size, cost, efficiency, and reliability of the overall system for portable applications primarily depend on the converter. Therefore, the selection of an appropriate converter topology is an important and fundamental aspect of designing a fuel cell system for portable applications as the converter alone plays a major role in determining the overall performance of the system. This paper presents a review of power electronics applications in fuel cell systems, which include various topology combinations of DC converters and AC inverters and which are primarily used in fuel cell systems for portable or stand-alone applications. This paper also reviews the switching techniques used in power conditioning for fuel cell systems. Finally, this paper addresses the current problem encountered with DC converters and AC inverter.

  13. An overview of power electronics applications in fuel cell systems: DC and AC converters.

    Science.gov (United States)

    Ali, M S; Kamarudin, S K; Masdar, M S; Mohamed, A

    2014-01-01

    Power electronics and fuel cell technologies play an important role in the field of renewable energy. The demand for fuel cells will increase as fuel cells become the main power source for portable applications. In this application, a high-efficiency converter is an essential requirement and a key parameter of the overall system. This is because the size, cost, efficiency, and reliability of the overall system for portable applications primarily depend on the converter. Therefore, the selection of an appropriate converter topology is an important and fundamental aspect of designing a fuel cell system for portable applications as the converter alone plays a major role in determining the overall performance of the system. This paper presents a review of power electronics applications in fuel cell systems, which include various topology combinations of DC converters and AC inverters and which are primarily used in fuel cell systems for portable or stand-alone applications. This paper also reviews the switching techniques used in power conditioning for fuel cell systems. Finally, this paper addresses the current problem encountered with DC converters and AC inverter. PMID:25478581

  14. Calculation of transition probabilities and ac Stark shifts in two-photon laser transitions of antiprotonic helium

    International Nuclear Information System (INIS)

    Numerical ab initio variational calculations of the transition probabilities and ac Stark shifts in two-photon transitions of antiprotonic helium atoms driven by two counter-propagating laser beams are presented. We found that sub-Doppler spectroscopy is, in principle, possible by exciting transitions of the type (n,L)→(n-2,L-2) between antiprotonic states of principal and angular momentum quantum numbers n∼L-1∼35, first by using highly monochromatic, nanosecond laser beams of intensities 104-105 W/cm2, and then by tuning the virtual intermediate state close (e.g., within 10-20 GHz) to the real state (n-1,L-1) to enhance the nonlinear transition probability. We expect that ac Stark shifts of a few MHz or more will become an important source of systematic error at fractional precisions of better than a few parts in 109. These shifts can, in principle, be minimized and even canceled by selecting an optimum combination of laser intensities and frequencies. We simulated the resonance profiles of some two-photon transitions in the regions n=30-40 of the p4He+ and p3He+ isotopes to find the best conditions that would allow this.

  15. Influence of the ac Stark effect on multiphoton transitions in molecules

    Science.gov (United States)

    Meerts, W. Leo; Ozier, Irving; Hougen, Jon T.

    1989-05-01

    A multiphoton mechanism for molecular beam transitions is presented which relies on a large first-order ac Stark effect to modulate the energy separation of the initial and final states of the multiphoton transition, but which does not require the presence of any intermediate level(s). The theoretical formalism uses ideas from the laser multiphoton literature for a two-level system interacting with a monochromatic electromagnetic radiation field, together with a close analog of the rotating wave approximation. The diagonal matrix elements of the Hamiltonian operator corresponding to the large ac Stark effect are removed by a mathematical substitution which in effect transforms appropriate differences of these diagonal elements into transition moments involving higher harmonics of the frequency of the monochromatic radiation field. The electric field strength of the true monochromatic radiation field is ``distributed'' among the higher harmonics of the effective field according to an expression involving Bessel functions. Because these Bessel functions are bounded, there exists for a given time t of exposure to the radiation, a threshold for the magnitude of the transition dipole matrix element coupling the two levels: Below this threshold, the transition probability in a traditional one-photon molecular beam electric resonance experiment cannot be made unity simply by increasing the amplitude of the radiation field. In fact, if the coupling matrix element is small enough, the molecular beam electric resonance signal cannot be detected within exposure time t. The algebraic formalism described above is checked by computer solution of an initial value problem involving four real coupled linear differential equations. It is then used to explain the multiphoton transitions previously observed in molecular beam electric resonance studies on the two symmetric top molecules OPF3 and CH3 CF3, where the number of photons involved in a given transition varies from 1

  16. DC Smart Grid Connected with Fuel Charging Station and AC Load by Hybrid MLI

    Directory of Open Access Journals (Sweden)

    Naveen Kumar

    2013-07-01

    Full Text Available This paper presents the Solar (photo voltaic power Plant and Windmill plant with DC Smart Grid connected with an DC Fuel Charging Station For Electric Vehicle (EV, Plug in Hybrid Electric Vehicle (PHEV and converted to AC load for Consumer single or Three phase ac load by means of Hybrid Multilevel Inverter (MLI. Solar Energy which store energy in lithium-ion battery and connected to Smart Grid .Wind Energy which get stored in Lithium-ion battery that Fixed DC Voltage connected with DC Smart Grid. Smart Grid which are Connected with DC Fuel Charging Station in Ring Topology with a certain distance for charging of Electric Vehicle (EV and Plug-in Hybrid Electric Vehicle with On-Board (Integrated Charger for faster charging of EV. In Power demand for Consumer the DC load from smart grid converted into an ac load by Hybrid Multilevel Inverter. In Consumers Place the small wind mill and PV panel are installed that energy can be used for consumers load at peak time or power Shutdown .Other than the power shutdown or peak time in the consumers place, stored DC Energy can be fed to Smart Grid. A major development in distribution automation is deployment of smart meters as a gateway between the utility and customer. With such capabilities the smart meter becomes not only a point of measurement of consumed kWh but also a controller capable of bidirectional communications with both the customer and utility.

  17. Fuel cycle transition - A Belgian implementation scenario

    International Nuclear Information System (INIS)

    At the end of 2002 the total installed electric power in Belgium was 16,200 MWe of which 40% (6485 MWe) corresponds to the seven nuclear power plants installed on the two Belgian sites of Doel (4 power plants) and Tihange (3 power plants) and the 25% participation in the two French Units B1 and B2 at Chooz at the Belgian-French border. The nuclear installed power in Belgium is 5800 MWe. In 2003, the government decided to phase out the nuclear energy progressively by closing the Belgian NPPs after 40 years of operation. This means that the first generation units (Doel 1, Doel 2 and Tihange 1) will be closed in 2015 and the four other remaining units in 2022-2025. Nevertheless, this phase out is subject to various conditions: the guarantee of energy independence should not be affected and the engagement to respect the Kyoto agreement (reducing the CO2 production by 7.5% in 2010 as compared to the 1990 production). Thus the phase-out decision can be re-opened if the above mentioned conditions are not met. The paper has the following contents: 1. Introduction; 2. Actual fuel cycle; 3. Transition fuel cycle; 4. Calculations; 4.1. PWR modelling; 4.2. ADS modelling; 4.3. Calculation code; 5. Results; 5.1. PWR/EPR; 5.2. ADS; 6. Conclusions. In conclusion it is shown that the evaluated stock pile of waste in Belgium (with no increase of electricity demand) coming from the thermal reactors park is 4380 tons (52 t Pu, 9 t MA, 217 t FP) with phase out (i.e. between 1975, first PWR and 2025, last PWR) and 7825 tons (84 t Pu, 20 t MA, 381 t FP) without phase out (i.e. between 1975, first PWR and 2075, last EPR). According to this study, Belgium should keep all its first generation Pu for the eventual starting of the self burning FR. Indeed, the Pu needed to start the self burning FR is evaluated between 60 t and 90 t (based on 10 t to 15 t per GWe). With an homogeneous core loading, 54% of the MA could be eliminated after 24 years in three 600 MWth industrial ADS (corresponding

  18. The ac Stark shifts of the terahertz clock transitions of barium

    Institute of Scientific and Technical Information of China (English)

    余庚华; 耿鹰鸽; 李隆; 周超; 段丞博; 柴瑞鹏; 杨永明

    2015-01-01

    Wavelength-dependent AC Stark shifts and magic wavelengths of the terahertz clock transitions between the metastable triplet states 6s5d 3D1 and 6s5d 3D2 are investigated with considering the optical lattice trapping of barium atoms with the linearly polarized laser. The trap depths and the slopes of light shift difference with distinct magic wave-lengths of the optical lattices are also discussed in detail. Several potentially suitable working points for the optical lattice trapping laser are recommended and selected from these magic wavelengths.

  19. Investigation of the hydrogen release incident at the AC Transit Emeryville Facility.

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Aaron P.; San Marchi, Christopher W.; Levin, Jamie; Butler, Dennis

    2012-06-01

    This report summarizes the investigation of the release of approximately 300kg of hydrogen at the AC Transit Facility in Emeryville, CA. The hydrogen release was avoidable in both the root cause and contributing factors. The report highlights the need for communication in all phases of project planning and implementation. Apart from the failed valve, the hydrogen system functioned as designed, venting the hydrogen gas a safe distance above surrounding structures and keeping the subsequent fire away from personnel and equipment. The Emeryville Fire Department responded appropriately given the information provided to the Incident Commander. No injuries or fatalities resulted from the incident.

  20. BC Transit Fuel Cell Bus Project: Evaluation Results Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Post, M.

    2014-02-01

    This report evaluates a fuel cell electric bus demonstration led by British Columbia Transit (BC Transit) in Whistler, Canada. BC Transit is collaborating with the California Air Resources Board and the U.S. Department of Energy's National Renewable Energy Laboratory to evaluate the buses in revenue service. This evaluation report covers two years of revenue service data on the buses from April 2011 through March 2013.

  1. AC-field-induced quantum phase transitions in density of states

    Science.gov (United States)

    Yang, Kai-Hua; Liu, Kai-Di; Wang, Huai-Yu; Qin, Chang-Dong

    2016-02-01

    We investigate the joint effects of the intralead electron interaction and an external alternating gate voltage on the time-averaged local density of states (DOSs) of a quantum dot coupled to two Luttinger-liquid leads in the Kondo regime. A rich dependence of the DOSs on the driving amplitude and intralead interaction is demonstrated. We show that the feature is quite different for different interaction strengths in the presence of the ac field. It is shown that the photon-assisted transport processes cause an additional splitting of the Kondo peak or dip, which exhibits photon-assisted single-channel (1CK) or two-channel Kondo (2CK) physics behavior. The phase transition between photon-assisted 1CK and 2CK physics occurs when the interaction strength is moderately strong. The inelastic channels associated with photon-assisted electron tunneling can dominate electron transport for weak interaction when the ac amplitude is greater than the frequency by one order of magnitude. In the limit of strong interaction the DOSs scale as a power-law behavior which is strongly affected by the ac field.

  2. Investigation of the Interfacial Transition Zone between Aggregate-Cement Paste by AC Impedance Spectroscopy

    Institute of Scientific and Technical Information of China (English)

    KONG Lijuan; HOU Lirong; WANG Yuhua; SUN Guowen

    2016-01-01

    Three different types and sizes of coarse aggregate were chosen, and the alternating current (AC) impedance of cement paste samples with and without aggregate was measured at different curing ages. Based on Song’s equivalent circuit model, the electrical properties from the AC impedance results were obtained, and the resistance of connected pores RCCP was used to characterize the microstructure of the interfacial transition zone (ITZ). The results show that the RCCP of concrete sample with aggregate is lower than that of cement paste sample, which indicates that the introduction of aggregate in cement paste makes the ITZ porous. Furthermore, for the same type of aggregate, an increase in particle size leads to a more porous ITZ, which accounts for the “water effect” and a larger aggregate would accumulate a thicker water iflm around it. In addition, for the same size of aggregate, the physical interaction between aggregate and cement paste is dominant in early age, and the microstructure of the ITZ around limestone aggregate is denser, which mainly depends on its rough surface and high water absorption. However, the microstructures of the ITZ around granite and basalt aggregates are denser in later age, which may be due to their higher chemical activity, and the chemical interaction between them and cement paste resulting in the generation of more hydrates. AC impedance spectroscopy thus proves to be powerful for evaluation of the microstructure of the ITZ.

  3. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2009

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.; Gikakis, C.

    2009-10-01

    This report documents progress in meeting the technological challenges of fuel cell propulsion for transportation based on current fuel cell transit bus demonstrations and plans for more fuel cell transit buses and hydrogen infrastructure.

  4. Core analysis during transition from 37-element fuel to CANFLEX-NU fuel in CANDU 6

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Chang Joon; Suk, Ho Chun [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    1998-12-31

    An 1200-day time-dependent fuel-management for the transition from 37-element fuel to CANFLEX-NU fuel in a CANDU 6 reactor has been simulated to show the compatibility of the CANFLEX-NU fuel with the reactor operation. The simulation calculations were carried out with the RFSP code, provided by cell averaged fuel properties obtained from the POWDERPUFS-V code. The refueling scheme for both fuels was an eight bundle shift at a time. The simulation results show that the maximum channel and bundle powers were maintained below the license limit of the CANDU 6. This indicates that the CANFLEX-NU fuel bundle is compatible with the CANDU 6 reactor operation during the transition period. 3 refs., 2 figs., 1 tab. (Author)

  5. Modeling a reversible solid oxide fuel cell as a storage device within AC power networks

    Energy Technology Data Exchange (ETDEWEB)

    Ren, J.; Roscoe, A.J.; Burt, G. [Department of Electronic and Electrical Engineering, Royal College, University of Strathclyde, Glasgow (United Kingdom); Gamble, S.R.; Irvine, J.T.S. [School of Chemistry, University of St. Andrews, Purdie Building, St. Andrews (United Kingdom)

    2012-10-15

    A reversible solid oxide fuel cell (RSOFC) system, consisting of a RSOFC stack, heat store, and electrical inverters to convert DC to AC power, is shown by computer modeling to have the potential to efficiently store electrical energy. This paper describes the modeling of a single RSOFC, based on a proposed cell geometry, empirical data on the resistivities of the components, and calculation of activation and diffusion polarization resistances from electrochemical theory. Data from ac impedance spectroscopy measurements on symmetrical cells are used to model RSOFC impedance. A RSOFC stack is modeled by electrically linking the individual cells inside a pressurized vessel. A phase change heat store is added to improve energy storage efficiency. The model is implemented in MATLAB {sup registered} /Simulink {sup registered}. Two competing inverter control schemes are compared, trading off DC bus ripple against AC power quality. It is found that selection of appropriate DC bus capacitance is important in certain scenarios, with potential system cost implications. It is shown that the system can store electrical energy at an efficiency of 64% over a single discharge-charge cycle, i.e., hydrogen to electricity and heat to hydrogen. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Stick-Slip to Sliding Transition of Dynamic Contact Lines under AC Electrowetting.

    Science.gov (United States)

    't Mannetje, D J C M; Mugele, F; van den Ende, D

    2013-12-01

    We show that at low velocities the dynamics of a contact line of a water drop moving over a Teflon-like surface under ac electrowetting must be described as stick-slip motion, rather than one continuous movement. At high velocities we observe a transition to a slipping regime. In the slipping regime the observed dependence of the contact angle is well described by a linearization of both the hydrodynamic and the molecular-kinetic model for the dynamic contact line behavior. The overall geometry of the drop also has a strong influence on the contact angle: if the drop is confined to a disk-like shape with radius R, much larger than the capillary length, and height h, smaller than the capillary length, the advancing angle increases steeper with velocity as the aspect ratio h/R is smaller. Although influence of the flow field near a contact line on the contact angle behavior has also been observed in other experiments, these observations do not fit either model. Finally, in our ac experiments no sudden increase of the hysteresis beyond a certain voltage and velocity was observed, as reported by other authors for a dc voltage, but instead we find with increasing voltage a steady decrease of the hysteresis. PMID:24219094

  7. Connecticut Transit (CTTRANSIT) Fuel Cell Transit Bus: Third Evaluation Report and Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2010-01-01

    This report describes operations at Connecticut Transit (CTTRANSIT) in Hartford for one prototype fuel cell bus and three new diesel buses operating from the same location. The prototype fuel cell bus was manufactured by Van Hool and ISE Corp. and features an electric hybrid drive system with a UTC Power PureMotion 120 Fuel Cell Power System and ZEBRA batteries for energy storage. The fuel cell bus started operation in April 2007, and evaluation results through October 2009 are provided in this report.

  8. BC Transit Fuel Cell Bus Project Evaluation Results: Second Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Post, M.

    2014-09-01

    Second report evaluating a fuel cell electric bus (FCEB) demonstration led by British Columbia Transit (BC Transit) in Whistler, Canada. BC Transit is collaborating with the California Air Resources Board and the U.S. Department of Energy's National Renewable Energy Laboratory to evaluate the buses in revenue service. NREL published its first report on the demonstration in February 2014. This report is an update to the previous report; it covers 3 full years of revenue service data on the buses from April 2011 through March 2014 and focuses on the final experiences and lessons learned.

  9. Speeding the transition: Designing a fuel-cell hypercar

    Energy Technology Data Exchange (ETDEWEB)

    Williams, B.D.; Moore, T.C.; Lovins, A.B. [Rocky Mountain Inst., Snowmass, CO (United States). Hypercar Center

    1997-12-31

    A rapid transformation now underway in automotive technology could accelerate the transition to transportation powered by fuel cells. Ultralight, advanced-composite, low-drag, hybrid-electric hypercars--using combustion engines--could be three- to fourfold more efficient and one or two orders of magnitude cleaner than today`s cars, yet equally safe, sporty, desirable, and (probably) affordable. Further, important manufacturing advantages--including low tooling and equipment costs, greater mechanical simplicity, autobody parts consolidation, shorter product cycles, and reduced assembly effort and space--permit a free-market commercialization strategy. This paper discusses a conceptual hypercar powered by a proton-exchange-membrane fuel cell (PEMFC). It outlines the implications of platform physics and component selection for the vehicle`s mass budget and performance. The high fuel-to-traction conversion efficiency of the hypercar platform could help automakers overcome the Achilles` heel of hydrogen-powered vehicles: onboard storage. Moreover, because hypercars would require significantly less tractive power, and even less fuel-cell power, they could adopt fuel cells earlier, before fuel cells` specific cost, mass, and volume have fully matured. In the meantime, commercialization in buildings can help prepare fuel cells for hypercars. The promising performance of hydrogen-fueled PEMFC hypercars suggests important opportunities in infrastructure development for direct-hydrogen vehicles.

  10. Leveraging Fuel Subsidy Reform for Transition in Yemen

    Directory of Open Access Journals (Sweden)

    Olivier Ecker

    2012-10-01

    Full Text Available Yemen is currently undergoing a major political transition, yet many economic challenges—including fuel subsidy reform—remain highly relevant. To inform the transition process with respect to a potential subsidy reform, we use a dynamic computable general equilibrium and microsimulation model for Yemen; we show that overall growth effects of subsidy reduction are positive in general, but poverty can increase or decrease depending on reform design. A promising strategy for a successful reform combines fuel subsidy reduction with direct income transfers to the poorest one-third of households during reform, and productivity-enhancing investment in infrastructure, plus fiscal consolidation. Public investments should be used for integrating economic spaces and restructuring of agricultural, industrial and service value chains in order to create a framework that encourages private-sector-led and job-creating growth.

  11. Connecticut Transit (CTTRANSIT) Fuel Cell Transit Bus: Second Evaluation Report and Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2009-05-01

    This report describes operations at Connecticut Transit (CTTRANSIT) in Hartford for one prototype fuel cell bus and three new diesel buses operating from the same location. The evaluation period in this report (January 2008 through February 2009) has been chosen to coincide with a UTC Power propulsion system changeout that occurred on January 15, 2008.

  12. SunLine Transit Agency Fuel Cell Transit Bus: Fifth Evaluation Report (Report and Appendices)

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2009-08-01

    This report describes operations at SunLine Transit Agency for a prototype fuel cell bus and five compressed natural gas (CNG) buses. This is the fifth evaluation report for this site, and it describes results and experiences from October 2008 through June 2009. These results are an addition to those provided in the previous four evaluation reports.

  13. SunLine Transit Agency Fuel Cell Transit Bus: Fourth Evaluation Report (Report and Appendices)

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2009-01-01

    This report describes operations at SunLine Transit Agency for a prototype fuel cell bus and five new compressed natural gas (CNG) buses. This is the fourth evaluation report for this site, and it describes results and experiences from April 2008 through October 2008. These results are an addition to those provided in the previous three evaluation reports.

  14. Spin density wave (SDW) transition in Ru doped BaFeAs2 investigated by AC steady state calorimetry

    International Nuclear Information System (INIS)

    Heat capacity measurements were done on sub-micron sized BaFe2−xRuxAs2 single crystals using thin film membrane based the AC steady state calorimetry technique. Noticeable thermal hysteresis is observed in the heat capacity of the BaFe2−xRuxAs2 during cooling and warming cycles, indicating first order nature of the SDW transition

  15. Safety evaluation of a hydrogen fueled transit bus

    Energy Technology Data Exchange (ETDEWEB)

    Coutts, D.A.; Thomas, J.K.; Hovis, G.L.; Wu, T.T. [Westinghouse Savannah River Co., Aiken, SC (United States)

    1997-12-31

    Hydrogen fueled vehicle demonstration projects must satisfy management and regulator safety expectations. This is often accomplished using hazard and safety analyses. Such an analysis has been completed to evaluate the safety of the H2Fuel bus to be operated in Augusta, Georgia. The evaluation methods and criteria used reflect the Department of Energy`s graded approach for qualifying and documenting nuclear and chemical facility safety. The work focused on the storage and distribution of hydrogen as the bus motor fuel with emphases on the technical and operational aspects of using metal hydride beds to store hydrogen. The safety evaluation demonstrated that the operation of the H2Fuel bus represents a moderate risk. This is the same risk level determined for operation of conventionally powered transit buses in the United States. By the same criteria, private passenger automobile travel in the United States is considered a high risk. The evaluation also identified several design and operational modifications that resulted in improved safety, operability, and reliability. The hazard assessment methodology used in this project has widespread applicability to other innovative operations and systems, and the techniques can serve as a template for other similar projects.

  16. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2011

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.; Gikakis, C.

    2011-11-01

    This status report, fifth in a series of annual status reports from the U.S. Department of Energy's National Renewable Energy Laboratory (NREL), discusses the achievements and challenges of fuel cell propulsion for transit and summarizes the introduction of fuel cell transit buses in the United States. Progress this year includes an increase in the number of fuel cell electric buses (FCEBs), from 15 to 25, operating at eight transit agencies, as well as increased diversity of the fuel cell design options for transit buses. The report also provides an analysis of the combined results from fuel cell transit bus demonstrations evaluated by NREL with a focus on the most recent data through July 2011 including fuel cell power system reliability and durability; fuel economy; roadcall; and hydrogen fueling results. These evaluations cover 22 of the 25 FCEBs currently operating.

  17. Reducing transit bus emissions: Alternative fuels or traffic operations?

    Science.gov (United States)

    Alam, Ahsan; Hatzopoulou, Marianne

    2014-06-01

    In this study, we simulated the operations and greenhouse gas (GHG) emissions of transit buses along a busy corridor and quantified the effects of two different fuels (conventional diesel and compressed natural gas) as well as a set of driving conditions on emissions. Results indicate that compressed natural gas (CNG) reduces GHG emissions by 8-12% compared to conventional diesel, this reduction could increase to 16% with high levels of traffic congestion. However, the benefits of switching from conventional diesel to CNG are less apparent when the road network is uncongested. We also investigated the effects of bus operations on emissions by applying several strategies such as transit signal priority (TSP), queue jumper lanes, and relocation of bus stops. Results show that in congested conditions, TSP alone can reduce GHG emissions by 14% and when combined with improved technology; a reduction of 23% is achieved. The reduction benefits are even more apparent when other transit operational improvements are combined with TSP. Finally a sensitivity analysis was performed to investigate the effect of operational improvements on emissions under varying levels of network congestion. We observe that under “extreme congestion”, the benefits of TSP decrease.

  18. ac hopping magnetotransport across the spin-flop transition in lightly doped La2CuO4

    Science.gov (United States)

    Sushkov, Oleg P.; Kotov, Valeri N.

    2008-02-01

    The weak ferromagnetism present in insulating La2CuO4 at low doping leads to a spin flop transition, and to transverse (interplane) hopping of holes in a strong external magnetic field. This results in a dimensional crossover 2D→3D for the in-plane transport, which in turn leads to an increase of the hole’s localization length and increased conduction. We demonstrate theoretically that as a consequence of this mechanism, a frequency-dependent jump of the in-plane ac hopping conductivity occurs at the spin flop transition. We predict the value and the frequency dependence of the jump. Experimental studies of this effect would provide important confirmation of the emerging understanding of lightly doped insulating La2-xSrxCuO4 .

  19. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2013

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Gikakis, C.

    2013-12-01

    This report is the seventh in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. The report also provides a snapshot of current FCEB performance results from August 2012 through July 2013 for five FCEB demonstrations at four transit agencies.

  20. ac Stark shift measurements of the clock transition in cold Cs atoms: Scalar and tensor light shifts of the D2 transition

    Science.gov (United States)

    Costanzo, G. A.; Micalizio, S.; Godone, A.; Camparo, J. C.; Levi, F.

    2016-06-01

    The ac Stark shift, or light shift, is a physical phenomenon that plays a fundamental role in many applications ranging from basic atomic physics to applied quantum electronics. Here, we discuss experiments testing light-shift theory in a cold-atom cesium fountain clock for the Cs D2 transition (i.e., 6 2S1 /2→6 2P3 /2 at 852 nm). Cold-atom fountains represent a nearly ideal system for the study of light shifts: (1) The atoms can be perturbed by a field of arbitrary character (e.g., coherent field or nonclassical field); (2) there are no trapping fields to complicate data interpretation; (3) the probed atoms are essentially motionless in their center-of-mass reference frame, T ˜ 1 μK; and (4) the atoms are in an essentially collisionless environment. Moreover, in the present work the resolution of the Cs excited-state hyperfine splittings implies that the D2 ac Stark shift contains a nonzero tensor polarizability contribution, which does not appear in vapor phase experiments due to Doppler broadening. Here, we test the linearity of the ac Stark shift with field intensity, and measure the light shift as a function of field frequency, generating a "light-shift curve." We have improved on the previous best test of theory by a factor of 2, and after subtracting the theoretical scalar light shift from the experimental light-shift curves, we have isolated and tested the tensor light shift for an alkali D2 transition.

  1. New aspects in the Bragg Glass-Disordered phase transition: an analysis based on the 3rd harmonics of the AC magnetic susceptibility

    OpenAIRE

    Adesso*, M. G.; Flukiger, R.; Giamarchi, T.; Goldacker, W.; H.; Kupfer; Pace, S.; Polichetti, M.; Uglietti, D.

    2007-01-01

    We analyse the phase transition between the Bragg Glass and the Disordered phase in the vortex lattice in type-II superconductors, both by analytical computations and experimental investigations. It is known that if the Peak Effect can be detected, a Bragg Glass/Disordered phase transition takes place. We show that, in some conditions, this transition can occur without the observation of the Peak Effect Phenomenon. We introduce a method based on the 3rd harmonics of the AC magnetic susceptibi...

  2. Transition Analysis of Promising U.S. Future Fuel Cycles Using ORION

    Energy Technology Data Exchange (ETDEWEB)

    Sunny, Eva E. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Worrall, Andrew [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Peterson, Joshua L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Powers, Jeffrey J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gehin, Jess C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gregg, Robert [Preston Laboratory, Springfields Works (United Kingdom)

    2015-01-01

    The US Department of Energy Office of Fuel Cycle Technologies performed an evaluation and screening (E&S) study of nuclear fuel cycle options to help prioritize future research and development decisions. Previous work for this E&S study focused on establishing equilibrium conditions for analysis examples of 40 nuclear fuel cycle evaluation groups (EGs) and evaluating their performance according to a set of 22 standardized metrics. Following the E&S study, additional studies are being conducted to assess transitioning from the current US fuel cycle to future fuel cycle options identified by the E&S study as being most promising. These studies help inform decisions on how to effectively achieve full transition, estimate the length of time needed to undergo transition from the current fuel cycle, and evaluate performance of nuclear systems and facilities in place during the transition. These studies also help identify any barriers to achieve transition. Oak Ridge National Laboratory (ORNL) Fuel Cycle Options Campaign team used ORION to analyze the transition pathway from the existing US nuclear fuel cycle—the once-through use of low-enriched-uranium (LEU) fuel in thermal-spectrum light water reactors (LWRs) —to a new fuel cycle with continuous recycling of plutonium and uranium in sodium fast reactors (SFRs). This paper discusses the analysis of the transition from an LWR to an SFR fleet using ORION, highlights the role of lifetime extensions of existing LWRs to aid transition, and discusses how a slight delay in SFR deployment can actually reduce the time to achieve an equilibrium fuel cycle.

  3. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2012

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Chandler, Kevin [Battelle, Columbus, OH (United States); Gikakis, Christina [Federal Transit Administration, Washington, DC (United States)

    2012-11-01

    This report is the sixth in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. The report also provides a snapshot of current FCEB performance results over the last year.

  4. Bay Area Transit Agencies Propel Fuel Cell Buses Toward Commercialization (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2010-07-01

    This fact sheet describes the Zero Emission Bay Area (ZEBA) demonstration of the next generation of fuel cells buses. Several transit agencies in the San Francisco Bay Area are participating in demonstrating the largest single fleet of fuel cell buses in the United States.

  5. Superconducting transition in ruthenocuprate RuSr2GdCu2O8 viewed from the studies of the imaginary part of ac susceptibility

    Science.gov (United States)

    Zivkovic, I.; Drobac, D.; Ariosa, D.; Berger, H.; Pavuna, D.; Prester, M.

    2002-12-01

    We have measured two structurally similar superconducting systems, RuSr2GdCu2O8 and GdBa2Cu3O7 by means of high-resolution ac susceptibility. The real and the imaginary part of ac susceptibility of both bulk-ceramic and powdered samples have been studied down to the very small magnetic-field levels. We show that there are significant differences in the evolution of superconductivity in the two studied superconducting systems. In particular, we show that the superconducting transition in the grains in RuSr2GdCu2O8 system is masked with intrinsic magnetism of complex origin.

  6. Development of a New Class of Low Cost, High Frequency Link Direct DC to AC Converters for Solid Oxide Fuel Cells (SOFC)

    Energy Technology Data Exchange (ETDEWEB)

    Prasad Enjeti; J.W. Howze

    2003-12-01

    This project proposes to design and develop a new class of power converters (direct DC to AC) to drastically improve performance and optimize the cost, size, weight and volume of the DC to AC converter in SOFC systems. The proposed topologies employ a high frequency link; direct DC to AC conversion approach. The direct DC to AC conversion approach is more efficient and operates without an intermediate dc-link stage. The absence of the dc-link, results in the elimination of bulky, aluminum electrolytic capacitors, which in turn leads to a reduction in the cost, volume, size and weight of the power electronic converter. The feasibility of two direct DC to AC converter topologies and their suitability to meet SECA objectives will be investigated. Laboratory proto-type converters (3-5kW) will be designed and tested in Phase-1. A detailed design trade-off study along with the test results will be available in the form of a report for the evaluation of SECA Industrial partners. This project proposes to develop a new and innovative power converter technology suitable for Solid Oxide Fuel Cell (SOFC) power systems in accordance with SECA objectives. The proposed fuel cell inverter (FCI) employs state of the art power electronic devices configured in two unique topologies to achieve direct conversion of DC power (24-48V) available from a SOFC to AC power (120/240V, 60Hz) suitable for utility interface and powering stand alone loads. The primary objective is to realize cost effective fuel cell converter, which operates under a wide input voltage range, and output load swings with high efficiency and improved reliability.

  7. SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: Fourth Results Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2013-01-01

    SunLine Transit Agency, which provides public transit services to the Coachella Valley area of California, has demonstrated hydrogen and fuel cell bus technologies for more than 10 years. In May 2010, SunLine began demonstrating the advanced technology (AT) fuel cell bus with a hybrid electric propulsion system, fuel cell power system, and lithium-based hybrid batteries. This report describes operations at SunLine for the AT fuel cell bus and five compressed natural gas buses. The U.S. Department of Energy's National Renewable Energy Laboratory (NREL) is working with SunLine to evaluate the bus in real-world service to document the results and help determine the progress toward technology readiness. NREL has previously published three reports documenting the operation of the fuel cell bus in service. This report provides a summary of the results with a focus on the bus operation from February 2012 through November 2012.

  8. SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: First Results Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2011-03-01

    This report describes operations at SunLine Transit Agency for their newest prototype fuel cell bus and five compressed natural gas (CNG) buses. In May 2010, SunLine began operating its sixth-generation hydrogen fueled bus, an Advanced Technology (AT) fuel cell bus that incorporates the latest design improvements to reduce weight and increase reliability and performance. The agency is collaborating with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) to evaluate the bus in revenue service. This report provides the early data results and implementation experience of the AT fuel cell bus since it was placed in service.

  9. Advanced Nuclear Fuel Cycle Transitions: Optimization, Modeling Choices, and Disruptions

    Science.gov (United States)

    Carlsen, Robert W.

    Many nuclear fuel cycle simulators have evolved over time to help understan the nuclear industry/ecosystem at a macroscopic level. Cyclus is one of th first fuel cycle simulators to accommodate larger-scale analysis with it liberal open-source licensing and first-class Linux support. Cyclus also ha features that uniquely enable investigating the effects of modeling choices o fuel cycle simulators and scenarios. This work is divided into thre experiments focusing on optimization, effects of modeling choices, and fue cycle uncertainty. Effective optimization techniques are developed for automatically determinin desirable facility deployment schedules with Cyclus. A novel method fo mapping optimization variables to deployment schedules is developed. Thi allows relationships between reactor types and scenario constraints to b represented implicitly in the variable definitions enabling the usage o optimizers lacking constraint support. It also prevents wasting computationa resources evaluating infeasible deployment schedules. Deployed power capacit over time and deployment of non-reactor facilities are also included a optimization variables There are many fuel cycle simulators built with different combinations o modeling choices. Comparing results between them is often difficult. Cyclus flexibility allows comparing effects of many such modeling choices. Reacto refueling cycle synchronization and inter-facility competition among othe effects are compared in four cases each using combinations of fleet of individually modeled reactors with 1-month or 3-month time steps. There are noticeable differences in results for the different cases. The larges differences occur during periods of constrained reactor fuel availability This and similar work can help improve the quality of fuel cycle analysi generally There is significant uncertainty associated deploying new nuclear technologie such as time-frames for technology availability and the cost of buildin advanced reactors

  10. Diffusion and Gas Conversion Analysis of Solid Oxide Fuel Cells at Loads via AC Impedance

    Directory of Open Access Journals (Sweden)

    Robert U. Payne

    2011-01-01

    Full Text Available Impedance measurements were conducted under practical load conditions in solid oxide fuel cells of differing sizes. For a 2 cm2 button cell, impedance spectra data were separately measured for the anode, cathode, and total cell. Improved equivalent circuit models are proposed and applied to simulate each of measured impedance data. Circuit elements related to the chemical and physical processes have been added to the total-cell model to account for an extra relaxation process in the spectra not measured at either electrode. The processes to which elements are attributed have been deduced by varying cell temperature, load current, and hydrogen concentration. Spectra data were also obtained for a planar stack of five 61 cm2 cells and the individual cells therein, which were fitted to a simplified equivalent circuit model of the total button cell. Similar to the button cell, the planar cells and stack exhibit a pronounced low-frequency relaxation process, which has been attributed to concentration losses, that is, the combined effects of diffusion and gas conversion. The simplified total-cell model approximates well the dynamic behavior of the SOFC cells and the whole stack.

  11. Fuel Cell Buses in U.S. Transit Fleets: Current Status 2012

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chander, K.; Gikakis, C.

    2012-11-01

    This report is the sixth in an annual series of reports that summarize the progress of fuel cell electric bus (FCEB) development in the United States and discuss the achievements and challenges of introducing fuel cell propulsion in transit. The report also provides a snapshot of current FCEB performance results over the last year. There are 25 active FCEBs in demonstrations this year at eight locations.

  12. Fuel Cell Transit Bus Evaluations: Joint Evaluation Plan for the U.S. Department of Energy and the Federal Transit Administration (Report and Appendix)

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2010-11-01

    This document describes the fuel cell transit bus evaluations performed by the National Renewable Energy Laboratory (NREL) and funded by the U.S. Department of Energy (DOE) and the U.S. Department of Transportation's Federal Transit Administration (FTA). This document provides a description of the demonstration sites, funding sources, and data collection activities for fuel cell transit bus evaluations currently planned from FY10 through FY12.

  13. Optimization analysis of the nuclear fuel cycle transition to the last core

    Energy Technology Data Exchange (ETDEWEB)

    Rebollo, L.; Blanco, J. [Union Fenosa Generacion, Madrid (Spain)

    2001-07-01

    The Zorita NPP was the first Spanish commercial nuclear reactor connected to the grid. It is a 160 MW one loop PWR, Westinghouse design, owned by UFG, in operation since 1968. The configuration of the reactor core is based on 69 fuel elements type 14 x 14, the standard reload of the present equilibrium cycle being based on 16 fuel elements with 3.6% enrichment in {sup 235}U. In order to properly plan the nuclear fuel management of the transition cycles to its end of life, presently foreseen by 2008, an based on the non-reprocessing option required by the policy of the Spanish Administration, a technical-economical optimization analysis has been performed. As a result, a fuel management strategy has been defined looking for getting simultaneously the minimum integral fuel cost of the transition from the present equilibrium cycle to the last core, as well as the minimum residual worth of the fuel remaining in the core after the final outage. Based on the ''lessons learned'' derived from the study, the time margin for the decision making has been determined, and a planning of the nuclear fuel supply for the transition reloads, specifying both the number of fuel elements and their enrichment in {sup 235}U, as been prepared. Finally, based on the calculated economical worth of the partially burned fuel of the last core, after the end of its operation cycle, a financial cover for yearly compensation from now on of the foreseen final lost has been elaborated. Most of the conceptual conclusions obtained are applicable to the other commercial nuclear reactors in operation owned by UFG, so that they are understood to be of general interest and broad application to commercial PWR. (author)

  14. Optimization analysis of the nuclear fuel cycle transition to the last core

    International Nuclear Information System (INIS)

    The Zorita NPP was the first Spanish commercial nuclear reactor connected to the grid. It is a 160 MW one loop PWR, Westinghouse design, owned by UFG, in operation since 1968. The configuration of the reactor core is based on 69 fuel elements type 14 x 14, the standard reload of the present equilibrium cycle being based on 16 fuel elements with 3.6% enrichment in 235U. In order to properly plan the nuclear fuel management of the transition cycles to its end of life, presently foreseen by 2008, an based on the non-reprocessing option required by the policy of the Spanish Administration, a technical-economical optimization analysis has been performed. As a result, a fuel management strategy has been defined looking for getting simultaneously the minimum integral fuel cost of the transition from the present equilibrium cycle to the last core, as well as the minimum residual worth of the fuel remaining in the core after the final outage. Based on the ''lessons learned'' derived from the study, the time margin for the decision making has been determined, and a planning of the nuclear fuel supply for the transition reloads, specifying both the number of fuel elements and their enrichment in 235U, as been prepared. Finally, based on the calculated economical worth of the partially burned fuel of the last core, after the end of its operation cycle, a financial cover for yearly compensation from now on of the foreseen final lost has been elaborated. Most of the conceptual conclusions obtained are applicable to the other commercial nuclear reactors in operation owned by UFG, so that they are understood to be of general interest and broad application to commercial PWR. (author)

  15. Proliferation resistant fuel cycle system for the transition from light water reactors to fast reactors

    International Nuclear Information System (INIS)

    Full text: Introduction of commercial fast reactors (FR) is predicted to start around 2050 in Japan. Effective utilization of plutonium in FR is important for the sustainable electricity generation by nuclear. Successive replacement of light water reactors (LWR) to FR will take more than 60-years and reasonable fuel cycle management is necessary during this period. The transition scenario has various unpredictable factors such as introduction speed and time of FR, and flexible fuel cycle system was proposed to respond to these factors. The system consists of LWR and FR spent fuels reprocessing for reduction of LWR spent fuel volume and FR fuel fabrication. LWR fuel reprocessing only carries out about 90% uranium removal from LWR spent fuel, then the composition of residual spent fuel called recycle material is about 50% uranium, 15% plutonium and 35% fission products + minor actinides. Recycle material is transferred to FR fuel reprocessing to recover plutonium and uranium followed by mixed oxide (MOX) fuel fabrication for FR with radioactive impurities. Depending on the introduction time of FR, recycle material (about 1/10 volume of original spent fuel) may be stored for future use. The system has some characteristics compared with ordinary system that consists of full reprocessing facilities for LWR and FR spent fuels to produce FR fresh fuels. The LWR reprocessing facility becomes much smaller due to no Pu-U recovery and fabrication. The recycle materials can supply higher content of plutonium to FR and be compactly stored in case of FR introduction delay. Plutonium always contains uranium and impurities (fission products and minor actinides), thus the system maintains high proliferation resistance. The plutonium balance was calculated under several conditions, which revealed that the system could supply enough and no excess plutonium to FR

  16. Comparative analysis of US and Canadian transit ridership response to rising fuel prices

    Energy Technology Data Exchange (ETDEWEB)

    Haire, A.R.; Machemeehl, R.B. [Texas Univ., Austin, TX (United States)

    2007-07-01

    Since worldwide gasoline prices have risen significantly over the last three years, several transit agencies have indicated that fuel price growth is the major impetus to increased transit ridership. This paper presented the results of a research project that builds upon previous research conducted in 2006 which found high correlation between fuel price and transit ridership in several historically auto-based United States cities. This comparative research attempted to determine whether a similar pattern of fuel cost-driven mode choice could be observed in three Canadian cities. The selected cities, Calgary, Ottawa, and Vancouver, were chosen based on their relative levels of auto-orientation and the extent and variety of transit services offered. It was concluded that although ridership and fuel prices grew in all three cities, the rates of growth do not correspond and correlation is unlikely. Reasons for this inconsistency with patterns in American cities may involve higher-density city layouts and commute distances. 3 refs., 3 tabs., 7 figs.

  17. Dynamic Analysis of Nuclear Waste Generation Based on Nuclear Fuel Cycle Transition Scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, S. R. [University of Science and Technology, Daejeon (Korea, Republic of); Ko, W. I. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    According to the recommendations submitted by the Public Engagement Commission on Spent Nuclear Fuel Management (PECOS), the government was advised to pick the site for an underground laboratory and interim storage facilities before the end of 2020 followed by the related research for permanent and underground disposal of spent fuel after 10 years. In the middle of the main issues, the factors of environmentally friendly and safe way to handle nuclear waste are inextricable from nuclear power generating nation to ensure the sustainability of nuclear power. For this purposes, the closed nuclear fuel cycle has been developed regarding deep geological disposal, pyroprocessing, and burner type sodium-cooled fast reactors (SFRs) in Korea. Among two methods of an equilibrium model and a dynamic model generally used for screening nuclear fuel cycle system, the dynamic model is more appropriate to envisage country-specific environment with the transition phase in the long term and significant to estimate meaningful impacts based on the timedependent behavior of harmful wastes. This study aims at analyzing the spent nuclear fuel generation based on the long-term nuclear fuel cycle transition scenarios considered at up-to-date country specific conditions and comparing long term advantages of the developed nuclear fuel cycle option between once-through cycle and Pyro-SFR cycle. In this study, a dynamic analysis was carried out to estimate the long-term projection of nuclear electricity generation, installed capacity, spent nuclear fuel arising in different fuel cycle scenarios based on the up-to-date national energy plans.

  18. Flame spread over electrical wire with AC electric fields: Internal circulation, fuel vapor-jet, spread rate acceleration, and molten insulator dripping

    KAUST Repository

    Lim, Seungjae

    2015-04-01

    The effect of electric field on the characteristics of flame spread along a polyethylene (PE) insulated electrical wire was investigated experimentally by varying the AC frequency and voltage applied to the wire. The results showed that the flame spread rate was accelerated due to the convergence of electric flux near the end of wire, having three distinct regimes depending on applied voltage. In each regime, several subregimes could be identified depending on AC frequency. Flame shape (height and width) and slanted direction of the spreading flame were influenced differently. Fuel-vapor jets were ejected from the molten PE surface even for the baseline case without the application of an electric field; this could be attributed to the bursting of fuel vapor bubbles generated from internal boiling at the molten PE surface. An internal circulation of molten-PE was also observed as a result of non-uniform heating by the spreading flame. In the high voltage regime with a high AC frequency, excessive dripping of molten PE led to flame extinction.

  19. SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: Third Results Reports

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2012-05-01

    This report describes operations at SunLine Transit Agency for their newest prototype fuel cell bus and five compressed natural gas (CNG) buses. In May 2010, SunLine began operating its sixth-generation hydrogen fueled bus, an Advanced Technology (AT) fuel cell bus that incorporates the latest design improvements to reduce weight and increase reliability and performance. The agency is collaborating with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) to evaluate the bus in revenue service. NREL has previously published two reports documenting the operation of the fuel cell bus in service. This report provides a summary of the results with a focus on the bus operation from July 2011 through January 2012.

  20. SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: Second Results Report and Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2011-10-01

    This report describes operations at SunLine Transit Agency for their newest prototype fuel cell bus and five compressed natural gas (CNG) buses. In May 2010, SunLine began operating its sixth-generation hydrogen fueled bus, an Advanced Technology (AT) fuel cell bus that incorporates the latest design improvements to reduce weight and increase reliability and performance. The agency is collaborating with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) to evaluate the bus in revenue service. This is the second results report for the AT fuel cell bus since it was placed in service, and it focuses on the newest data analysis and lessons learned since the previous report. The appendices, referenced in the main report, provide the full background for the evaluation. They will be updated as new information is collected but will contain the original background material from the first report.

  1. Timing is everything : along the fossil fuel transition pathway.

    Energy Technology Data Exchange (ETDEWEB)

    Kobos, Peter Holmes; Walker, La Tonya Nicole; Malczynski, Leonard A.

    2013-10-01

    People save for retirement throughout their career because it is virtually impossible to save all you'll need in retirement the year before you retire. Similarly, without installing incremental amounts of clean fossil, renewable or transformative energy technologies throughout the coming decades, a radical and immediate change will be near impossible the year before a policy goal is set to be in place. Therefore, our research question is,To meet our desired technical and policy goals, what are the factors that affect the rate we must install technology to achieve these goals in the coming decades?' Existing models do not include full regulatory constraints due to their often complex, and inflexible approaches to solve foroptimal' engineering instead ofrobust' and multidisciplinary solutions. This project outlines the theory and then develops an applied software tool to model the laboratory-to-market transition using the traditional technology readiness level (TRL) framework, but develops subsequent and a novel regulatory readiness level (RRL) and market readiness level (MRL). This tool uses the ideally-suited system dynamics framework to incorporate feedbacks and time delays. Future energy-economic-environment models, regardless of their programming platform, may adapt this software model component framework ormodule' to further vet the likelihood of new or innovative technology moving through the laboratory, regulatory and market space. The prototype analytical framework and tool, called the Technology, Regulatory and Market Readiness Level simulation model (TRMsim) illustrates the interaction between technology research, application, policy and market dynamics as they relate to a new or innovative technology moving from the theoretical stage to full market deployment. The initial results that illustrate the model's capabilities indicate for a hypothetical technology, that increasing the key driver

  2. Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration Results. Fourth Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, Leslie [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2015-07-02

    This report presents results of a demonstration of fuel cell electric buses (FCEB) operating in Oakland, California. Alameda-Contra Costa Transit District (AC Transit) leads the Zero Emission Bay Area (ZEBA) demonstration, which includes 12 advanced-design fuel cell buses and two hydrogen fueling stations. The FCEBs in service at AC Transit are 40-foot, low-floor buses built by Van Hool with a hybrid electric propulsion system that includes a US Hybrid fuel cell power system and EnerDel lithium-based energy storage system. The buses began revenue service in May 2010.

  3. Simulations of the Fuel Economy and Emissions of Hybrid Transit Buses over Planned Local Routes

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Zhiming [ORNL; LaClair, Tim J [ORNL; Daw, C Stuart [ORNL; Smith, David E [ORNL; Franzese, Oscar [ORNL

    2014-01-01

    We present simulated fuel economy and emissions city transit buses powered by conventional diesel engines and diesel-hybrid electric powertrains of varying size. Six representative city drive cycles were included in the study. In addition, we included previously published aftertreatment device models for control of CO, HC, NOx, and particulate matter (PM) emissions. Our results reveal that bus hybridization can significantly enhance fuel economy by reducing engine idling time, reducing demands for accessory loads, exploiting regenerative braking, and shifting engine operation to speeds and loads with higher fuel efficiency. Increased hybridization also tends to monotonically reduce engine-out emissions, but trends in the tailpipe (post-aftertreatment) emissions involve more complex interactions that significantly depend on motor size and drive cycle details.

  4. The transition to hydrogen as a transportation fuel: Costs and infrastructure requirements

    Energy Technology Data Exchange (ETDEWEB)

    Schock, R.N.; Berry, G.D.; Ramback, G.D.; Smith, J.R.

    1996-03-20

    Hydrogen fuel, used in an internal combustion engine optimized for maximum efficiency and as part of a hybrid-electric vehicle, will give excellent performance and range with emissions below one-tenth the ultra-low emission vehicle standards being considered in California as Equivalent Zero Emission Vehicles. These vehicles can also be manufactured with increased but not excessive cost. Hydrogen-fueled engines have demonstrated indicated efficiencies of more than 50% under lean operation. Combining optimized engines and other advanced components, the overall vehicle efficiency should approach 40%, compared with 13% for a conventional vehicle in the urban driving cycle. The optimized engine-generator unit is the mechanical equivalent of the fuel cell but at a cost competitive with today`s engines. The increased efficiency of hybrid-electric vehicles now makes hydrogen fuel competitive with today`s conventional vehicles. Conservative analysis of the infrastructure options to support a transition to a hydrogen-fueled light-duty fleet indicates that hydrogen may be utilized at a total cost comparable to the 3.1 cents/km U.S. vehicle operators pay today while using conventional automobiles. Both on-site production by electrolysis or reforming of natural gas and liquid hydrogen distribution offer the possibility of a smooth transition by taking advantage of existing large-scale energy infrastructures. Eventually, renewable sources of electricity and scalable methods of making hydrogen will have lower costs than today. With a hybrid-electric propulsion system, the infrastructure to supply hydrogen and the vehicles to use it can be developed today and thus be in place when fuel cells become economical for vehicle use.

  5. Solar Electricity and Solar Fuels: Status and Perspectives in the Context of the Energy Transition.

    Science.gov (United States)

    Armaroli, Nicola; Balzani, Vincenzo

    2016-01-01

    The energy transition from fossil fuels to renewables is already ongoing, but it will be a long and difficult process because the energy system is a gigantic and complex machine. Key renewable energy production data show the remarkable growth of solar electricity technologies and indicate that crystalline silicon photovoltaics (PV) and wind turbines are the workhorses of the first wave of renewable energy deployment on the TW scale around the globe. The other PV alternatives (e.g., copper/indium/gallium/selenide (CIGS) or CdTe), along with other less mature options, are critically analyzed. As far as fuels are concerned, the situation is significantly more complex because making chemicals with sunshine is far more complicated than generating electric current. The prime solar artificial fuel is molecular hydrogen, which is characterized by an excellent combination of chemical and physical properties. The routes to make it from solar energy (photoelectrochemical cells (PEC), dye-sensitized photoelectrochemical cells (DSPEC), PV electrolyzers) and then synthetic liquid fuels are presented, with discussion on economic aspects. The interconversion between electricity and hydrogen, two energy carriers directly produced by sunlight, will be a key tool to distribute renewable energies with the highest flexibility. The discussion takes into account two concepts that are often overlooked: the energy return on investment (EROI) and the limited availability of natural resources-particularly minerals-which are needed to manufacture energy converters and storage devices on a multi-TW scale. PMID:26584653

  6. Solar Electricity and Solar Fuels: Status and Perspectives in the Context of the Energy Transition.

    Science.gov (United States)

    Armaroli, Nicola; Balzani, Vincenzo

    2016-01-01

    The energy transition from fossil fuels to renewables is already ongoing, but it will be a long and difficult process because the energy system is a gigantic and complex machine. Key renewable energy production data show the remarkable growth of solar electricity technologies and indicate that crystalline silicon photovoltaics (PV) and wind turbines are the workhorses of the first wave of renewable energy deployment on the TW scale around the globe. The other PV alternatives (e.g., copper/indium/gallium/selenide (CIGS) or CdTe), along with other less mature options, are critically analyzed. As far as fuels are concerned, the situation is significantly more complex because making chemicals with sunshine is far more complicated than generating electric current. The prime solar artificial fuel is molecular hydrogen, which is characterized by an excellent combination of chemical and physical properties. The routes to make it from solar energy (photoelectrochemical cells (PEC), dye-sensitized photoelectrochemical cells (DSPEC), PV electrolyzers) and then synthetic liquid fuels are presented, with discussion on economic aspects. The interconversion between electricity and hydrogen, two energy carriers directly produced by sunlight, will be a key tool to distribute renewable energies with the highest flexibility. The discussion takes into account two concepts that are often overlooked: the energy return on investment (EROI) and the limited availability of natural resources-particularly minerals-which are needed to manufacture energy converters and storage devices on a multi-TW scale.

  7. Droplet entrainment and deposition rate models for determination of boiling transition in BWR fuel assembly

    International Nuclear Information System (INIS)

    Droplet entrainment and deposition rates are of vital importance for mechanistic determination of critical power and location of boiling transition in a BWR fuel assembly. Data from high-pressure, high-temperature steam-water adiabatic experiments conducted in very tall test sections are used to develop a combination of equilibrium entrainment-deposition rate. Application of this combination to the heated tests conducted in a shorter test section of typical height of a BWR fuel assembly shows that correct split of total liquid in form of the film and droplets at the onset of annular-mist flow regime is also important to obtain good prediction of film flow rates/entrainment fraction. The improved model is then applied to simulate critical power tests in annulus and rod bundles. (author)

  8. Cost Probability Analysis of China's Nuclear Fuel Cycle Transition

    International Nuclear Information System (INIS)

    The Chinese government has already determined to develop the closed nuclear fuel cycle, its long-term roadmap of spent fuel management has not been decided yet. Currently, it seems that China's booming economy gives abundant financial assurance to develop nuclear programs in full play according to its near-term national plans. However, the viability and sustainability of nuclear power always depends critically on its economics. Therefore, it is necessary to conduct a well focused cost-benefit and objective analysis of China's ongoing nuclear power programs with the future prospects. In this study, we conduct a comparative analysis of electricity generation cost in four reference nuclear fuel cycle transition scenarios by 2050. Direct disposal is assumed to produce the cheapest LCT as low as 62.688 mills/kWh compared to the other options. However, after performing a relative uncertainty study, the results show that the capital cost of reactor is the key cost component which leads to the cost gap

  9. Transition from ignition to flame spread over thick fuels in a simulated microgravity environment

    Science.gov (United States)

    Wang, Shuangfeng; Lu, Zhanbin

    Ignition of solid fuels and subsequent transition to flame spread is of fundamental interest and practical importance for spacecraft fire safety. Most previous reseach on microgravity flame spread has involved purely opposed or purely concurrent flow, i.e. ignition occurs at one end of the fuel sample. In this study, a narrow channel apparatus is employed to investigate the phenomenon of flame spread over a thermally thick PMMA sheet in narrow gaps that essentially suppress buoyancy and produce a low-gravity flame spread environment. The ignition is initiated in the middle of the sample, and the focus is to determine the effects of atmosphere oxygen concentration and flow velocity on flame spread behavior in microgravity. Experimental results show that a single flame propagates upstream when oxygen concentration and flow velocity are relatively low. As oxygen and flow velocity are increased to levels high enough, however, the flame may propagate upstream and also downstream. Based on oxygen side diffusion, oxygen shadowing, and fuel depletion effect, the various observed flame behaviors are explained.

  10. Cost Probability Analysis of China's Nuclear Fuel Cycle Transition

    Energy Technology Data Exchange (ETDEWEB)

    Gao, R. X. [Univ. of Science and Technology, Daejeon (Korea, Republic of); Ko, W. I.; Lee, S. H. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    The Chinese government has already determined to develop the closed nuclear fuel cycle, its long-term roadmap of spent fuel management has not been decided yet. Currently, it seems that China's booming economy gives abundant financial assurance to develop nuclear programs in full play according to its near-term national plans. However, the viability and sustainability of nuclear power always depends critically on its economics. Therefore, it is necessary to conduct a well focused cost-benefit and objective analysis of China's ongoing nuclear power programs with the future prospects. In this study, we conduct a comparative analysis of electricity generation cost in four reference nuclear fuel cycle transition scenarios by 2050. Direct disposal is assumed to produce the cheapest LCT as low as 62.688 mills/kWh compared to the other options. However, after performing a relative uncertainty study, the results show that the capital cost of reactor is the key cost component which leads to the cost gap.

  11. High temperature phase transitions in nuclear fuels of the fourth generation

    International Nuclear Information System (INIS)

    Understanding the behaviour of nuclear materials in extreme conditions is of prime importance for the analysis of the operation limits of nuclear fuels, and prediction of possible nuclear reactor accidents, relevant to the general objectives of nuclear safety research. The main purpose of this thesis is the study of high temperature phase transitions in nuclear materials, with special attention to the candidate fuel materials for the reactors of the 4. Generation. In this framework, material properties need to be investigated at temperatures higher than 2500 K, where equilibrium conditions are difficult to obtain. Laser heating combined with fast pyrometer is the method used at the European Institute for Transuranium Elements (JRC - ITU). It is associated to a novel process used to determine phase transitions, based on the detection, via a suited low-power (mW) probe laser, of changes in surface reflectivity that may accompany solid/liquid phase transitions. Fast thermal cycles, from a few ms up to the second, under almost container-free conditions and control atmosphere narrow the problem of vaporisation and sample interactions usually meet with traditional method. This new experimental approach has led to very interesting results. It confirmed earlier research for material systems known to be stable at high temperature (such as U-C) and allowed a refinement of the corresponding phase diagrams. But it was also feasible to apply this method to materials highly reactive, thus original results are presented on PuO2, NpO2, UO2-PuO2 and Pu-C systems. (author)

  12. Technical Approach and Plan for Transitioning Spent Nuclear Fuel (SNF) Project Facilities to the Environmental Restoration Program

    International Nuclear Information System (INIS)

    This document describes the approach and process in which the 100-K Area Facilities are to be deactivated and transitioned over to the Environmental Restoration Program after spent nuclear fuel has been removed from the K Basins. It describes the Transition Project's scope and objectives, work breakdown structure, activity planning, estimated cost, and schedule. This report will be utilized as a planning document for project management and control and to communicate details of project content and integration

  13. Technical Approach and Plan for Transitioning Spent Nuclear Fuel (SNF) Project Facilities to the Environmental Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    SKELLY, W.A.

    1999-10-06

    This document describes the approach and process in which the 100-K Area Facilities are to be deactivated and transitioned over to the Environmental Restoration Program after spent nuclear fuel has been removed from the K Basins. It describes the Transition Project's scope and objectives, work breakdown structure, activity planning, estimated cost, and schedule. This report will be utilized as a planning document for project management and control and to communicate details of project content and integration.

  14. Storage Free Smart Energy Management for Frequency Control in a Diesel-PV-Fuel Cell-Based Hybrid AC Microgrid.

    Science.gov (United States)

    Sekhar, P C; Mishra, S

    2016-08-01

    This paper proposes a novel, smart energy management scheme for a microgrid, consisting of a diesel generator and power electronic converter interfaced renewable energy-based generators, such as photovoltaic (PV) and fuel cell, for frequency regulation without any storage. In the proposed strategy, output of the PV is controlled in coordination with other generators using neurofuzzy controller, either only for transient frequency regulation or for both transient and steady-state frequency regulation, depending on the load demand, thereby eliminating the huge storage requirements. The option of demand response control is also explored along with the generation control. For accurate and quick tracking of maximum power point and its associated reserve power from the PV generator, this paper also proposes a novel adaptive-predictor-corrector-based tracking mechanism. PMID:26011895

  15. Prediction of Emissions from Biodiesel Fueled Transit Buses Using Artificial Neural Networks

    Directory of Open Access Journals (Sweden)

    Abhisek Mudgal

    2011-06-01

    Full Text Available The growing demand of freight transportation and passenger cars has led to air pollution, green house gas emissions (especially CO2 and fuel supply concerns. Research has been carried out on biodiesel which is shown to generate lower emissions. However, the amount of emissions generated is not well understood which entails more vigorous data collection and development of emissions models. A comprehensive data collection plan was developed and emissions (NOx, HC, CO, CO2 and PM10 from biodiesel fueled transit buses were collected using a portable emissions measurement system (PEMS. Linear models were developed and tested for each emission. However, the models could not capture the emissions spikes well resulting in very low R2 values. Artificial neural networks (ANNs based models were then employed on this data because of their ability to handle nonlinearity and not requiring assumptions on the input data as needed by statistical models. Sensitivity analysis was performed on the input parameters, number of hidden layers, learning rate and learning algorithm to arrive at an optimum ANN architecture. The optimal architecture for this study was found to be two hidden layers with 50 hidden nodes for each of NOx, HC, CO, and PM and one hidden layer for CO2. The emissions were predicted using best-performance ANN models for each emission. Scatter-plots of observed versus predicted values showed R2 of 0.96, 0.94, 0.82, 0.98 and 0.78 for NOx, HC, CO, CO2 and PM emissions, respectively. Histogram on prediction error showed low frequency for large errors.

  16. Public perception related to a hydrogen hybrid internal combustion engine transit bus demonstration and hydrogen fuel

    International Nuclear Information System (INIS)

    Hydrogen has been widely considered as a potentially viable alternative to fossil fuels for use in transportation. In addition to price competitiveness with fossil fuels, a key to its adoption will be public perceptions of hydrogen technologies and hydrogen fuel. This paper examines public perceptions of riders of a hydrogen hybrid internal combustion engine bus and hydrogen as a fuel source

  17. Fuel poverty is facing a data challenge - Which strategies to struggle against fuel poverty? Propositions for an ecologic and social transition policy

    International Nuclear Information System (INIS)

    The authors address three main questions: how are structured the network of actors and the tools for the struggle against fuel poverty, what are the specific data challenges faced by the actors and the possible responses, and which lessons can be learned for the governance of energy transition in its whole. After a presentation of the context of fuel poverty (analysis of tools for the struggle against fuel poverty, the use of social-energetic data), this study, based on about forty interviews of various actors and on a workshop, proposes an analysis framework which distinguishes six steps in the definition and implementation of policies of struggle against fuel poverty. After a description of the current status and an identification of required improvements for each step, the authors propose a set of recommendations, draw lessons for urban policies aimed at an ecologic transformation and a modernisation of the social protection system in terms of level of intervention, scope of actions, and ownership and access to data bases. These recommendations more particularly address the definition of fuel poverty, its diagnosis at the national and at the territorial level, a better identification of concerned households, and an assessment of existing arrangements

  18. Critical factors in transitioning from fuel cell to cold fusion technology

    International Nuclear Information System (INIS)

    The fuel cell industry possesses much of the required manufacturing equipment and knowledge-base (e.g., proton conduction and hydrogen safety) necessary to develop cold fusion systems. Key factors in making a transition to cold fusion technology are discussed. Loading of reaction material can be provided by electrolytic charging and high gas over-pressure. Effective pressures over 10,000 atmospheres are required in cold fusion systems, giving a loading of H/M = 1; and a combination of loading methods is highly desirable. Systems must be designed to provide continuous flow of hydrogen ions (muchgt1017/sec for ten kilowatts), with an input power source of 50 watts (est.). Cold fusion experiments have shown that helium is formed during the reaction, and physical changes occur in the reaction material. These revelations impact design and operation of cold fusion systems, as the reaction material must be replaced periodically, while the systems must maintain integrity during operation. Safety and cost are also highly important considerations

  19. Green trucks: transitioning the freight truck industry to low and zero emission fuel systems

    OpenAIRE

    Kalthoff, Jarrett Reid

    2012-01-01

    The freight truck industry in Canada is the lifeblood of many communities throughout the country. These communities rely upon overland freight for everything from food to fuel. The continued operation of this industry is fundamentally dependent on the consumption of fossil fuels. This dependence leads to two challenges facing the freight industry: (1) fossil fuels are expensive, finite resources that are prone to dramatic surges in price; and, (2) the consumption and combustion of fossil fuel...

  20. Heating of the fuel mixture due to viscous stress ahead of accelerating flames in deflagration-to-detonation transition

    OpenAIRE

    Valiev, Damir; Bychkov, Vitaly; Akkerman, V'yacheslav; Eriksson, Lars-Erik; Marklund, Mattias

    2008-01-01

    The role of viscous stress in heating of the fuel mixture in deflagration-to-detonation transition in tubes is studied both analytically and numerically. The analytical theory is developed in the limit of low Mach number; it determines temperature distribution ahead of an accelerating flame with maximum achieved at the walls. The heating effects of viscous stress and the compression wave become comparable at sufficiently high values of the Mach number. In the case of relatively large Mach num...

  1. Nuclear Energy R&D Imperative 3: Enable a Transition Away from Fossil Fuel in the Transportation and Industrial Sectors

    Energy Technology Data Exchange (ETDEWEB)

    David Petti; J. Stephen Herring

    2010-03-01

    As described in the Department of Energy Office of Nuclear Energy’s Nuclear Energy R&D Roadmap, nuclear energy can play a significant role in supplying energy for a growing economy while reducing both our dependence on foreign energy supplies and emissions from the burning of fossil fuels. The industrial and transportation sectors are responsible for more than half of the greenhouse gas emissions in the U.S., and imported oil supplies 70% of the energy used in the transportation sector. It is therefore important to examine the various ways nuclear energy can facilitate a transition away from fossil fuels to secure environmentally sustainable production and use of energy in the transportation and manufacturing industry sectors. Imperative 3 of the Nuclear Energy R&D Roadmap, entitled “Enable a Transition Away from Fossil Fuels by Producing Process Heat for use in the Transportation and Industrial Sectors”, addresses this need. This document presents an Implementation Plan for R&D efforts related to this imperative. The expanded use of nuclear energy beyond the electrical grid will contribute significantly to overcoming the three inter-linked energy challenges facing U.S. industry: the rising and volatile prices for premium fossil fuels such as oil and natural gas, dependence on foreign sources for these fuels, and the risks of climate change resulting from carbon emissions. Nuclear energy could be used in the industrial and transportation sectors to: • Generate high temperature process heat and electricity to serve industrial needs including the production of chemical feedstocks for use in manufacturing premium fuels and fertilizer products, • Produce hydrogen for industrial processes and transportation fuels, and • Provide clean water for human consumption by desalination and promote wastewater treatment using low-grade nuclear heat as a useful additional benefit. Opening new avenues for nuclear energy will significantly enhance our nation’s energy

  2. Energy access and transition to cleaner cooking fuels and technologies in Sri Lanka: Issues and policy limitations

    International Nuclear Information System (INIS)

    Easy energy access is a trigger for human, social, and economic development. A research project was undertaken in Sri Lanka to broaden the understanding of human dimension of energy access and technologies. A questionnaire survey, covering 2269 households, gathered data on socio-economic contexts and issues influencing a transition towards clean cooking facilities. The findings reveal that the transition is impeded by four factors: the lack of motivation and the pressure for switching over to cleaner facilities, the lack of modern energy technology options, the financial risks, and the lack of financing and other support. The paper describes the delicate two-way interrelation between women earning wages and the transitions to cleaner cooking fuels and technologies. The findings suggest the need for a policy framework involving the stakeholders, financing and standardised technologies. To make a change it is proposed to introduce a national, integrated policy incorporating financing and energy governance. - Highlights: ► Households in Sri Lanka lack access to modern energy technology options for cooking. ► Cooking with fuel wood and residues is the norm in Sri Lanka, particularly in rural households. ► A survey of rural households revealed that most cannot afford to switch to cleaner cooking options. ► Most households have little awareness of the health impacts of biomass cooking. ► Women in regular formal employment are more likely to value cleaner cooking options that save time.

  3. Heating of the fuel mixture due to viscous stress ahead of accelerating flames in deflagration-to-detonation transition

    CERN Document Server

    Valiev, Damir; Akkerman, V'yacheslav; Eriksson, Lars-Erik; Marklund, Mattias

    2008-01-01

    The role of viscous stress in heating of the fuel mixture in deflagration-to-detonation transition in tubes is studied both analytically and numerically. The analytical theory is developed in the limit of low Mach number; it determines temperature distribution ahead of an accelerating flame with maximum achieved at the walls. The heating effects of viscous stress and the compression wave become comparable at sufficiently high values of the Mach number. In the case of relatively large Mach number, viscous heating is investigated by direct numerical simulations. The simulations were performed on the basis of compressible Navier-Stokes gas-dynamic equations taking into account chemical kinetics. In agreement with the theory, viscous stress makes heating and explosion of the fuel mixture preferential at the walls. The explosion develops in an essentially multi-dimensional way, with fast spontaneous reaction spreading along the walls and pushing inclined shocks. Eventually, the combination of explosive reaction an...

  4. Fuel Pellets from Wheat Straw: The Effect of Lignin Glass Transition and Surface Waxes on Pelletizing Properties

    DEFF Research Database (Denmark)

    Stelte, Wolfgang; Clemons, Craig; Holm, Jens K.;

    2012-01-01

    and a high concentration of hydrophobic waxes on its outer surface that may limit the pellet strength. The present work studies the impact of the lignin glass transition on the pelletizing properties of wheat straw. Furthermore, the effect of surface waxes on the pelletizing process and pellet strength....... Pellets are pressed from wheat straw and straw where the waxes have been extracted from. Two pelletizing temperatures were chosen—one below and one above the glass transition temperature of lignin. The pellets compression strength, density, and fracture surface were compared to each other. Pellets pressed...... no such effect is observed at elevated temperatures. Fuel pellets made from extracted wheat straw have a slightly higher compression strength which might be explained by a better interparticle adhesion in the absence of hydrophobic surface waxes....

  5. Fast breeder reactor core concept consistent with fuel cycle system during the transition period from LWR to FBR cycles in Japan

    International Nuclear Information System (INIS)

    During the transition period from the LWR cycle to a FBR cycle, the Pu needed for FBR start-up will be obtained from the next reprocessing facility. Therefore, from the economic viewpoint, it would be better if the FBR core in the next reprocessing facility had a lower Pu inventory. A design concept study was carried out for an FBR core with a lower Pu inventory that is consistent with the fuel cycle system during the transition period. The Pu from LWR spent fuel will be used for FBR start-up at least for the initial core cycle and succeeding first few cycles during the transition period. An FBR core loaded with Pu from LWR spent fuel has higher burnup reactivity than one loaded with Pu from FBR multi-recycling fuel composition. The increased burnup reactivity may reduce the cycle length of the FBR core. We chose loading of minor actinides (MAs) into the FBR MOX fuel as the countermeasure to the increased burnup reactivity from the viewpoint of utilizing nuclear characteristics of the MAs. The maximum MA content in the MOX fuel was set to 5% on the basis of irradiation test results. MAs recovered from the LWR spent fuel that provides Pu for FBR start-up are loaded into the initial loading fuel assemblies and exchanged fuel assemblies for several cycles until equilibriumis reached. The average MA content of the initially loaded fuel was assumed to be 3%, and that of the exchanged fuel was assumed to be 5%. The core performance including burnup characteristics and reactivity coefficient were also evaluated, and it was confirmed that the transient core from the initial loading until the equilibrium cycle for loaded Pu from LWR spent fuels could maintain performance neary equal to that of an FBR multi-recycling core. (author)

  6. 78 FR 29519 - Physical Protection of Irradiated Reactor Fuel in Transit

    Science.gov (United States)

    2013-05-20

    ... shipments of naval SNF under the Naval Nuclear Propulsion Program and highway shipment of classified... Measures for the Transportation of Spent Nuclear Fuel Greater than 100 Grams,'' (67 FR 63167; October 10... Register (44 FR 34466) an interim final rule that established requirements for the physical protection...

  7. Phase transition between the Bragg Glass and a disordered Phase in Nb3Sn, detected by 3rd harmonics of the AC magnetic susceptibility

    OpenAIRE

    Adesso, Maria G.; Uglietti, Davide; Flukiger, Rene; Polichetti, Massimiliano; Pace, Sandro

    2005-01-01

    We report additional experimental evidences about the presence of an universal behavior in the Field-Temperature Phase Diagram of Type II Superconductors. This behavior is characterized by a phase transition in the vortex matter between the disordered and the Bragg Glass phase. The experimental detection of a Peak Effect phenomenon has been proved to be strictly connected to the existence of this phase transition. In this paper, we show the first observation of a Peak Effect in the compound N...

  8. Technical Breakthrough Points and Opportunities in Transition Scenarios for Hydrogen as Vehicular Fuel

    Energy Technology Data Exchange (ETDEWEB)

    Diakov, V.; Ruth, M.; James, B.; Perez, J.; Spisak, A.

    2011-12-01

    This technical reports is about investigating a generic case of hydrogen production/delivery/dispensing pathway evolution in a large population city, assuming that hydrogen fuel cell electric vehicles (FCEV) will capture a major share of the vehicle market by the year 2050. The range of questions that are considered includes (i) what is the typical succession of hydrogen pathways that minimizes consumer cost? (ii) what are the major factors that will likely influence this sequence?

  9. Fire Behavior Modeling - Experiment on Surface Fire Transition to the Elevated Live Fuel

    OpenAIRE

    Omodan, Sunday

    2015-01-01

    ABSTRCT OF THE THESISFire Behavior Modeling - Experiment on Surface Fire Transition to the Elevated Live Fuelby Sunday OmodanMaster of Science, Graduate Program in Mechanical EngineeringUniversity of California, Riverside, June 2015Dr. Marko Princevac, ChairpersonRecent increase in the number of wildfires globally over the last decade has made fire behavior modelling a major subject of scientific concern. Although, there have been wildfire studies since the beginning of 19th century, and thi...

  10. Synthesis and characterization of new ternary transition metal sulfide anodes for H 2S-powered solid oxide fuel cell

    Science.gov (United States)

    Vorontsov, V.; Luo, J. L.; Sanger, A. R.; Chuang, K. T.

    A number of ternary transition metal sulfides with general composition AB 2S 4 (where A and B are different transition metal atoms) have been prepared and investigated as potential anode catalysts for use in H 2S-powered solid oxide fuel cells (SOFCs). For the initial screening, polarization resistance of the materials was measured in a two electrode symmetrical cell at 700-850 °C. Vanadium-based materials showed the lowest polarization resistance, and so were chosen for subsequent full cell tests using the configuration [H 2S, AV 2S 4/YSZ/Pt, air] (where A = Ni, Cr, Mo). MoV 2S 4 anode had superior activity and performance in the full cell setup, consistent with results from symmetrical cell tests. Polarization curves showed MoV 2S 4 had the lowest potential drop, with up to a 200 mA cm -2 current density at 800 °C. The highest power density of ca. 275 mW cm -2 at 800 °C was obtained with a pure H 2S stream. Polarization resistance of materials was a strong function of current density, and showed a sharp change of slope attributable to a change in the rate-limiting step of the anode reaction mechanism. MoV 2S 4 was chemically stable during prolonged (10 days) exposure to H 2S at 850 °C, and fuel cell performance was stable during continuous 3-day operation at 370 mA cm -2 current density.

  11. Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration Results: Fifth Report

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, Leslie [National Renewable Energy Lab. (NREL), Golden, CO (United States); Post, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jeffers, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2016-06-01

    This report presents results of a demonstration of fuel cell electric buses (FCEB) operating in Oakland, California. Alameda-Contra Costa Transit District (AC Transit) leads the Zero Emission Bay Area (ZEBA) demonstration, which includes 13 advanced-design fuel cell buses and two hydrogen fueling stations. The ZEBA partners are collaborating with the U.S. Department of Energy (DOE) and DOE's National Renewable Energy Laboratory (NREL) to evaluate the buses in revenue service. NREL has published four previous reports describing operation of these buses. This report presents new and updated results covering data from January 2015 through December 2015.

  12. Zero Emission Bay Area (ZEBA) Fuel Cell Bus Demonstration: First Results Report

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2011-08-01

    This report documents the early implementation experience for the Zero Emission Bay Area (ZEBA) Demonstration, the largest fleet of fuel cell buses in the United States. The ZEBA Demonstration group includes five participating transit agencies: AC Transit (lead transit agency), Santa Clara Valley Transportation Authority (VTA), Golden Gate Transit (GGT), San Mateo County Transit District (SamTrans), and San Francisco Municipal Railway (Muni). The ZEBA partners are collaborating with the U.S. Department of Energy (DOE) and DOE's National Renewable Energy Laboratory (NREL) to evaluate the buses in revenue service.

  13. Mechanisms of disease: epithelial-mesenchymal transition and back again: does cellular plasticity fuel neoplastic progression?

    Energy Technology Data Exchange (ETDEWEB)

    Bissell, Mina J; Turley, Eva A.; Veiseh, Mandana; Radisky, Derek C.; Bissell, Mina J.

    2008-02-13

    Epithelial-mesenchymal transition (EMT) is a conversion that facilitates organ morphogenesis and tissue remodeling in physiological processes such as embryonic development and wound healing. A similar phenotypic conversion is also detected in fibrotic diseases and neoplasia, which is associated with disease progression. EMT in cancer epithelial cells often seems to be an incomplete and bi-directional process. In this Review, we discuss the phenomenon of EMT as it pertains to tumor development, focusing on exceptions to the commonly held rule that EMT promotes invasion and metastasis. We also highlight the role of the RAS-controlled signaling mediators, ERK1, ERK2 and PI3-kinase, as microenvironmental responsive regulators of EMT.

  14. Durable transition-metal-carbide-supported Pt-Ru anodes for direct methanol fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Nishanth, K.G.; Sridhar, P.; Pitchumani, S. [CSIR-Central Electrochemical Research Institute, Madras Unit, CSIR Madras Complex, Chennai (India); Shukla, A.K. [Solid State and Structural Chemistry Unit, Indian Institute of Science, Bangalore (India)

    2012-02-15

    Molybdenum carbide (MoC) and tungsten carbide (WC) are synthesized by direct carbonization method. Pt-Ru catalysts supported on MoC, WC, and Vulcan XC-72R are prepared, and characterized by X-ray diffraction, X-ray photoelectron spectroscopy, and transmission electron microscopy in conjunction with electrochemistry. Electrochemical activities for the catalysts towards methanol electro-oxidation are studied by cyclic voltammetry. All the electro-catalysts are subjected to accelerated durability test (ADT). The electrochemical activity of carbide-supported electro-catalysts towards methanol electro-oxidation is found to be higher than carbon-supported catalysts before and after ADT. The study suggests that Pt-Ru/MoC and Pt-Ru/WC catalysts are more durable than Pt-Ru/C. Direct methanol fuel cells (DMFCs) with Pt-Ru/MoC and Pt-Ru/WC anodes also exhibit higher performance than the DMFC with Pt-Ru/C anode. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  15. High performance ceramic interconnect material for solid oxide fuel cells (SOFCs): Ca- and transition metal-doped yttrium chromite

    Science.gov (United States)

    Yoon, Kyung Joong; Stevenson, Jeffrey W.; Marina, Olga A.

    2011-10-01

    The effect of transition metal substitution on thermal and electrical properties of Ca-doped yttrium chromite was investigated in relation to use as a ceramic interconnect in high temperature solid oxide fuel cells (SOFCs). 10 at.% Co, 4 at.% Ni, and 1 at.% Cu substitution on B-site of 20 at.% Ca-doped yttrium chromite led to a close match of thermal expansion coefficient (TEC) with that of 8 mol% yttria-stabilized zirconia (YSZ), and a single phase Y0.8Ca0.2Cr0.85Co0.1Ni0.04Cu0.01O3 remained stable between 25 and 1100 °C over a wide oxygen partial pressure range. Doping with Cu significantly facilitated densification of yttrium chromite. Ni dopant improved both electrical conductivity and dimensional stability in reducing environments, likely through diminishing the oxygen vacancy formation. Substitution with Co substantially enhanced electrical conductivity in oxidizing atmosphere, which was attributed to an increase in charge carrier density and hopping mobility. Electrical conductivity of Y0.8Ca0.2Cr0.85Co0.1Ni0.04Cu0.01O3 at 900 °C is 57 S cm-1 in air and 11 S cm-1 in fuel (pO2 = 5 × 10-17 atm) environments. Chemical compatibility of doped yttrium chromite with other cell components was verified at the processing temperatures. Based on the chemical and dimensional stability, sinterability, and thermal and electrical properties, Y0.8Ca0.2Cr0.85Co0.1Ni0.04Cu0.01O3 is suggested as a promising SOFC ceramic interconnect to potentially overcome technical limitations of conventional acceptor-doped lanthanum chromites.

  16. Star-Forming Brightest Cluster Galaxies at 0.25 < z < 1.25: A Transitioning Fuel Supply

    Energy Technology Data Exchange (ETDEWEB)

    McDonald, M.; Stalder, B.; Bayliss, M.; Allen, S. W.; Applegate, D. E.; Ashby, M. L. N.; Bautz, M.; Benson, B. A.; Bleem, L. E.; Brodwin, M.; Carlstrom, J. E.

    2016-02-01

    We present a multi-wavelength study of 90 brightest cluster galaxies (BCGs) in a sample of galaxy clusters selected via the Sunyaev Zel'dovich effect by the South Pole Telescope, utilizing data from various ground- and space-based facilities. We infer the star formation rate (SFR) for the BCG in each cluster, based on the UV and IR continuum luminosity, as well as the [O II] emission line luminosity in cases where spectroscopy is available, finding 7 systems with SFR > 100 Msun/yr. We find that the BCG SFR exceeds 10 Msun/yr in 31 of 90 (34%) cases at 0.25 < z < 1.25, compared to ~1-5% at z ~ 0 from the literature. At z > 1, this fraction increases to 92(+6)(-31)%, implying a steady decrease in the BCG SFR over the past ~9 Gyr. At low-z, we find that the specific star formation rate in BCGs is declining more slowly with time than for field or cluster galaxies, most likely due to the replenishing fuel from the cooling ICM in relaxed, cool core clusters. At z > 0.6, the correlation between cluster central entropy and BCG star formation - which is well established at z ~ 0 - is not present. Instead, we find that the most star-forming BCGs at high-z are found in the cores of dynamically unrelaxed clusters. We investigate the rest-frame near-UV morphology of a subsample of the most star-forming BCGs using data from the Hubble Space Telescope, finding complex, highly asymmetric UV morphologies on scales as large as ~50-60 kpc. The high fraction of star-forming BCGs hosted in unrelaxed, non-cool core clusters at early times suggests that the dominant mode of fueling star formation in BCGs may have recently transitioned from galaxy-galaxy interactions to ICM cooling.

  17. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  18. Hydrogen and Fuel Cell Transit Bus Evaluations: Joint Evaluation Plan for the U.S. Department of Energy and the Federal Transit Administration (Report and Appendix)

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2008-05-01

    This document describes the hydrogen transit bus evaluations performed by the National Renewable Energy Laboratory (NREL) and funded by the U.S. Department of Energy (DOE) and the U.S. Department of Transportation's Federal Transit Administration (FTA).

  19. Assessing transition trajectories towards a sustainable energy system: A case study on the Dutch transition to climate-neutral transport fuel chains

    NARCIS (Netherlands)

    Suurs, R.A.A.; Hekkert, M.P.; Meeus, M.T.H.; Nieuwlaar, E.

    2004-01-01

    This paper proposes a method for the ex ante evaluation of technological trajectories. As a case we study the Dutch transport energy system and its transition to climate neutrality. Two technological trajectories are proposed: (i) a sequence of transition steps based on radical infrastructural chang

  20. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  1. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  2. Contribution to the study of 233U production with MOX-ThPu fuel in PWR reactor. Transition scenarios towards Th/233U iso-generating concepts in thermal spectrum. Development of the MURE fuel evolution code

    International Nuclear Information System (INIS)

    If nuclear power is to provide a significant fraction of the growing world energy demand, only through the breeding concept can the development of sustainable nuclear energy become a reality. The study of such a transition, from present-day nuclear technologies to future breeding concepts is therefore pertinent. Among these future concepts, those using the thorium cycle Th/U-233 in a thermal neutron spectrum are of particular interest; molten-salt type thermal reactors would allow for breeding while requiring comparatively low initial inventories of U-233. The upstream production of U-233 can be obtained through the use of thorium-plutonium mixed oxide fuel in present-day light water reactors. This work presents, firstly, the development of the MURE evolution code system, a C++ object-oriented code that allows the study, through Monte Carlo (M.C.) simulation, of nuclear reactors and the evolution of their fuel under neutron irradiation. The M.C. methods are well-suited for the study of any reactor, whether it'd be an existing reactor using a new kind of fuel or a future concept altogether, the simulation is only dependent on nuclear data. Exact and complex geometries can be simulated and continuous energy particle transport is performed. MURE is an interface with MCNP, the well-known and validated transport code, that allows, among other functionalities, to simulate constant power and constant reactivity evolutions. Secondly, the study of MOX ThPu fuel in a conventional light water reactor (REP) is presented; it explores different plutonium concentrations and isotopic qualities in order to evaluate their safety characteristics. Simulation of their evolution allows us to quantify the production of U-233 at the end of burnup. Last, different french scenarios validating a possible transition towards a park of thermal Th/U-233 breeders, are presented. In these scenarios, U-233 is produced in ThPu moxed light water reactors. (author)

  3. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  4. Analysis of the Transition to Hydrogen Fuel Cell Vehicles and the Potential Hydrogen Energy Infrastructure Requirements, March 2008

    Energy Technology Data Exchange (ETDEWEB)

    Greene, David L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Leiby, Paul N. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); James, Brian [Directed Technologies, Inc., Youngstown, OH (United States); Perez, Julie [Directed Technologies, Inc., Youngstown, OH (United States); Melendez, Margo [National Renewable Energy Lab. (NREL), Golden, CO (United States); Milbrandt, Anelia [National Renewable Energy Lab. (NREL), Golden, CO (United States); Unnash, Stefan [Life Cycle Associates, Portola Valley, CA (United States); Rutherford, Daniel [Life Cycle Associates, Portola Valley, CA (United States); Hooks, Matthew [TIAX, LLC, Lexingtion, MA (United States)

    2008-03-14

    Achieving a successful transition to hydrogen-powered vehicles in the U.S. automotive market will require strong and sustained commitment by hydrogen producers, vehicle manufacturers, transporters and retailers, consumers, and governments. The interaction of these agents in the marketplace will determine the real costs and benefits of early market transformation policies, and ultimately the success of the transition itself.

  5. Current status of the Japanese nuclear fuel cycle - outline of the Japanese nuclear fuel cycle strategy and transition scenario to FR cycle

    International Nuclear Information System (INIS)

    The G8 leaders declared, at the Hokkaido Toyako Summit in 2008, 'to seek to share with all Parties to the UNFCC the vision of, and together with them to consider and adopt in the UNFCCC negotiations, the goal of achieving at least 50% reduction of global emissions by 2050' [1]. They also referred to nuclear energy as 'a means to addressing climate change and energy security concerns and as an essential instrument in reducing dependence on fossil fuels and hence green gas emissions in a growing number of countries.' Japan has been aggressively utilising nuclear energy as one of the major electric power sources to fulfil its domestic energy demand, by currently operating more than 50 nuclear power plants with the total capacity of ca. 50 GWe. This energy source highly depends on the imports of natural uranium from foreign countries to supply fuel to the nuclear power plants. Since nuclear energy use is growing throughout the world; meaning much more uranium resources are to be required in the future, it is rather difficult for Japan alone to maintain the stable supply of uranium resources on a longer-term range. Therefore, the establishment of nuclear fuel cycle with plutonium recycling is indispensable to realise the efficient use of natural uranium resources. Moreover, commercialisation of fast reactors and related fuel cycle (FR cycle) system is aimed at improving drastically the efficiency of natural uranium utilisation and at the same time minimising our environmental concern on geological disposal of high-level radioactive waste. The establishment of closed FR cycle technologies is hoped to secure the long-term sustainable and stable energy supply and to help prevent global warming through reduction of greenhouse gas emissions. This paper describes the current status of nuclear energy and the scenario for the sustainable nuclear energy in Japan. (authors)

  6. Hydrogen Scenario Analysis Summary Report: Analysis of the Transition to Hydrogen Fuel Cell Vehicles and the Potential Hydrogen Energy Infrastructure Requirements

    Energy Technology Data Exchange (ETDEWEB)

    Greene, David L [ORNL; Leiby, Paul Newsome [ORNL; James, Brian [Directed Technologies, Inc.; Perez, Julie [Directed Technologies, Inc.; Melendez, Margo [National Renewable Energy Laboratory (NREL); Milbrandt, Anelia [National Renewable Energy Laboratory (NREL); Unnasch, Stefan [Life Cycle Associates; Rutherford, Daniel [TIAX, LLC; Hooks, Matthew [TIAX, LLC

    2008-03-01

    Achieving a successful transition to hydrogen-powered vehicles in the U.S. automotive market will require strong and sustained commitment by hydrogen producers, vehicle manufacturers, transporters and retailers, consumers, and governments. The interaction of these agents in the marketplace will determine the real costs and benefits of early market transformation policies, and ultimately the success of the transition itself. The transition to hydrogen-powered transportation faces imposing economic barriers. The challenges include developing and refining a new and different power-train technology, building a supporting fuel infrastructure, creating a market for new and unfamiliar vehicles, and achieving economies of scale in vehicle production while providing an attractive selection of vehicle makes and models for car-buyers. The upfront costs will be high and could persist for a decade or more, delaying profitability until an adequate number of vehicles can be produced and moved into consumer markets. However, the potential rewards to the economy, environment, and national security are immense. Such a profound market transformation will require careful planning and strong, consistent policy incentives. Section 811 of the Energy Policy Act (EPACT) of 2005, Public Law 109-59 (U.S. House, 2005), calls for a report from the Secretary of Energy on measures to support the transition to a hydrogen economy. The report was to specifically address production and deployment of hydrogen-fueled vehicles and the hydrogen production and delivery infrastructure needed to support those vehicles. In addition, the 2004 report of the National Academy of Sciences (NAS, 2004), The Hydrogen Economy, contained two recommendations for analyses to be conducted by the U.S. Department of Energy (DOE) to strengthen hydrogen energy transition and infrastructure planning for the hydrogen economy. In response to the EPACT requirement and NAS recommendations, DOE's Hydrogen, Fuel Cells and

  7. Industrial Frequency Single-Phase AC Traction Power Supply System and Its Key Technologies for Urban Rail Transit%城市轨道交通交流牵引供电系统及其关键技术

    Institute of Scientific and Technical Information of China (English)

    李群湛

    2015-01-01

    To avoid stray current and maintain the benefit of no phase-split in the DC traction power supply system,an AC traction power supply system was proposed for the urban public transport such as metro and light rail transit. The proposed system consists of main substation (MSS)and cable traction network (CTN ). MSS includes a single-phase main traction transformer (MTT ) and a negative sequence compensation device (NCD ),while CTN includes double-core cables (DCC ),traction transformers (TT),overhead catenary system (OCS),rails (R),etc. Three key techniques of the proposed system were discussed. First,power supply principle,equivalent circuit and transmission ability of CNT were introduced and cable-catenary matching technique,catenary voltage level selection were discussed. Second,the segmentation technology,status identification method for traction power supply network,distributed and centralized protection schemes,etc. were discussed. Third,single-line main substation supply scheme,and two or more lines shared main substation scheme were presented. Given that the excellent technical performance,good economy and high reliability of the proposed system,it provides a new alternative for metro and urban rail transit power supply system.%在地铁、轻轨等城市轨道交通中,为了避免现行直流牵引供电系统的迷流,同时发挥其无分相的优势,提出并研究了一种交流牵引供电系统。该系统由主变电所(MSS)和电缆牵引网(CTN)构成,主变电所由单相主牵引变压器(MTT)和负序补偿装置(NCD)组合而成,电缆牵引网由双芯电缆(DCC)、牵引变压器(TT)和接触网(OCS)、钢轨(R)等构成。讨论了该系统的3项关键技术:电缆牵引网的供电原理,等效电路和输电能力,电缆与接触网的匹配技术,接触网电压等级选择等;牵引网分段供电技术,牵引网供电状态辨识方法,分布式保护与集中式

  8. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  9. AC1 Wing

    OpenAIRE

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  10. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  11. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  12. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  13. Dynamics of a nanowire superlattice in an ac electric field

    OpenAIRE

    Zhang, Aizhen; Voon, L. C. Lew Yan; M. Willatzen

    2005-01-01

    With a one-band envelope function theory, we investigate the dynamics of a finite nanowire superlattice driven by an ac electric field by solving numerically the time-dependent Schroedinger equation. We find that for an ac electric field resonant with two energy levels located in two different minibands, the coherent dynamics in nanowire superlattices is much more complex as compared to the standard two-level description. Depending on the energy levels involved in the transitions, the coheren...

  14. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  15. Hydrogen Scenario Analysis Summary Report: Analysis of the Transition to Hydrogen Fuel Cell Vehicles and the Potential Hydrogen Energy Infrastructure Requirements

    Energy Technology Data Exchange (ETDEWEB)

    Greene, David L [ORNL; Leiby, Paul Newsome [ORNL; James, Brian [Directed Technologies, Inc.; Perez, Julie [Directed Technologies, Inc.; Melendez, Margo [National Renewable Energy Laboratory (NREL); Milbrandt, Anelia [National Renewable Energy Laboratory (NREL); Unnasch, Stefan [Life Cycle Associates; Rutherford, Daniel [TIAX, LLC; Hooks, Matthew [TIAX, LLC

    2008-03-01

    Achieving a successful transition to hydrogen-powered vehicles in the U.S. automotive market will require strong and sustained commitment by hydrogen producers, vehicle manufacturers, transporters and retailers, consumers, and governments. The interaction of these agents in the marketplace will determine the real costs and benefits of early market transformation policies, and ultimately the success of the transition itself. The transition to hydrogen-powered transportation faces imposing economic barriers. The challenges include developing and refining a new and different power-train technology, building a supporting fuel infrastructure, creating a market for new and unfamiliar vehicles, and achieving economies of scale in vehicle production while providing an attractive selection of vehicle makes and models for car-buyers. The upfront costs will be high and could persist for a decade or more, delaying profitability until an adequate number of vehicles can be produced and moved into consumer markets. However, the potential rewards to the economy, environment, and national security are immense. Such a profound market transformation will require careful planning and strong, consistent policy incentives. Section 811 of the Energy Policy Act (EPACT) of 2005, Public Law 109-59 (U.S. House, 2005), calls for a report from the Secretary of Energy on measures to support the transition to a hydrogen economy. The report was to specifically address production and deployment of hydrogen-fueled vehicles and the hydrogen production and delivery infrastructure needed to support those vehicles. In addition, the 2004 report of the National Academy of Sciences (NAS, 2004), The Hydrogen Economy, contained two recommendations for analyses to be conducted by the U.S. Department of Energy (DOE) to strengthen hydrogen energy transition and infrastructure planning for the hydrogen economy. In response to the EPACT requirement and NAS recommendations, DOE's Hydrogen, Fuel Cells and

  16. Feasibility study of recycle material storage facility in the flexible fuel cycle system during transition from LWR cycle to FBR cycle

    International Nuclear Information System (INIS)

    In order to establish the future ideal FBR fuel cycle system from the current LWR fuel cycle, we proposed the Flexible Fuel Cycle Initiative (FFCI) as a suitable transition system. The FFCI removes about 90% of the U present in LWR spent fuel and the residual material, designated as recycle material (RM), is temporarily stored in a facility, such as the vitrified high-level waste (HLW) storage facility. Decay heat of the RM is removed with natural convection of air. In this paper, feasibility of the RM storage facility was studied from viewpoints of heat removal performance and critical safety. Maximum temperature of the RM and the containment pipe were evaluated for the variable density value which depends on the RM filling ratio. Because the heat density of the RM is larger than that of vitrified HLW, we made the diameter of the canister 15cm which is about one third the diameter of a vitrified HLW canister. To improve economy, we evaluated the safety of the storage facility in which three canisters surrounded by an outer pipe identical to the air pipe used in the HLW storage facility. Each canister is surrounded by an containment pipe and an pipe. The points of the feasibility study for the RM storage facility were summarized as follows. 1) The thermal analysis of the storage facility was done by regarding RM as a granule material and basically consisting of uranium oxide. Temperature at the center of the RM was evaluated with various thermal conductivity models in relation to RM filling ratio. 2) Temperature of the RM storage facility was also evaluated preliminarily with thermal properties of simulated oxide RM. Temperature at the center of a canister slightly exceeded a limit value of 1000degC for the RM produced in an air atmosphere. But it can be de reduced within the limit for the RM produced in a helium atmosphere. 3) Critical safety was also investigated for RM storage and it was found that sub-criticality could be achieved even in the hypothetical

  17. Hermetisk AC-Krets

    OpenAIRE

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  18. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  19. Fuel cycle: the transition between the third and the fourth generation of reactors; Cycle du combustible: faire la transition vers les 3eme et 4eme generations de reacteurs

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-07-01

    Many challenges arrive today for the french research and development on the fuel cycle: promote the industrial technologies, improve the world increase of the nuclear and adapt the fuel cycle technologies to the future reactors. In this framework the report presents after a recall on the fuel cycle, the researches on the fuel, the optimization of the recycling, the wastes management, the simulation and Phenix an experimentation tool for the fuel. (A.L.B.)

  20. Experimental investigation of fuel cell dynamic response and control

    Science.gov (United States)

    Williams, Keith A.; Keith, Warren T.; Marcel, Michael J.; Haskew, Timothy A.; Shepard, W. Steve; Todd, Beth A.

    An experimental study of the dynamic response of a commercial fuel cell system is presented in this work. The primary goal of the research is an examination of the feasibility for using fuel cells in a load-following mode for vehicular applications, where load-following implies that the fuel cell system provides the power necessary for transient responses without the use of additional energy storage elements, such as batteries or super-capacitors. The dynamic response of fuel cell systems used in the load-following mode may have implications for safe and efficient operation of vehicles. To that end, a DC-DC converter was used to port the power output of the fuel cell to a resistive load using a pulse-width-modulating circuit. Frequency responses of the system were evaluated at a variety of DC offsets and AC amplitudes of the PWM duty cycle from 1 out to 400 Hz. Open-loop transient responses are then evaluated using transitions from 10% to 90% duty cycle levels, followed by dwells at the 90% level and then transitions back to the 10% level. A classical proportional-integral controller was then developed and used to close the loop around the system, with the result that the fuel cell system was driven to track the same transient. The controller was then used to drive the fuel cell system according to a reference power signal, which was a scaled-down copy of the simulated power output from an internal combustion engine powering a conventional automobile through the Federal Urban Driving Schedule (FUDS). The results showed that the fuel cell system is capable of tracking transient signals with sufficient fidelity such that it should be applicable for use in a load-following mode for vehicular applications. The results also highlight important issues that must be addressed in considering vehicular applications of fuel cells, such as the power conditioning circuit efficiency and the effect of stack heating on the system response.

  1. Cost-effective fuel and technology choices in the transportation sector in a future carbon constrained world: Results from the Global Energy Transition (GET) model

    Energy Technology Data Exchange (ETDEWEB)

    Grahn, Maria

    2009-06-15

    This thesis analyzes future fuel and technology choices focusing on transport in a carbon constrained world. The analysis tool used in all five appended papers is the cost-minimizing Global Energy Transition (GET) model. Paper I analyzes cost-effective fuel and technology choices for passenger vehicles under a variety of vehicle cost-assumptions and how these choices depend on technology paths in the electricity sector. We find that cost estimates as well as the availability of carbon capture and storage technology and concentrating solar power have a substantial impact, ranging from a dominance of hydrogen to a dominance of electricity. Paper II analyzes the cost-effectiveness of biofuels for transportation, assuming that industrialized regions start reducing their CO{sub 2} emissions some decades ahead of developing regions. We find that biofuels may play a more important role for transportation in industrialized regions if these regions assume their responsibilities and reduce emissions before developing regions start reducing theirs, compared to the case in which all countries take action under a global cap and trade emissions reduction regime. Paper III analyzes how policy instruments aimed at increasing the use of biofuels for transportation in industrialized regions affect CO{sub 2} emissions in industrialized and developing regions. We find that such policy instruments may lead to avoided emissions in industrialized regions, especially during the first 50 years, and in a few specific cases in the developing regions, too. However, in the majority of cases, such a biofuels policy leads to increased emissions in the developing regions, i.e., to 'carbon leakage'. Paper IV analyzes why two global energy systems models reach different results on the cost-effectiveness of biofuels, although the models have strong similarities. We find biomass most cost-effectively used for heat production at low CO{sub 2} taxes in both models. Biomass allocation at

  2. AC susceptibility of polycrystalline (Bi-Pb 2223 superconductors

    Directory of Open Access Journals (Sweden)

    H. Salamati

    2004-06-01

    Full Text Available   The temperature dependence of ac susceptibility of (Bi-Pb2223 polycrystalline samples was measured as a function of frequency and ac field amplitude. Analysis of the temperature dependence of the AC susceptibility near the transition temperature (Tc has been done employing Bean’s critical state model. The observed variation of intergranular critical current densities (Jc with temperature indicates that the weak links are superconductor- normal metal-superconductor (SNS type for this sample. The frequency effect on AC susceptibility was also measured. As the frequency increases, (TP shifts to higher temperatures. This effect can be interpreted in terms of flux creep. The temperature T, and field, , dependence of activation energy obtained from the Arrhenius plot for the frequency ( f and ( TP , can be described as: U(Hac,T=U0(1-T/TCHac-0.18

  3. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  4. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  5. Energy saving measures for automotive air conditioning (AC) system in the tropics

    OpenAIRE

    Subiantoro, Alison; Ooi, Kim Tiow; Stimming, Ulrich

    2014-01-01

    Air conditioning (AC) is an integral component of modern cars in the tropics. However, AC usage in this region consumes a large amount of energy. In conventional internal combustion engine cars, it consumes up to 30% of the fuel, while in battery electric cars, AC may reduce the battery range by up to 40%. Fortunately, there are various ways to improve the efficiency of automotive ACs in the tropics. In this paper, three energy saving measures are discussed. These include a higher indoor temp...

  6. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  7. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  8. Modelling socio-metabolic transitions: The historical take-off, the acceleration of fossil fuel use, and the 1970s oil price shock - the first trigger of a future decline?

    Science.gov (United States)

    Wiedenhofer, Dominik; Rovenskaya, Elena; Krausmann, Fridolin; Haas, Willi; Fischer-Kowalski, Marina

    2013-04-01

    By talking about socio-metabolic transitions, we talk about changes in the energy base of socio-economic systems, leading to fundamental changes in social and environmental relations. This refers to the historical shift from a biomass-based (agrarian) economy to a fossil fuel based (industrial) economy just as much as to a future shift from fossil fuels to renewable energy carriers. In our presentation, • We will first show that this pattern of transition can be identified for most high income industrial countries: the later the transition started, the faster it proceeded, and the turning point to stabilization of metabolic rates in all of them happened in the early 1970ies. Due to the inherent non-linearity of this process, two approaches will be aplied to estimate parameters for the starting point, transition speed and saturation level: firstly a combination of an expontential and a generalized logistic function and secondly a Gompertz function. For both an iterative test procedure is applied to find the global minimum of the residual error for the whole function and all its parameters. This theory-based approach allows us to apply a robust methodology across all cases, thereby yielding results which can be generalized. • Next, we will show that this was not just a "historical" socio-ecological transition, however. Currently, a substantial number of countries comprising more than half of the world's population are following a similar transitional pathway at an ever accelerating pace. Based on empirical data on physical resource use and the above sketched methodology, we can show that these so-called emerging economies are currently in the take-off or acceleration phase of the very same transition. • Apart from these "endogenous" processes of socio-metabolic transition, we will investigate the effect of external shocks and their impact on the dynamics of energy and materials use. The first such shock we will explore is the oil crisis of 1972 that possibly

  9. Direct Experimental Observation of a Practical AC Zeeman Force

    Science.gov (United States)

    Fancher, Charles; Pyle, Andrew; Rotunno, Andrew; Du, Shuangli; Aubin, Seth

    2016-05-01

    We present measurements of the spin-dependent AC Zeeman force produced by microwave magnetic near-field gradients on an atom chip. We measure the AC Zeeman force on ultracold 87 Rb atoms by observing its effect on the motion of atoms in free-fall and on those confined in a trap. We have studied the force as a function of microwave frequency detuning from a hyperfine transition at 6.8 GHz at several magnetic field strengths and have observed its characteristic bipolar and resonant features predicted by two-level dressed atom theory. We find that the force is several times the strength of gravity in our setup, and that it can be targeted to a specific hyperfine transition while leaving other hyperfine states and transitions relatively unaffected. We find that our measurements are reasonably consistent with theory and are working towards a parameter-free comparison. AC Zeeman potentials offer the possibility of targeting qualitatively different trapping potentials to different spin states, a capability currently absent from the toolbox of atomic quantum control techniques. In particular, an AC Zeeman potential could be used as the beamsplitter for a spin-dependent atom interferometer or for engineering a quantum gate. Work supported by AFOSR and W&M, and in part by AFRL.

  10. Operation Method for AC Motor Control during Power Interruption in Direct AC/AC Converter System

    Science.gov (United States)

    Shizu, Keiichiro; Azuma, Satoshi

    Direct AC/AC converters have been studied due to their potential use in power converters with no DC-link capacitor, which can contribute to the miniaturization of power converters. However, the absence of a DC-link capacitor makes it difficult to control the AC motor during power interruption. First, this paper proposes a system that realizes AC motor control during power interruption by utilizing a clamp capacitor. In general, direct AC/AC converters have a clamp circuit consisting of a rectifier diode(s) and a clamp capacitor in order to avoid over-voltages. In the proposed system, there is an additional semiconductor switch reverse-parallel to the rectifier diode(s), and the clamp capacitor voltage can be utilized for AC motor control by turning on the additional switch. Second, this paper discusses an operation method for AC motor control and clamp capacitor voltage control during power interruption. In the proposed method “DC-link voltage control”, the kinetic energy in the AC motor is transformed into electrical energy and stored in the clamp capacitor; the clamp capacitor is therefore charged and the capacitor voltage is controlled to remain constant at an instruction value. Third, this paper discusses a switching operation during power interruption. A dead-time is introduced between the operation of turning off all switches on the rectifier side and the operation of turning on the additional switch, which prevents the occurrence of a short circuit between the interrupted power source and the clamp capacitor. Finally, experimental results are presented. During power interruptions, an output current was continuously obtained and the clamp capacitor voltage was maintained to be equal to the instruction value of the capacitor voltage. These results indicate that both AC motor control and capacitor voltage control were successfully achieved by using the proposed system.

  11. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  12. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  13. AC Motor Drive Fed by Renewable Energy Sources with PWM

    Directory of Open Access Journals (Sweden)

    J. Pavalam

    2014-01-01

    Full Text Available In this fast aproaching nature of technology the ned of Electricity becomes a mandatory in developing technology. The ned of Electricity increases the power demand where the power demand met by the conventional sources of energy has some disadvantage of polution, this disadvantage can be decreased by the use of the Renewable energy sources like Fuel Cel and available solar energy. When a FUEL cel produces AC power, basicaly two stages are required for conversion first a bosting stage and second is inversion stage. In this paper the Bost inverter topology is achieved where in the conventional methods the normal DC - AC power conversion method is used where as in this paper the PWM based DC - AC inverter has ben used which is useful in reducing the harmonics in the output of the Inverter. The voltage controled output is produced in the bost inverter the curent controled output is taken from dc-dc bidirectional converter. The Fuel cel canot be relied as a whole so a Solar PV module is conected acros the Load so while the Sunlight days the PV arays generate power and in the night time the Fuel cel is used to generate power for the load. Since, the Fuel cel and PV arays can generate power in Partial load they are prefered than any other sources. When the output from the Solar PV aray is low or when the sunlight available is not eficient in generating the power a automatic switch over is provided in the junction betwen the Solar PV aray and Fuel cel so that whenever it hapens the switch automaticaly switch over to another source. The simulation results are presented to confirm the operational feature of the proposed system.

  14. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  15. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  16. Releasing metal catalysts via phase transition: (NiO)0.05-(SrTi0.8Nb0.2O3)0.95 as a redox stable anode material for solid oxide fuel cells.

    Science.gov (United States)

    Xiao, Guoliang; Wang, Siwei; Lin, Ye; Zhang, Yanxiang; An, Ke; Chen, Fanglin

    2014-11-26

    Donor-doped perovskite-type SrTiO3 experiences stoichiometric changes at high temperatures in different Po2 involving the formation of Sr or Ti-rich impurities. NiO is incorporated into the stoichiometric strontium titanate, SrTi0.8Nb0.2O3-δ (STN), to form an A-site deficient perovskite material, (NiO)0.05-(SrTi0.8Nb0.2O3)0.95 (Ni-STN), for balancing the phase transition. Metallic Ni nanoparticles can be released upon reduction instead of forming undesired secondary phases. This material design introduces a simple catalytic modification method with good compositional control of the ceramic backbones, by which transport property and durability of solid oxide fuel cell anodes are largely determined. Using Ni-STN as anodes for solid oxide fuel cells, enhanced catalytic activity and remarkable stability in redox cycling have been achieved. Electrolyte-supported cells with the cell configuration of Ni-STN-SDC anode, La0.8Sr0.2Ga0.87Mg0.13O3 (LSGM) electrolyte, and La0.6Sr0.4Co0.2Fe0.8O3 (LSCF) cathode produce peak power densities of 612, 794, and 922 mW cm(-2) at 800, 850, and 900 °C, respectively, using H2 as the fuel and air as the oxidant. Minor degradation in fuel cell performance resulted from redox cycling can be recovered upon operating the fuel cells in H2. Such property makes Ni-STN a promising regenerative anode candidate for solid oxide fuel cells.

  17. Operation and Control of Grid Connected Hybrid AC/DC Microgrid using various RES

    Directory of Open Access Journals (Sweden)

    Kodanda Ram R B P U S B

    2014-10-01

    Full Text Available This paper proposes a Hybrid AC/DC Microgrid in alliance with Photo Voltaic (PV energy, Wind Energy and Proton Exchange Membrane (PEM Fuel cells. Microgrids are becoming increasingly attractive to the researchers because of the less greenhouse gases, low running cost, and flexibility to operate in connection with utility grid. The Hybrid AC/DC Microgrid constitutes independent AC and DC subgrids, where all the corresponding sources and loads are connected to their respective buses and these buses are interfaced using an interfacing converter. The Hybrid AC/DC Microgrid increases system efficiency by reducing the multiple reverse conversions involved in conventional RES integration to grid. A Small Hybrid AC/DC Microgrid in grid connected mode was modeled and simulated in MATLAB-SIMULINK environment. The simulation results proves the stable operation considering the uncertainty of generations and loads.

  18. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  19. Phase sensitive quantum interference on forbidden transition in ladder scheme

    CERN Document Server

    Koganov, Gennady A

    2014-01-01

    A three level ladder system is analyzed and the coherence of initially electric-dipole forbidden transition is calculated. Due to the presence of two laser fields the initially dipole forbidden transition becomes dynamically permitted due to ac Stark effect. It is shown that such transitions exhibit quantum-interference-related phenomena, such as electromagnetically induced transparency, gain without inversion and enhanced refractive index. Gain and dispersion characteristics of such transitions strongly depend upon the relative phase between the driving and the probe fields. Unlike allowed transitions, gain/absorption behavior of ac-Stark allowed transitions exhibit antisymmetric feature on the Rabi sidebands. It is found that absorption/gain spectra possess extremely narrow sub-natural resonances on these ac Stark allowed forbidden transitions. An interesting finding is simultaneous existence of gain and negative dispersion at Autler-Townes transition which may lead to both reduction of the group velocity a...

  20. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  1. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  2. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  3. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-04-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

  4. Nuclear structure effects in the exotic decay of $^{225}$Ac via $^{14}$C emission

    CERN Document Server

    Bonetti, R; Guglielmetti, A; Matheoud, R; Migliorino, C; Pasinetti, A L; Ravn, H L

    1993-01-01

    By using a $^{225}$Ac source produced at the electromagnetic separator Isolde we collected on our track-recording glass detectors 305 $^{14}$C events from the radioactive decays of $^{225}$Ac and its daughter $^{221}$Fr and obtained, for $^{225}$Ac, a branching ratio B($^{14}$C/$\\alpha$)=(6.0 $\\pm$ 1.3) x 10$^{-12}$. Our result suggests that such a decay from an odd proton nucleus is dominated by transition to the ground or to the first excited state of daughter nucleus.

  5. SSTI Clark ACS Technology Demonstrations

    OpenAIRE

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  6. Apuntes de Acústica

    OpenAIRE

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  7. Energy saving in ac generators

    Science.gov (United States)

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  8. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  9. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  10. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  11. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  12. Development of ac corona discharge modes at atmospheric pressure

    International Nuclear Information System (INIS)

    Corona discharges in gases exist under several distinctive forms. In this paper, a survey study has been made of ac corona discharge modes generated in some different gases fed in a wire-duct reactor with a constant rate of flowing at atmospheric pressure. The properties of different corona modes are analyzed under some condition transitions from Trichel pulses to a steady glow. In the course of the presented experimental work, numerous apparent contradictions with earlier observations necessitated further study and are given to provide more information on the physical mechanisms of the ac corona discharges. Furthermore, we have gained insight into some new technologies and applications of the environmentally friendly corona and plasma discharges.

  13. Monitoring colloidal stability of polymer-coated magnetic nanoparticles using AC susceptibility measurements.

    Science.gov (United States)

    Herrera, Adriana P; Barrera, Carola; Zayas, Yashira; Rinaldi, Carlos

    2010-02-15

    The application of the response of magnetic nanoparticles to oscillating magnetic fields to probe transitions in colloidal state and structure of polymer-coated nanoparticles is demonstrated. Cobalt ferrite nanoparticles with narrow size distribution were prepared and shown to respond to oscillating magnetic fields through a Brownian relaxation mechanism, which is dependent on the mechanical coupling between the particle dipoles and the surrounding matrix. These nanoparticles were coated with covalently-attached poly(N-isopropylacrylamide) (pNIPAM) or poly(N-isopropylmethacrylamide) (pNIPMAM) through free radical polymerization. The temperature induced transitions of colloidal suspensions of these nanoparticles were studied through a combination of differential scanning calorimetry (DSC), dynamic light scattering (DLS), and AC susceptibility measurements. In the pNIPAM coated nanoparticles excellent agreement was found for a transition temperature of approximately 30 degrees C by all three methods, although the AC susceptibility measurements indicated aggregation which was not evident from the DLS results. Small-angle neutron scattering (SANS) results obtained for pNIPAM coated nanoparticles confirmed that aggregation indeed occurs above the lower critical transition temperature of pNIPAM. For the pNIPMAM coated nanoparticles DLS and AC susceptibility measurements indicated aggregation at a temperature of approximately 33-35 degrees C, much lower than the transition temperature peak at 40 degrees C observed by DSC. However, the transition observed by DSC is very broad, hence it is possible that aggregation begins to occur at temperatures lower than the peak, as indicated by the AC susceptibility and DLS results. These experiments and observations demonstrate the possibility of using AC susceptibility measurements to probe transitions in colloidal suspensions induced by external stimuli. Because magnetic measurements do not require optical transparency, these

  14. Electricity generation analyses in an oil-exporting country: Transition to non-fossil fuel based power units in Saudi Arabia

    International Nuclear Information System (INIS)

    In Saudi Arabia, fossil-fuel is the main source of power generation. Due to the huge economic and demographic growth, the electricity consumption in Saudi Arabia has increased and should continue to increase at a very fast rate. At the moment, more than half a million barrels of oil per day is used directly for power generation. Herein, we assess the power generation situation of the country and its future conditions through a modelling approach. For this purpose, we present the current situation by detailing the existing generation mix of electricity. Then we develop a optimization model of the power sector which aims to define the best production and investment pattern to reach the expected demand. Subsequently, we will carry out a sensitivity analysis so as to evaluate the robustness of the model's by taking into account the integration variability of the other alternative (non-fossil fuel based) resources. The results point out that the choices of investment in the power sector strongly affect the potential oil's exports of Saudi Arabia. (authors)

  15. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  16. Fuel cell development for transportation: Catalyst development

    Energy Technology Data Exchange (ETDEWEB)

    Doddapaneni, N. [Sandia National Lab., Albuquerque, NM (United States)

    1996-04-01

    Fuel cells are being considered as alternate power sources for transportation and stationary applications. With proton exchange membrane (PEM) fuel cells the fuel crossover to cathodes causes severe thermal management and cell voltage drop due to oxidation of fuel at the platinized cathodes. The main goal of this project was to design, synthesize, and evaluate stable and inexpensive transition metal macrocyclic catalysts for the reduction of oxygen and be electrochemically inert towards anode fuels such as hydrogen and methanol.

  17. DC and AC transport properties on La0.8Sr0.2MnO3

    Institute of Scientific and Technical Information of China (English)

    Zhantao Wei; Xinsheng Yang; Li Lv; Min Zhang; Yong Zhang

    2014-01-01

    Magnetoresistive sensor can be widely used in modern transportation field, such as the vehicle positioning and navigation system, vehicle detection system, and intelligent transportation system. In order to improve the efficiency of magnetoresistive sensor, we synthesized La0.8Sr0.2MnO3 polycrystalline bulks at different sintering temperatures and investigated their DC and AC transport properties in this work. As a result, all samples showed insulator-metal (I-M) phase transition, and the transition temperature (TI-M) shifted to higher temperature with the increase of sintering temperature. The TI-M measured at different AC frequencies was smaller than that measured at DC condition, which implied that the I-M phase transition was suppressed at AC frequencies. The resistivity mea-sured at high AC frequencies was larger than that measured at low AC frequencies, which could be attributed to the change of the magnetic penetration depth (d). However, the room-temperature AC-magnetoresistance (MR) at low frequencies was much larger than that at high frequencies and room-temperature DC-MR. These findings demon-strate that reducing the AC frequency is an effective way for enhancing the room-temperature MR, which can be used to promote the efficiency of magnetoresistive sensor.

  18. Fuel and control for an integrated fuel cell system

    International Nuclear Information System (INIS)

    The OS/IES (On-Site Integrated Energy System) comprises a phosphoric acid fuel cell driven total energy package that produces electrical energy in the form of AC power (when the DC voltage from the fuel cell is inverted), and heat energy in the form of hot water. The fuel cell prefers a fuel high in hydrogen therefore it becomes necessary to convert as much of the fuel, i.e. natural or pipeline gas into hydrogen as possible using a fuel reformer. Fuel reforming is an endothermic process and in this case waste energy in the form of ''spent'' fuel from the fuel cell is used to supply heat to the reformer. Fuel cell waste heat is also used to raise the steam used in the reforming process. The OS/IES fuel processing system comprises five interrelated subsystems. Each subsystem is controlled independently through a microprocessor but a change in any subsystem function could have an effect on the operation of any or several other subsystems. Thus the controller receives a signal indicating electrical demand and proceeds to balance the subsystems as well as the fuel and air flow to each of the fuel cells. The controller also responds to a number of alarm signals and is capable of starting and stopping the complete OS/IES. It is assisted by a tie to the utility line which can dispense electrical energy for startup or instantaneous load following and accept excess generated power in case of load loss. In this paper we review fuel cell operation and requirements, the components and interactions that make up the reformer system, and the microprocessor control required to integrate the OS/IES

  19. Electricity generation analyses in an oil-exporting country: Transition to non-fossil fuel based power units in Saudi Arabia

    International Nuclear Information System (INIS)

    In Saudi Arabia, fossil-fuel is the main source of power generation. Due to the huge economic and demographic growth, the electricity consumption in Saudi Arabia has increased and should continue to increase at a very fast rate. At the moment, more than half a million barrels of oil per day is used directly for power generation. Herein, we assess the power generation situation of the country and its future conditions through a modelling approach. For this purpose, we present the current situation by detailing the existing generation mix of electricity. Then we develop an optimization model of the power sector which aims to define the best production and investment pattern to reach the expected demand. Subsequently, we will carry out a sensitivity analysis so as to evaluate the robustness of the model's by taking into account the integration variability of the other alternative (non-fossil fuel based) resources. The results point out that the choices of investment in the power sector strongly affect the potential oil's exports of Saudi Arabia. For instance, by decarbonizing half of its generation mix, Saudi Arabia can release around 0.5 Mb/d barrels of oil equivalent per day from 2020. Moreover, total power generation cost reduction can reach up to around 28% per year from 2030 if Saudi Arabia manages to attain the most optimal generation mix structure introduced in the model (50% of power from renewables and nuclear power plants and 50% from the fossil power plants). - Highlights: • We model the current and future power generation situation of Saudi Arabia. • We take into account the integration of the other alternative resources. • We consider different scenarios of power generation structure for the country. • Optimal generation mix can release considerable amount of oil for export

  20. A DEVICE FOR MEASURING SUPERCONDUCTING TRANSITION TEMPERATURE BY AC SUSCEPTIBILITY MEASUREMENT OF SUPERCONDUCTING FILM IN SMALL ^* CRYOCOOLER%在小型制冷机中测量薄片交流磁化率以决定超导转变温度的装置

    Institute of Scientific and Technical Information of China (English)

    褚向华; 王三胜; 杨慧; 陈笃行

    2012-01-01

    In this paper, a device for measuring superconducting transition temperature in small cryocooler, based on principles of electromagnetic induction and superconducting magnetic effect, is introduced. This device consists of a vacuum chamber, a small cryocooler, a vacuum pump, a vacuum gauge, a lock-in amplifier, a temperature controller, a computer and a coil pancake and so on. The coil pancake, which is fixed in the vacuum claamoer, contains a primary coil and secondary coil, the primary coil and secondary coil are respectively wound onto two coil formers. The measured superconducting thin film is put between the primary coil and the secondary coil. The small cryocooler is used to cool superconducting thin film, the vacuum pump is used to pump gas in the vacuum chamber, and the temperature controller is used to measure and control the temperature of superconducting thin filro. The internal oscillator of the lock-in amplifier is connected to the primary coil to provide an excitation field exerted to the superconducting film. At the same time, the lock-in amplifier is used to measure the response of the secondary coil. In our system, the sample temperature datum and the voltage output of the secondary coil are transmitted and saved in the computer; then these datum can be drawn into V--T lines displayed on the computer screen at real time. Experiments show that this device can be used to obtain superconducting transition temperature automatically by measuring ac susceptibility with a lower cost.%本文介绍了一种利用电磁感应原理和超导磁效应,在小型制冷机中测量超导体转变温度的装置.本装置包括密闭的真空室、压缩制冷机、真空泵、真空计、锁相放大器、温控仪、计算机、线圈绕组.其中,线圈绕组置于真空室内,由初级线圈和次级线圈组成,初级线圈和次级线圈分别绕制在两个线圈骨架上;被测超导薄片材料放置于初级线圈和次级线圈之间

  1. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  2. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  3. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  4. ac electroosmosis in rectangular microchannels.

    Science.gov (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  5. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  6. Shape Dependence of Low-Temperature Magnetic Relaxation of Mn12Ac

    Institute of Scientific and Technical Information of China (English)

    LIU Hai-Qing; SU Shao-Kui; JING Xiu-nian; LIU Ying; LI Yan-rong; HE Lun-Hua; GE Pei-Wen; YAN Qi-Wei; WANG Yun-Ping

    2008-01-01

    We report the discovery that the low-temperature magnetic relaxation in Mn,12 Ac single crystals strongly depends on the shape of the samples. The relaxation time exhibits a minimum at the phase transition point between ferromagnetic and antiferromagnetic phases. The shape dependence is attributed to the dipolar interaction between molecular magnets.

  7. Current distribution effects in AC impedance spectroscopy of electroceramic point contact and thin film model electrodes

    DEFF Research Database (Denmark)

    Nielsen, Jimmi; Jacobsen, Torben

    2010-01-01

    The Finite-Element-Method (FEM) was used for the simulations of the effect of a changing current distribution during AC impedance spectrum recording on electroceramic point contact and thin film model electrodes. For pure electronic conducting point contact electrodes the transition from the prim...

  8. A catalyst layer optimisation approach using electrochemical impedance spectroscopy for PEM fuel cells operated with pyrolysed transition metal-N-C catalysts

    Science.gov (United States)

    Malko, Daniel; Lopes, Thiago; Ticianelli, Edson A.; Kucernak, Anthony

    2016-08-01

    The effect of the ionomer to carbon (I/C) ratio on the performance of single cell polymer electrolyte fuel cells is investigated for three different types of non-precious metal cathodic catalysts. Polarisation curves as well as impedance spectra are recorded at different potentials in the presence of argon or oxygen at the cathode and hydrogen at the anode. It is found that a optimised ionomer content is a key factor for improving the performance of the catalyst. Non-optimal ionomer loading can be assessed by two different factors from the impedance spectra. Hence this observation could be used as a diagnostic element to determine the ideal ionomer content and distribution in newly developed catalyst-electrodes. An electrode morphology based on the presence of inhomogeneous resistance distribution within the porous structure is suggested to explain the observed phenomena. The back-pressure and relative humidity effect on this feature is also investigated and supports the above hypothesis. We give a simple flowchart to aid optimisation of electrodes with the minimum number of trials.

  9. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  10. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  11. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  12. Solid Oxide Fuel Cell

    DEFF Research Database (Denmark)

    2010-01-01

    The solid oxide fuel cell comprising a metallic support material, an active anode layer consisting of a good hydrocarbon cracking catalyst, an electrolyte layer, an active cathode layer, and a transition layer consisting of preferably a mixture of LSM and a ferrite to the cathode current collector...

  13. Anomalous behavior of magnetostriction and magnetic ac-suseptibility of Gd1-xPrxCo5 polycrystals

    Directory of Open Access Journals (Sweden)

    A. Amirabadizadeh

    2003-12-01

    Full Text Available Magnetostriction and low field ac-susceptibility of polycrystalline Gd1-xPrxCo5 (x = 0, 0.1 and 0.5 alloys are measured in temperature region of 77-300 K. XRD patterns show that our samples are single phase. For x = 0 (GdCo5 there are no anomaly in temperature dependence of magnetostriction and ac-susceptibility curves. For x = 0.1 and 0.5 temperature dependence of ac-susceptibilities show easy-axes phase transitions. In the case of x = 0.1 sample, the easy-axes of magnetization changes from canted to axial (practically, hexagonal c-axis direction as temperature increases, and ac-susceptibility of x = 0.5 sample shows two iterative transitions, first from basal to canted then canted to axial. Magnetostriction of Pr contained samples anomalously decreases at spin reorientation regions.

  14. Long-Term Performance of Chemically and Physically Modified Activated Carbons in Air Cathodes of Microbial Fuel Cells

    KAUST Repository

    Zhang, Xiaoyuan

    2014-07-31

    © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim. Activated carbon (AC) is a low-cost and effective catalyst for oxygen reduction in air cathodes of microbial fuel cells (MFCs), but its performance must be maintained over time. AC was modified by three methods: 1)pyrolysis with iron ethylenediaminetetraacetic acid (AC-Fe), 2)heat treatment (AC-heat), and 3)mixing with carbon black (AC-CB). The maximum power densities after one month with these AC cathodes were 35% higher with AC-Fe (1410±50mW m-2) and AC-heat (1400±20mW m-2), and 16% higher with AC-CB (1210±30mW m-2) than for plain AC (1040±20mW m-2), versus 1270±50mW m-2 for a Pt control. After 16months, the Pt cathodes produced only 250±10mW m-2. However, the AC-heat and AC-CB cathodes still produced 960-970mW m-2, whereas plain AC produced 860±60mW m-2. The performance of the AC cathodes was restored to >85% of the initial maximum power densities by cleaning with a weak acid solution. Based on cost considerations among the AC materials, AC-CB appears to be the best choice for long-term performance.

  15. Cluster emission in the radioactive decay of 223Ac

    CERN Document Server

    Steyn, G F; Faccio, D; Bonetti, R; Tretyakova, S P; Shishkin, S V; Ogloblin, A A; Pik-Pichak, G A; Vermeulen, C; van der Meulen, N P; van der Walt, T N; McGee, D

    2010-01-01

    The branching ratio of 223Ac decay by spontaneous 14C emission was measured and a search for 15N clusters was performed. After exposure of a hemispherical array of solid-state nuclear track detectors, 347 14C events were identified and no 15N events. B(14C) = λ(14C)/λ(α) = (3.2 ± 1.0) x 10-11 is consistent with a favoured ground state to ground state transition. As no nitrogen tracks were found, only an upper limit could be inferred for 15N emission, B(15N) = λ(15N)/λ(α) ≤ 2.2 x 10-13 (confidence limit 90%), consistent with an unfavoured transition. Intense 227Pa sources were produced for this study, using the reaction 232Th(p,6n)227Pa. This offered an opportunity to compare the measured source strength with predictions based on published excitation function data.

  16. High Efficiency Reversible Fuel Cell Power Converter

    DEFF Research Database (Denmark)

    Pittini, Riccardo

    entitled "High Efficiency Reversible Fuel Cell Power Converter" and it presents the design of a high efficiency dc-dc converter developed and optimized for bidirectional fuel cell applications. First, a brief overview of fuel cell and energy storage technologies is presented. Different system topologies...... as well as different dc-ac and dc-dc converter topologies are presented and analyzed. A new ac-dc topology for high efficiency data center applications is proposed and an efficiency characterization based on the fuel cell stack I-V characteristic curve is presented. The second part discusses the main...... of magnetic components especially for large production volumes. At last, the complete converter design is presented in detailed and characterized in efficiency terms. Both benefits, provided by SiC power devices and by a redesign of the converter layout increased the converter power density up to 2.2 k...

  17. DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-05-01

    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  18. Examining the Link Between Public Transit Use and Active Commuting

    Directory of Open Access Journals (Sweden)

    Melissa Bopp

    2015-04-01

    Full Text Available Background: An established relationship exists between public transportation (PT use and physical activity. However, there is limited literature that examines the link between PT use and active commuting (AC behavior. This study examines this link to determine if PT users commute more by active modes. Methods: A volunteer, convenience sample of adults (n = 748 completed an online survey about AC/PT patterns, demographic, psychosocial, community and environmental factors. t-test compared differences between PT riders and non-PT riders. Binary logistic regression analyses examined the effect of multiple factors on AC and a full logistic regression model was conducted to examine AC. Results: Non-PT riders (n = 596 reported less AC than PT riders. There were several significant relationships with AC for demographic, interpersonal, worksite, community and environmental factors when considering PT use. The logistic multivariate analysis for included age, number of children and perceived distance to work as negative predictors and PT use, feelings of bad weather and lack of on-street bike lanes as a barrier to AC, perceived behavioral control and spouse AC were positive predictors. Conclusions: This study revealed the complex relationship between AC and PT use. Further research should investigate how AC and public transit use are related.

  19. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  20. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  1. 78 FR 3853 - Retrievability, Cladding Integrity and Safe Handling of Spent Fuel at an Independent Spent Fuel...

    Science.gov (United States)

    2013-01-17

    ... Independent Spent Fuel Storage Installation and During Transportation AGENCY: Nuclear Regulatory Commission... transport of spent nuclear fuel are separate from requirements for storage of spent nuclear fuel. Because... transition from storage to transport by potentially minimizing future handling of spent fuel and......

  2. Electric field in an AC dielectric barrier discharge overlapped with a nanosecond pulse discharge

    Science.gov (United States)

    Goldberg, Benjamin M.; Shkurenkov, Ivan; Adamovich, Igor V.; Lempert, Walter R.

    2016-08-01

    The effect of ns discharge pulses on the AC barrier discharge in hydrogen in plane-to-plane geometry is studied using time-resolved measurements of the electric field in the plasma. The AC discharge was operated at a pressure of 300 Torr at frequencies of 500 and 1750 Hz, with ns pulses generated when the AC voltage was near zero. The electric field vector is measured by ps four-wave mixing technique, which generates coherent IR signal proportional to the square of electric field. Absolute calibration was done using an electrostatic (sub-breakdown) field applied to the discharge electrodes, when no plasma was generated. The results are compared with one-dimensional kinetic modeling of the AC discharge and the nanosecond pulse discharge, predicting behavior of both individual micro-discharges and their cumulative effect on the electric field distribution in the electrode gap, using stochastic averaging based on the experimental micro-discharge temporal probability distribution during the AC period. Time evolution of the electric field in the AC discharge without ns pulses, controlled by a superposition of random micro-discharges, exhibits a nearly ‘flat top’ distribution with the maximum near breakdown threshold, reproduced quite well by kinetic modeling. Adding ns pulse discharges on top of the AC voltage waveform changes the AC discharge behavior in a dramatic way, inducing transition from random micro-discharges to a more regular, near-1D discharge. In this case, reproducible volumetric AC breakdown is produced at a well-defined moment after each ns pulse discharge. During the reproducible AC breakdown, the electric field in the plasma exhibits a sudden drop, which coincides in time with a well-defined current pulse. This trend is also predicted by the kinetic model. Analysis of kinetic modeling predictions shows that this effect is caused by large-volume ionization and neutralization of surface charges on the dielectrics by ns discharge pulses. The present

  3. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  4. Fault Tolerant Three-Phase AC Motor Drive Topologies:A Comparison of Features, Cost, and Limitations

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    THE RELIABILITY of adjustables peed ac motor drives is an area of great interest for all members of the drives community and marketplace. This is particularly the case for the military, aerospace and automotive industries that are increasingly adopting variable speed drives in order to improve overall system efficiency and performance. There are certain safety critical applications such as steering, fuel pumps,

  5. Logarithmic ac response in the heavy-fermion superconductor URu2Si2

    International Nuclear Information System (INIS)

    Ac-magnetic-susceptibility χac(T) measurements as a function of frequency f and excitation field hac have been performed on a single crystal of the heavy-fermion superconductor URu2Si2 in magnetic fields H up to 30 kOe applied along the c axis. The apparent superconducting transition temperature Tc shows an unexpected and approximately logarithmic increase (decrease) with f (hac) that is enhanced with H, which suggests the existence of an irreversibility line below the upper critical field Hc2(T) in URu2Si2. Isothermal χac vs H sweeps were used to define Hc2(T) which was independent of f and hac

  6. Contribution to the study of {sup 233}U production with MOX-ThPu fuel in PWR reactor. Transition scenarios towards Th/{sup 233}U iso-generating concepts in thermal spectrum. Development of the MURE fuel evolution code; Contribution a l'etude de la production d'{sup 233}U en combustible MOX-ThPu en reacteur a eau sous pression. Scenarios de transition vers des concepts isogenerateurs Th/{sup 233}U en spectre thermique. Developpement du code MURE d'evolution du combustible

    Energy Technology Data Exchange (ETDEWEB)

    Michel-Sendis, F

    2006-12-15

    If nuclear power is to provide a significant fraction of the growing world energy demand, only through the breeding concept can the development of sustainable nuclear energy become a reality. The study of such a transition, from present-day nuclear technologies to future breeding concepts is therefore pertinent. Among these future concepts, those using the thorium cycle Th/U-233 in a thermal neutron spectrum are of particular interest; molten-salt type thermal reactors would allow for breeding while requiring comparatively low initial inventories of U-233. The upstream production of U-233 can be obtained through the use of thorium-plutonium mixed oxide fuel in present-day light water reactors. This work presents, firstly, the development of the MURE evolution code system, a C++ object-oriented code that allows the study, through Monte Carlo (M.C.) simulation, of nuclear reactors and the evolution of their fuel under neutron irradiation. The M.C. methods are well-suited for the study of any reactor, whether it'd be an existing reactor using a new kind of fuel or a future concept altogether, the simulation is only dependent on nuclear data. Exact and complex geometries can be simulated and continuous energy particle transport is performed. MURE is an interface with MCNP, the well-known and validated transport code, that allows, among other functionalities, to simulate constant power and constant reactivity evolutions. Secondly, the study of MOX ThPu fuel in a conventional light water reactor (REP) is presented; it explores different plutonium concentrations and isotopic qualities in order to evaluate their safety characteristics. Simulation of their evolution allows us to quantify the production of U-233 at the end of burnup. Last, different french scenarios validating a possible transition towards a park of thermal Th/U-233 breeders, are presented. In these scenarios, U-233 is produced in ThPu moxed light water reactors. (author)

  7. AcEST: DK954326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available mily ATPase, CDC48 subfamily OS=Met... 125 1e-27 tr|B8GJ73|B8GJ73_9EURY AAA famil...al transitional endo... 122 1e-26 tr|A7IB30|A7IB30_METB6 AAA family ATPase, CDC48 subfamily OS=Met...... 122 2e-26 tr|A2SR43|A2SR43_METLZ AAA family ATPase, CDC48 subfamily OS=Met... 122 2e-26...et... 120 5e-26 tr|Q2FSR5|Q2FSR5_METHJ AAA family ATPase, CDC48 subfamily OS=Met... 120 5e-26 >tr|O81459|O81

  8. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  9. Structure and Control Strategies of Fuel Cell Vehicle

    Institute of Scientific and Technical Information of China (English)

    宋建国; 张承宁; 孙逢春; 钟秋海

    2004-01-01

    The structure and kinds of the fuel cell vehicle (FCV) and the mathematical model of the fuel cell processor are discussed in detail. FCV includes many parts: the fuel cell thermal and water management, fuel supply, air supply and distribution, AC motor drive, main and auxiliary power management, and overall vehicle control system. So it requires different kinds of control strategies, such as the PID method, zero-pole method, optimal control method, fuzzy control and neural network control. Along with the progress of control method, the fuel cell vehicle's stability and reliability is up-and-up. Experiment results show FCV has high energy efficiency.

  10. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  11. Novel power electronic interface for grid-connected fuel cell power generation system

    International Nuclear Information System (INIS)

    Highlights: • A fuel cell power generation system was composed of a DC–DC power converter and a DC–AC inverter. • A voltage doubler based topology was adopted to configure the DC–DC power converter. • A dual buck power converter and a full-bridge power converter were applied to the DC–AC inverter. • The DC–AC inverter outputs a five-level voltage. • The DC–AC inverter performs the functions of DC–AC power conversion and active power filter. - Abstract: A novel power electronic interface for the grid-connected fuel cell power generation system is proposed in this paper. This power electronic interface is composed of a DC–DC power converter and a DC–AC inverter. A voltage doubler based topology is adopted to configure the DC–DC power converter to perform high step-up gain for boosting the output voltage of the fuel cell to a higher voltage. Moreover, the input current ripple of the fuel cell is suppressed by controlling the DC–DC power converter. The DC–AC inverter is configured by a dual buck power converter and a full-bridge power converter to generate a five-level AC output voltage. The DC–AC inverter can perform the functions of DC–AC power conversion and active power filtration. A 1.2 kW hardware prototype is developed to verify the performance of the proposed power electronic interface for the grid-connected fuel cell power generation system. The experimental results show that the proposed power electronic interface for the grid-connected fuel cell power generation system has the expected performance

  12. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    OpenAIRE

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  13. Examining hydrogen transitions.

    Energy Technology Data Exchange (ETDEWEB)

    Plotkin, S. E.; Energy Systems

    2007-03-01

    This report describes the results of an effort to identify key analytic issues associated with modeling a transition to hydrogen as a fuel for light duty vehicles, and using insights gained from this effort to suggest ways to improve ongoing modeling efforts. The study reported on here examined multiple hydrogen scenarios reported in the literature, identified modeling issues associated with those scenario analyses, and examined three DOE-sponsored hydrogen transition models in the context of those modeling issues. The three hydrogen transition models are HyTrans (contractor: Oak Ridge National Laboratory), MARKAL/DOE* (Brookhaven National Laboratory), and NEMS-H2 (OnLocation, Inc). The goals of these models are (1) to help DOE improve its R&D effort by identifying key technology and other roadblocks to a transition and testing its technical program goals to determine whether they are likely to lead to the market success of hydrogen technologies, (2) to evaluate alternative policies to promote a transition, and (3) to estimate the costs and benefits of alternative pathways to hydrogen development.

  14. Fuel cycles

    International Nuclear Information System (INIS)

    AECL publications, from the open literature, on fuels and fuel cycles used in CANDU reactors are listed in this bibliography. The accompanying index is by subject. The bibliography will be brought up to date periodically

  15. Structure and relaxation dynamics of poly(amide urethane)s with bioactive transition metal acetyl acetonates in hard blocks.

    Science.gov (United States)

    Kalogeras, I M; Roussos, M; Vassilikou-Dova, A; Spanoudaki, A; Pissis, P; Savelyev, Y V; Shtompel, V I; Robota, L P

    2005-12-01

    Structural characteristics, thermal transitions and molecular dynamics of selected poly(amide urethane)s with transition metal acetyl acetonates Me(AcAc)(2) (Me = Sn(4+), Zn(2+), Cu(2+), Pb(2+)) as chain extenders, were comparatively investigated using small- and wide-angle X-ray scattering (SAXS, WAXS), differential scanning calorimetry (DSC), and dielectric techniques (dielectric relaxation spectroscopy, DRS; thermally stimulated currents, TSC). We studied the influence of metal chelates on the mixing of the soft-segment (SS) and hard-segment (HS) domains and the related degree of microphase separation (DMS). The reactivity of Me(AcAc)(2) with macrodiisocyanate was found to decrease in the order Sn(AcAc)(2)Cl(2) > Cu(AcAc)(2) > Zn(AcAc)(2) > Pb(AcAc)(2). While Pb(AcAc)(2) shows a higher tendency for crystallisation, both the dielectric and calorimetric results suggest that the corresponding polyurethane has comparatively low DMS. The type of the transition metal has moderate effect on the glass transition temperature and no influence on the shape of the dielectric alpha relaxation signal, indicating weak interactions between metal ions and SS domains. In contrast, structural parameters and the dielectric behaviour of the beta relaxation suggest preference for hydrogen-bonding interactions between Sn(4+) and Cu(2+) metal-chelates and HS domains. The temperature dependence of dc conductivity sigma(dc) is described by the Vogel-Tammann-Fulcher equation and signifies the coupling between the mobility of polymeric chains and charges' motion. It may be expected that the present combination of techniques and particular results with respect to DMS will contribute to the development and testing of novel biodegradation-resistant and antibacterial metal-polyurethanes for biotechnological and industrial applications. PMID:16331340

  16. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  17. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  18. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  19. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  20. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... COMMISSION ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission (``Commission...''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b)(2) of the..., owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  1. Micro pumping methods based on AC electrokinetics and Electrorheologically actuated PDMS valves

    Science.gov (United States)

    Soni, Gaurav; Squires, Todd; Meinhart, Carl

    2006-11-01

    We have developed 2 different micropumping methods for transporting ionic fluids through microchannels. The first method is based on Induced Charge Electroosmosis (ICEO) and AC flow field-effect. We used an AC electric field to produce a symmetric ICEO flow on a planar electrode, called `gate'. In order to break the symmetry of ICEO, we applied an additional AC voltage to the gate electrode. Such modulation of the gate potential is called field effect and produces a unidirectional pumping over the gate surface. We used micro PIV to measure pumping velocities for a range of ionic concentration, AC frequency and gate voltage. We have also conducted numerical simulations to understand the deteriorating effect of lateral conduction of surface charge on the pumping velocities. The second method is based on vibration of a flexible PDMS diaphragm actuated by an electrorheological (ER) fluid. ER fluid is a colloidal suspension exhibiting a reversible liquid-to-solid transition under an electric field. This liquid-to-solid transition can yield very high shear stress and can be used to open and close a PDMS valve. Three such valves were fabricated and actuated in a peristaltic fashion in order to achieve positive displacement pumping of fluids.

  2. A Generalised Fault Protection Structure Proposed for Uni-grounded Low-Voltage AC Microgrids

    Science.gov (United States)

    Bui, Duong Minh; Chen, Shi-Lin; Lien, Keng-Yu; Jiang, Jheng-Lun

    2016-04-01

    This paper presents three main configurations of uni-grounded low-voltage AC microgrids. Transient situations of a uni-grounded low-voltage (LV) AC microgrid (MG) are simulated through various fault tests and operation transition tests between grid-connected and islanded modes. Based on transient simulation results, available fault protection methods are proposed for main and back-up protection of a uni-grounded AC microgrid. In addition, concept of a generalised fault protection structure of uni-grounded LVAC MGs is mentioned in the paper. As a result, main contributions of the paper are: (i) definition of different uni-grounded LVAC MG configurations; (ii) analysing transient responses of a uni-grounded LVAC microgrid through line-to-line faults, line-to-ground faults, three-phase faults and a microgrid operation transition test, (iii) proposing available fault protection methods for uni-grounded microgrids, such as: non-directional or directional overcurrent protection, under/over voltage protection, differential current protection, voltage-restrained overcurrent protection, and other fault protection principles not based on phase currents and voltages (e.g. total harmonic distortion detection of currents and voltages, using sequence components of current and voltage, 3I0 or 3V0 components), and (iv) developing a generalised fault protection structure with six individual protection zones to be suitable for different uni-grounded AC MG configurations.

  3. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  4. Fossil Fuels.

    Science.gov (United States)

    Crank, Ron

    This instructional unit is one of 10 developed by students on various energy-related areas that deals specifically with fossil fuels. Some topics covered are historic facts, development of fuels, history of oil production, current and future trends of the oil industry, refining fossil fuels, and environmental problems. Material in each unit may…

  5. Josephson effects in an alternating current biased transition edge sensor

    CERN Document Server

    Gottardi, Luciano; Akamatsu, Hiroki; van der Kuur, Jan; Bruijn, Marcel P; Hartog, Roland H den; Hijmering, Richard; Khosropanah, Pourya; Lambert, Colin; van der Linden, Anton J; Ridder, Marcel L; Suzuki, Toyo; Gao, Jan R

    2016-01-01

    We report the experimental evidence of the ac Josephson effect in a transition edge sensor (TES) operating in a frequency domain multiplexer and biased by ac voltage at MHz frequencies. The effect is observed by measuring the non-linear impedance of the sensor. The TES is treated as a weakly linked superconducting system and within the resistively shunted junction model framework. We provide a full theoretical explanation of the results by finding the analytic solution of the non-inertial Langevian equation of the system and calculating the non-linear response of the detector to a large ac bias current in the presence of noise.

  6. Consistent behaviour of AC susceptibility and transport properties in magnetic superconductor RuSr 2GdCu 2O 8

    Science.gov (United States)

    Očko, M.; Živkovic, I.; Prester, M.; Drobac, Dj.; Ariosa, D.; Berger, H.; Pavuna, D.

    2004-02-01

    We report on AC susceptibility, resistivity, thermopower and measurements of sintered magnetic superconductor RuSr 2GdCu 2O 8. The antiferromagnetic phase transition at 133 K is seen clearly in the AC susceptibility as well as in the derivative of resistivity and thermopower. Above the antiferromagnetic transition, we have found some new evidences of the similarity between HTC compounds and the magnetic superconductor. The onset of superconductivity is observed by both transport methods at 46 K, and an explanation why it is not seen in the AC susceptibility data is given. The end of the SC transition occurs at about 24 K in all measured properties. We discuss the steps of broad SC transition, especially the maximum in susceptibility at 34 K, and compare our results with related studies reported in the literature.

  7. Consistent behaviour of AC susceptibility and transport properties in magnetic superconductor RuSr{sub 2}GdCu{sub 2}O{sub 8}

    Energy Technology Data Exchange (ETDEWEB)

    Ocko, M. E-mail: ocko@ifs.hr; Zivkovic, I.; Prester, M.; Drobac, Dj.; Ariosa, D.; Berger, H.; Pavuna, D

    2004-02-01

    We report on AC susceptibility, resistivity, thermopower and measurements of sintered magnetic superconductor RuSr{sub 2}GdCu{sub 2}O{sub 8}. The antiferromagnetic phase transition at 133 K is seen clearly in the AC susceptibility as well as in the derivative of resistivity and thermopower. Above the antiferromagnetic transition, we have found some new evidences of the similarity between HTC compounds and the magnetic superconductor. The onset of superconductivity is observed by both transport methods at 46 K, and an explanation why it is not seen in the AC susceptibility data is given. The end of the SC transition occurs at about 24 K in all measured properties. We discuss the steps of broad SC transition, especially the maximum in susceptibility at 34 K, and compare our results with related studies reported in the literature.

  8. Energy Transition Initiative: Islands Playbook (Book)

    Energy Technology Data Exchange (ETDEWEB)

    2015-01-01

    The Island Energy Playbook (the Playbook) provides an action-oriented guide to successfully initiating, planning, and completing a transition to an energy system that primarily relies on local resources to eliminate a dependence on one or two imported fuels. It is intended to serve as a readily available framework that any community can adapt to organize its own energy transition effort.

  9. Hysteresis and transition in swirling nonpremixed flames

    NARCIS (Netherlands)

    Tummers, M.J.; Hübner, A.W.; Veen, van E.H.; Hanjalic, K.; Meer, van der Th.H.

    2009-01-01

    Strongly swirling nonpremixed flames are known to exhibit a hysteresis when transiting from an attached long, sooty, yellow flame to a short lifted blue flame, and vice versa. The upward transition (by increasing the air and fuel flow rates) corresponds to a vortex breakdown, i.e. an abrupt change f

  10. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  11. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  12. Terminology used for renewable liquid and gaseous fuels based on the conversion of electricity: a review

    DEFF Research Database (Denmark)

    Ridjan, Iva; Mathiesen, Brian Vad; Connolly, David

    2016-01-01

    As the transport sector transitions away from fossil fuels and renewable fuels shift into focus, it is important that the terminology around renewable fuels is clarified. A number of terms such as synthetic fuel and electrofuel are used to describe both renewable and alternative fuels. The aim of...

  13. Economic aspects of Dukovany NPP fuel cycle

    International Nuclear Information System (INIS)

    The paper discusses some aspects of high burnup program implementation at Dukovany NPP and its influence on the fuel cycle costs. Dukovany internal fuel cycle is originally designed as a three years cycle of the Out-In-In fuel reloading patterns. These reloads are not only uneconomical but they additionally increased the radiation load of the reactor pressure vessel due to high neutron leakage typical for Out-In-In loading pattern. To avoid the high neutron leakage from the core a transition to 4-year fuel cycle is started in 1987. The neutron leakage from the core is sequentially decreased by insertion of older fuel assemblies at the core periphery. Other developments in fuel cycle are: 1) increasing of enrichment in control assemblies (3.6% of U-235); 2) improvement in fuel assembly design (reduce the assembly shroud thickness from 2.1 to 1.6 mm); 3) introduction of Zr spacer grid instead of stainless steel; 4) introduction of new type of assembly with profiled enrichment with average value of 3.82%. Due to increased reactivity of the new assemblies the transition to the partial 5-year fuel cycle is required. Typical fuel loading pattern for 3, 3.5, 4 and 5-year cycles are shown in the presented paper. An evaluation of fuel cost is also discussed by using comparative analysis of different fuel cycle options. The analysis shows that introduction of the high burnup program has decrease relative fuel cycle costs

  14. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  15. Fuel distribution

    Energy Technology Data Exchange (ETDEWEB)

    Tison, R.R.; Baker, N.R.; Blazek, C.F.

    1979-07-01

    Distribution of fuel is considered from a supply point to the secondary conversion sites and ultimate end users. All distribution is intracity with the maximum distance between the supply point and end-use site generally considered to be 15 mi. The fuels discussed are: coal or coal-like solids, methanol, No. 2 fuel oil, No. 6 fuel oil, high-Btu gas, medium-Btu gas, and low-Btu gas. Although the fuel state, i.e., gas, liquid, etc., can have a major impact on the distribution system, the source of these fuels (e.g., naturally-occurring or coal-derived) does not. Single-source, single-termination point and single-source, multi-termination point systems for liquid, gaseous, and solid fuel distribution are considered. Transport modes and the fuels associated with each mode are: by truck - coal, methanol, No. 2 fuel oil, and No. 6 fuel oil; and by pipeline - coal, methane, No. 2 fuel oil, No. 6 oil, high-Btu gas, medium-Btu gas, and low-Btu gas. Data provided for each distribution system include component makeup and initial costs.

  16. Power Electronic Transformer based Three-Phase PWM AC Drives

    Science.gov (United States)

    Basu, Kaushik

    A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common

  17. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  18. Dynamic Stark effect and forbidden-transition spectrallineshapes

    Energy Technology Data Exchange (ETDEWEB)

    Stalnaker, Jason E.; Budker, D.; Freedman, S.J.; Guzman, J.S.; Rochester, S.M.; Yashchuk, V.V.

    2005-12-15

    We report on an experimental and theoretical study of thedynamic (ac) Stark effect on a for bidden transition. A general frameworkfor parameterizing and describing off-resonant ac-Stark shifts ispresented. A model is developed to calculate spectral line shapesresulting from resonant excitation of atoms in an intense standinglight-wave in the presence of off-resonant ac-Stark shifts. The model isused in the analysis and interpretation of a measurement of the ac-Starkshifts of the static-electric-field-induced 6s2 1S0 -->5d6s 3D1transition at 408 nm in atomic Yb. The results are in agreement withestimates of the ac-Stark shift of the transition under the assumptionthat the shift is dominated by that of the 6s2 1S0 ground state. Adetailed description of the experiment and analysis is presented. Abi-product of this work is an ind ependent determination (from thesaturation behavior of the 408-nm transition) of the Stark transitionpolarizability, which is found to be in agreement with our earliermeasurement. This work is part of the ongoing effort aimed at a precisionmeasurement of atomic parity-violation effects in Yb.

  19. TMI Fuel Characteristics for Disposal Criticality Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Larry L. Taylor

    2003-09-01

    This report documents the reported contents of the Three Mile Island Unit 2 (TMI-2) canisters. proposed packaging, and degradation scenarios expected in the repository. Most fuels within the U.S. Department of Energy spent nuclear fuel inventory deal with highly enriched uranium, that in most cases require some form of neutronic poisoning inside the fuel canister. The TMI-2 fuel represents a departure from these fuel forms due to its lower enrichment (2.96% max.) values and the disrupted nature of the fuel itself. Criticality analysis of these fuel canisters has been performed over the years to reflect conditions expected during transit from the reactor to the Idaho National Engineering and Environmental Laboratory, water pool storage,1 and transport/dry-pack storage at Idaho Nuclear Technology and Engineering Center.2,3 None of these prior analyses reflect the potential disposal conditions for this fuel inside a postclosure repository.

  20. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  1. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  2. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  3. Wetting transitions

    International Nuclear Information System (INIS)

    When a liquid droplet is put onto a surface, two situations distinguishable by the contact angle may result. If the contact angle is zero, the droplet spreads across the surface, a situation referred to as complete wetting. On the other hand, if the contact angle is between 0 deg. and 180 deg., the droplet does not spread, a situation called partial wetting. A wetting transition is a surface phase transition from partial wetting to complete wetting. We review the key experimental findings on this transition, together with simple theoretical models that account for the experiments. The wetting transition is generally first order (discontinuous), implying a discontinuity in the first derivative of the surface free energy. In this case, if one measures the thickness of the adsorbed film beside the droplet, at the wetting transition a discontinuous jump in film thickness occurs from a microscopically thin to a thick film. We show that this can lead to the observation of metastable surface states and an accompanying hysteresis. The observed hysteresis poses, in turn, a number of questions concerning the nucleation of wetting films that we also consider here. In addition, we consider the equilibrium wetting film thickness that results from a competition between the long-range van der Waals forces and gravity. Finally, the first-order character of the wetting transition can lead to a similar transition even when the phase that does the wetting is not (yet) stable in the bulk. For such prewetting transitions, a discontinuous thin-to-thick film transition occurs off bulk coexistence. We show that, for the large variety of systems for which prewetting transitions have been observed, the behaviour is surprisingly uniform, and can be mapped onto a simple generic phase diagram. The second part of the review deals with the exceptions to the first-order nature of the wetting transition. Two different types of continuous or critical wetting transition have been reported, for which

  4. The system architecture for renewable synthetic fuels

    DEFF Research Database (Denmark)

    Ridjan, Iva

    To overcome and eventually eliminate the existing heavy fossil fuels in the transport sector, there is a need for new renewable fuels. This transition could lead to large capital costs for implementing the new solutions and a long time frame for establishing the new infrastructure unless a suitab...

  5. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  6. Phase transitions

    CERN Document Server

    Solé, Ricard V

    2011-01-01

    Phase transitions--changes between different states of organization in a complex system--have long helped to explain physics concepts, such as why water freezes into a solid or boils to become a gas. How might phase transitions shed light on important problems in biological and ecological complex systems? Exploring the origins and implications of sudden changes in nature and society, Phase Transitions examines different dynamical behaviors in a broad range of complex systems. Using a compelling set of examples, from gene networks and ant colonies to human language and the degradation o

  7. Bio-, recycling- and waste fuels. How does the transition to renewable energy-sources affect the Swedish power and heat preparedness; Bio-, retur- och avfallsbraenslen. Hur oevergaangen till foernybara energikaellor paaverkar Sveriges el- och vaermeberedskap

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-02-01

    The total energy supply in Sweden amounted to 600 TWh in 2000. Close to 100 TWh of these were Bio-, recycling- and waste-fuels (BRW), which means that the use of these fuels has tripled during the last decade. BRW stand for half the energy supply to district heating in Sweden. A large number of heat and power plants built for fossil fuels have been converted to BRW, and several new plants designed for biofuels have been taken into operation. Upgraded biofuels (briquets, pellets and powders) have substituted fuel oil in households and small heating networks. These developments make it important to study issues about safety of supply and emergency planning. In difference to fossil fuels there is no obligation to set up emergency stocks of BRW in Sweden. In combination with an increased dependence on logistics this means that the preparedness in short time emergency situations has deteriorated. For short periods, fuel oil and coal can however be used as replacement fuels. The increased know-how on producing, handling, transport and combustion of BRW is, on the other hand, a great asset for Sweden both in normal and emergency situations.

  8. Fuel Cells

    DEFF Research Database (Denmark)

    Smith, Anders; Pedersen, Allan Schrøder

    2014-01-01

    Fuel cells have been the subject of intense research and development efforts for the past decades. Even so, the technology has not had its commercial breakthrough yet. This entry gives an overview of the technological challenges and status of fuel cells and discusses the most promising applications...... of the different types of fuel cells. Finally, their role in a future energy supply with a large share of fluctuating sustainable power sources, e.g., solar or wind, is surveyed....

  9. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  10. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  11. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  12. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  13. Nuclear fuel

    International Nuclear Information System (INIS)

    All stages of nuclear fuel cycle are analysed with respect to the present situation and future perspectives of supply and demand of services; the prices and the unitary cost estimation of these stages for the international fuel market are also mentioned. From the world resources and projections of uranium consumption, medium-and long term analyses are made of fuel availability for several strategies of use of different reactor types. Finally, the cost of nuclear fuel in the generation of electric energy is calculated to be used in the energetic planning of the electric sector. (M.A.)

  14. Modelling and control of hybrid renewable energy system connected to AC grid

    Directory of Open Access Journals (Sweden)

    Sami Younsi

    2011-12-01

    Full Text Available This paper discusses the development of new control and supervision method for the optimum operation of hybrid renewable energy system (HRES connected to AC grid. The hybrid system consists of wind generator (WG, diesel generator (DG, and flywheel energy storage system (FESS. These subsystems are based on permanent magnet synchronous machines (PMSM which are controlled by sliding mode control. A supervisor control is designed to determine the energy transfer type of flywheel energy storage system (charging / discharging / no transfer energy, to take decision on diesel generators ON/OFF status, and to determine the reference powers for these two subsystems. The supervisor inputs are the power requested by AC grid, the power generated by wind generator, and the energy stored in flywheel. The objectives of the control and supervision for hybrid renewable energy system are to satisfy the power requested by AC grid, to manage the energy transfer between hybrid system and AC grid, to optimize the use of wind energy, and to reduce fuel of diesel generator. The system is simulated with Matlab – Simulink software and it gave good results.

  15. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  16. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  17. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  18. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  19. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  20. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  1. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  2. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  3. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Directory of Open Access Journals (Sweden)

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  4. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  5. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  6. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  7. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    OpenAIRE

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  8. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Directory of Open Access Journals (Sweden)

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  9. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  10. A new class of hybrid AC/AC direct power converters

    OpenAIRE

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  11. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    OpenAIRE

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  12. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  13. Transition? What transition? : Changing energy systems in an increasingly carbon constrained world

    NARCIS (Netherlands)

    Mc Cahery, J.A.; Lopez de Silanes, Florencio; de Roode, Alexander

    2014-01-01

    Energy transitions have been taking place continuously since the Industrial Revolution. These transitions primarily involve national energy mixes. In general, countries keep moving up the energy ladder, meaning that they integrate larger and larger proportions of specialized fuels into their energy

  14. Fuel cells:

    DEFF Research Database (Denmark)

    Sørensen, Bent

    2013-01-01

    A brief overview of the progress in fuel cell applications and basic technology development is presented, as a backdrop for discussing readiness for penetration into the marketplace as a solution to problems of depletion, safety, climate or environmental impact from currently used fossil...... and nuclear fuel-based energy technologies....

  15. Nuclear fuel

    International Nuclear Information System (INIS)

    It is expected that nuclear power generation will reach 49 million kW in 1985 and 129 million kW in 1995, and the nuclear fuel having to be supplied and processed will increase in proportion to these values. The technical problems concerning nuclear fuel are presented on the basis of the balance between the benefit for human beings and the burden on the human beings. Recently, especially the downstream of nuclear fuel attracts public attention. Enriched uranium as the raw material for light water reactor fuel is almost monopolized by the U.S., and the technical information has not been published for fear of the diversion to nuclear weapons. In this paper, the present situations of uranium enrichment, fuel fabrication, transportation, reprocessing and waste disposal and the future problems are described according to the path of nuclear fuel cycle. The demand and supply of enriched uranium in Japan will be balanced up to about 1988, but afterwards, the supply must rely upon the early establishment of the domestic technology by centrifugal separation method. No problem remains in the fabrication of light water reactor fuel, but for the fabrication of mixed oxide fuel, the mechanization of the production facility and labor saving are necessary. The solution of the capital risk for the construction of the second reprocessing plant is the main problem. Japan must develop waste disposal techniques with all-out efforts. (Kako, I.)

  16. AC losses in a HTS coil carrying DC current in AC external magnetic field

    International Nuclear Information System (INIS)

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  17. AC Conductivity and Dielectric Relaxation Behavior of Sb2S3 Bulk Material

    Science.gov (United States)

    Abd El-Rahman, K. F.; Darwish, A. A. A.; Qashou, Saleem I.; Hanafy, T. A.

    2016-07-01

    The Sb2S3 bulk material was used for next-generation anode for lithium-ion batteries. Alternative current (AC) conductivity, dielectric properties and electric modulus of Sb2S3 have been investigated. The measurements were carried out in the frequency range from 40 Hz to 5 MHz and temperature range from 293 K to 453 K. The direct current (DC) conductivity, σ DC, shows an activated behavior and the calculated activation energy is 0.50 eV. The AC conductivity, σ AC, was found to increase with the increase of temperature and frequency. The conduction mechanism of σ AC was controlled by the correlated barrier hopping model. The behavior of the dielectric constant, ɛ', and dielectric loss index, ɛ'', reveal that the polarization process of Sb2S3 is dipolar in nature. The behavior of both ɛ' and ɛ'' reveals that bulk Sb2S3 has no ferroelectric or piezoelectric phase transition. The dielectric modulus, M, gives a simple method for evaluating the activation energy of the dielectric relaxation. The calculated activation energy from M is 0.045 eV.

  18. A novel wireless power and data transmission AC to DC converter for an implantable device.

    Science.gov (United States)

    Liu, Jhao-Yan; Tang, Kea-Tiong

    2013-01-01

    This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz. PMID:24110077

  19. Ac Stark splitting in multiphoton excitation of atomic hydrogen in flames: Abnormal peak asymmetry due to pressure broadening

    International Nuclear Information System (INIS)

    A theory of ac Stark (or Autler-Townes) splitting occurring in double optical resonances, one of which is a two-photon transition is developed. Both laser bandwidth and collisional broadening effects are included. Theoretical results are in excellent agreement with Goldsmith's observation of two-peaked structures in the multiphoton excitation spectra of atomic hydrogen in atmospheric-pressure flames. This is believed to be the first study demonstrating that the peak asymmetry in an ac Stark doublet can be reversed due to pressure broadening

  20. Use of Pyrolyzed Iron Ethylenediaminetetraacetic Acid Modified Activated Carbon as Air–Cathode Catalyst in Microbial Fuel Cells

    KAUST Repository

    Xia, Xue

    2013-08-28

    Activated carbon (AC) is a cost-effective catalyst for the oxygen reduction reaction (ORR) in air-cathode microbial fuel cells (MFCs). To enhance the catalytic activity of AC cathodes, AC powders were pyrolyzed with iron ethylenediaminetetraacetic acid (FeEDTA) at a weight ratio of FeEDTA:AC = 0.2:1. MFCs with FeEDTA modified AC cathodes and a stainless steel mesh current collector produced a maximum power density of 1580 ± 80 mW/m2, which was 10% higher than that of plain AC cathodes (1440 ± 60 mW/m 2) and comparable to Pt cathodes (1550 ± 10 mW/m2). Further increases in the ratio of FeEDTA:AC resulted in a decrease in performance. The durability of AC-based cathodes was much better than Pt-catalyzed cathodes. After 4.5 months of operation, the maximum power density of Pt cathode MFCs was 50% lower than MFCs with the AC cathodes. Pyridinic nitrogen, quaternary nitrogen and iron species likely contributed to the increased activity of FeEDTA modified AC. These results show that pyrolyzing AC with FeEDTA is a cost-effective and durable way to increase the catalytic activity of AC. © 2013 American Chemical Society.

  1. Application of PEI–K2CO3/AC for capturing CO2 from flue gas after combustion

    International Nuclear Information System (INIS)

    Highlights: • A novel PEI–K2CO3/AC sorbent was prepared with the co-impregnation method. • The coupling characteristics of PEI and K2CO3 in the sorbent are expounded. • Both PEI and K2CO3 contribute to the total CO2 capture capacity of PEI–K2CO3/AC. • PEI–K2CO3/AC presents high CO2 capture capacity and long-term stability. • PEI–K2CO3/AC should be considered as a new option for post-combustion CO2 capture. - Abstract: The capture of CO2 from flue gas after combustion using solid sorbents is one of the efficient options for reducing CO2 emissions from fossil fuel-fired power plants. To satisfy the requirement of large quantities flue gas treatment, the CO2 capture capacities of the solid sorbents must be focused on. In order to obtain a sorbent with high CO2 capture capacity, a novel PEI–K2CO3/AC sorbent was prepared by impregnating potassium carbonate (K2CO3) and polyethylenimine (PEI) on activated carbon (AC) in this work. The CO2 capture performance of this sorbent was investigated using a fixed bed reactor system. The CO2 capture capacity of PEI–K2CO3/AC with the total K2CO3 and PEI loadings of 50 wt% was measured as 3.60 mmol CO2/g under the condition of 60 °C, 8% CO2 + 10% H2O. In addition, this sorbent is proved to be regenerable and stable during 5 cycle CO2 sorption–desorption tests. Compared with K2CO3/AC (loading of 58 wt%) and PEI/AC (loading of 43 wt%), PEI–K2CO3/AC presents higher CO2 capture capacity and long-term stability. Therefore, PEI–K2CO3/AC should be considered as a new option for capturing CO2 from flue gas after combustion

  2. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  3. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an...

  4. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  5. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  6. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  7. Analysis of DC/DC Converter Efficiency for Energy Storage System Based on Bidirectional Fuel Cells

    DEFF Research Database (Denmark)

    Pittini, Riccardo; Zhang, Zhe; Andersen, Michael A. E.

    2013-01-01

    Renewable energy sources are fluctuating depending on the availability of the energy source. For this reason, energy storage is becoming more important and bidirectional fuel cells represent an attractive technology. Fuel cells require highcurrent low-voltage dc-dc or dc-ac converters as power in...

  8. Development of a 200kW multi-fuel type PAFC power plant

    Energy Technology Data Exchange (ETDEWEB)

    Take, Tetsuo; Kuwata, Yutaka; Adachi, Masahito; Ogata, Tsutomu [NTT Integrated Information & Energy System Labs., Tokyo (Japan)

    1996-12-31

    Nippon Telegraph and Telephone Corporation (NFT) has been developing a 200 kW multi-fuel type PAFC power plant which can generate AC 200 kW of constant power by switching fuel from pipeline town gas to liquefied propane gas (LPG) and vice versa. This paper describes the outline of the demonstration test plant and test results of its fundamental characteristics.

  9. 76 FR 49525 - Advisory Circular 20-24C, Approval of Propulsion Fuels and Lubricating Oils

    Science.gov (United States)

    2011-08-10

    ... adding fuels and oils to type certificates as engine, aircraft, or auxiliary power unit (APU) operating... adding fuels and oils as engine, aircraft, or APU operating limitations. These established methods..., aircraft, or APU operating limitations in lieu of the methods described in the AC. However, the EPD...

  10. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  11. Entropy production in ac-calorimetry

    OpenAIRE

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  12. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  13. Transitional Shelter

    OpenAIRE

    Shiozaki, Yoshimitsu; TANAKA, Yasuo; Hokugo, Akihiko; Bettencourt, Sofia

    2013-01-01

    Transitional shelter can play a crucial role in housing reconstruction following a mega disaster. Reconstruction of permanent housing cannot move forward until a number of complex issues are settled, such as relocation planning and removal of debris. Even after plans are agreed on and reconstruction begins, it may take several years for permanent housing to be completed. In this context, a...

  14. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  15. Biodiesel/ULSD blend ratios by analysis of fuel properties

    Science.gov (United States)

    Biodiesel is an alternative fuel that is made from vegetable oil or animal fat. Biodiesel is often blended with ultra low sulfur diesel (ULSD; 15 mg/kg maximum sulfur content) in volumetric ratios (VBD) of up to 20 vol% (B20). Government tax credits and other regulatory requirements may depend on ac...

  16. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  17. Standard Fire Behavior Fuel Models : A Comprehensive Set for Use with Rothermel's Surface Fire Spread Model

    OpenAIRE

    Scott, Joe H; Burgan, Robert E

    2005-01-01

    This report describes a new set of standard fire behavior fuel models for use with Rothermel’s surface fire spread model and the relationship of the new set to the original set of 13 fire behavior fuel models. To assist with transition to using the new fuel models, a fuel model selection guide, fuel model crosswalk, and set of fuel model photos are provided.

  18. Fuel cells

    Directory of Open Access Journals (Sweden)

    D. N. Srivastava

    1962-05-01

    Full Text Available The current state of development of fuel cells as potential power sources is reviewed. Applications in special fields with particular reference to military requirements are pointed out.

  19. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  20. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  1. Fuel assembly

    International Nuclear Information System (INIS)

    Purpose: To reconstruct a BWR type reactor into a high conversion reactor with no substantial changes for the reactor inner structure such as control rod structure. Constitution: The horizontal cross sectional shape of a channel box is reformed into a square configuration and the arrangement of fuel rods is formed as a trigonal lattice-like configuration. As a method of improving the conversion ratio, there is considered to use a dense lattice by narrowing the distance between fuel rods and trigonal lattice arrangement for fuel rod is advantageous therefor. A square shape cross sectional configuration having equal length both in the lateral and longitudinal directions is suitable for the channel box as a guide upon movement of the control rod. Fuel rods can be arranged with no loss by the trigonal lattice configuration, by which it is possible to improve the neutron moderation, increase the reactor core reactivity and conduct effective fuel combustion. In this way, it is possible to attain the object by inserting the follower portion of the control rod at the earier half and extracting the same at the latter half during the operation period in the reactor core comprising fuel assemblies suitable to a high conversion BWR type reactor having average conversion ratio of about 0.8. (Kamimura, M.)

  2. Local Fuel Rod Crud Prediction Tool Applications

    Energy Technology Data Exchange (ETDEWEB)

    Krammen, Michael A.; Karoutas, Zeses E.; Wang, Guoqiang; Young, Michael Y

    2009-06-15

    response to two CILC fuel failures observed in a reactor plant where fuel rod crudding was not initially of concern due to negligible predicted fuel rod steaming on a fuel assembly sub-channel scale. The fuel rod crud observed in the reactor cycle with the fuel rod CILC failures was very localized, but was heaviest on those fuel rods with relatively higher fuel rod duty. These indications led to development of the more locally detailed predictive capability. And, based on the observed behavior, guideline limits have been established by benchmarking the methodology to the fuel rod crud induced fuel failures. The guideline limits are used in designing fuel managements. Application of these tools in subsequent fuel management design for later reactor cycles in both the plant where the CILC fuel failures occurred and in its sister plant with similar operating characteristics have avoided a recurrence of the CILC fuel failure. These tools were also used when a new fuel design with mixing vane grids was introduced in two plants previously fueled with non-mixing vane grids. The predictive tools account for the thermal hydraulic transition core effects. Interestingly, the plant with the generally higher fuel duty, a plant that had experienced Crud Induced Power Shift (CIPS) in earlier cycles, is predicted to easily meet the CIPS and CILC guidelines for the transition and following cycle. While the other plant, which has not experienced CIPS in earlier cycles, is predicted to be operating close to the CILC guideline limits in the transition cycle. The higher duty plant is predicted to have appreciable fuel rod surface area that is steaming over the reactor cycle, while the lower duty plant is predicted to have relatively little fuel rod surface area in steaming. The interpretation is that with a relatively similar crud source in the coolant, a smaller steaming surface area may act as a stronger sink for the available crud, resulting in locally thicker crud. This is a similar

  3. A nuclear reactor core fuel reload optimization using Artificial-Ant-Colony Connective Networks

    International Nuclear Information System (INIS)

    A Pressurized Water Reactor core must be reloaded every time the fuel burnup reaches a level when it is not possible to sustain nominal power operation. The nuclear core fuel reload optimization consists in finding a burned-up and fresh-fuel-assembly pattern that maximizes the number of full operational days. This problem is NP-hard, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Besides that, the problem is non-linear and its search space is highly discontinual and multimodal. In this work a parallel computational system based on Ant Colony System (ACS) called Artificial-Ant-Colony Networks is introduced to solve the nuclear reactor core fuel reload optimization problem. ACS is a system based on artificial agents that uses the reinforcement learning technique and was originally developed to solve the Traveling Salesman Problem, which is conceptually similar to the nuclear fuel reload problem. (author)

  4. Dynamic Systems Analysis Report for Nuclear Fuel Recycle

    Energy Technology Data Exchange (ETDEWEB)

    Brent Dixon; Sonny Kim; David Shropshire; Steven Piet; Gretchen Matthern; Bill Halsey

    2008-12-01

    This report examines the time-dependent dynamics of transitioning from the current United States (U.S.) nuclear fuel cycle where used nuclear fuel is disposed in a repository to a closed fuel cycle where the used fuel is recycled and only fission products and waste are disposed. The report is intended to help inform policy developers, decision makers, and program managers of system-level options and constraints as they guide the formulation and implementation of advanced fuel cycle development and demonstration efforts and move toward deployment of nuclear fuel recycling infrastructure.

  5. Transition Operators

    CERN Document Server

    Alcock-Zeilinger, Judith

    2016-01-01

    In this paper, we give a generic algorithm of the transition operators between Hermitian Young projection operators corresponding to equivalent irreducible representations of SU(N), using the compact expressions of Hermitian Young projection operators derived in a companion paper. We show that the Hermitian Young projection operators together with their transition operators constitute a fully orthogonal basis for the algebra of invariants of $V^{\\otimes m}$ that exhibits a systematically simplified multiplication table. We discuss the full algebra of invariants over $V^{\\otimes 3}$ and $V^{\\otimes 4}$ as explicit examples. In our presentation we make use of various standard concepts such as Young projection operators, Clebsch-Gordan operators, and invariants (in birdtrack notation). We tie these perspectives together and use them to shed light on each other.

  6. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  7. Germany: energy transition or revolution

    International Nuclear Information System (INIS)

    Germany has decided to phase out nuclear power by 2022 but it wants also to get rid of fossil energies by 2050. Those ambitious goals imply to be able to cut by half the demand for primary energy by 2050 which will be only possible if the need for building heating is cut by 80%, the constraint on transport is less important: one million of electrical vehicles will have to be on the road by 2020 and 3 millions 10 years later. In 2012 the production of electricity was made mainly from coal (44.7%), renewable energies (21.9%), nuclear energy (16%), natural gas (11.3%) and other energies (fuel...) (6.1%). Today the renewable energy sector is a major industrial sector in Germany, it represents about 382000 jobs directly or indirectly, it means more than the sector of conventional energies. (A.C.)

  8. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled......-second average at its output, while simultaneously achieving inductive voltage boosting by shooting through either an appropriately selected inverter phase-leg or two phase-legs being commanded simultaneously. More interestingly, these performance features are achieved with no increase in the number...

  9. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications

    OpenAIRE

    Vuorsalo, Simo

    2015-01-01

    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  10. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    Directory of Open Access Journals (Sweden)

    S. Arumugam S. Ramareddy M. Sridhar

    2011-12-01

    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  11. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... a low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  12. Technological Change during the Energy Transition

    OpenAIRE

    van der Meijden, Gerard; Smulders, Sjak

    2014-01-01

    The energy transition from fossil fuels to alternative energy sources has important consequences for technological change and resource extraction. We examine these consequences by incorporating a non-renewable resource and an alternative energy source in a market economy model of endogenous growth through expanding varieties. During the energy transition, technological progress is non-monotonic over time: it declines initially, starts increasing when the economy approaches the regime shift, a...

  13. Fuel assembly

    International Nuclear Information System (INIS)

    Since the neutron flux distribution and the power distribution of a fuel assembly in which short fuel rods vary greatly in the vicinity of a boundary where the distribution of uranium amount is different, the reading value of local power range monitors, having the detectors positioned in the vicinity of the boundary is varied. Then in the present invention, the upper end of the effective axial length of fuel rod is so made as not approaching with the detection position of the local power range monitor in a reactor core. Further, the upper end of the effective axial length of fuel rods in a 4 x 4 fuel rod lattice positioned at the corner on the side of the local power range monitor is so made as not approaching the detection position of the local power range monitor. As a result, the change of the neutron flux distribution and power distribution in the vicinity of the position where the detector of the local power range monitor is situated can be extremely reduced. Accordingly, there is no scattering and fluctuation for the reading value by the local power range monitor, to improve the monitoring performance for thermal characteristics in the reactor core. (N.H.)

  14. The legacy of fossil fuels.

    Science.gov (United States)

    Armaroli, Nicola; Balzani, Vincenzo

    2011-03-01

    Currently, over 80% of the energy used by mankind comes from fossil fuels. Harnessing coal, oil and gas, the energy resources contained in the store of our spaceship, Earth, has prompted a dramatic expansion in energy use and a substantial improvement in the quality of life of billions of individuals in some regions of the world. Powering our civilization with fossil fuels has been very convenient, but now we know that it entails severe consequences. We treat fossil fuels as a resource that anyone anywhere can extract and use in any fashion, and Earth's atmosphere, soil and oceans as a dump for their waste products, including more than 30 Gt/y of carbon dioxide. At present, environmental legacy rather than consistence of exploitable reserves, is the most dramatic problem posed by the relentless increase of fossil fuel global demand. Harmful effects on the environment and human health, usually not incorporated into the pricing of fossil fuels, include immediate and short-term impacts related to their discovery, extraction, transportation, distribution, and burning as well as climate change that are spread over time to future generations or over space to the entire planet. In this essay, several aspects of the fossil fuel legacy are discussed, such as alteration of the carbon cycle, carbon dioxide rise and its measurement, greenhouse effect, anthropogenic climate change, air pollution and human health, geoengineering proposals, land and water degradation, economic problems, indirect effects on the society, and the urgent need of regulatory efforts and related actions to promote a gradual transition out of the fossil fuel era. While manufacturing sustainable solar fuels appears to be a longer-time perspective, alternatives energy sources already exist that have the potential to replace fossil fuels as feedstocks for electricity production.

  15. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  16. AC Electric Field Activated Shape Memory Polymer Composite

    Science.gov (United States)

    Kang, Jin Ho; Siochi, Emilie J.; Penner, Ronald K.; Turner, Travis L.

    2011-01-01

    Shape memory materials have drawn interest for applications like intelligent medical devices, deployable space structures and morphing structures. Compared to other shape memory materials like shape memory alloys (SMAs) or shape memory ceramics (SMCs), shape memory polymers (SMPs) have high elastic deformation that is amenable to tailored of mechanical properties, have lower density, and are easily processed. However, SMPs have low recovery stress and long response times. A new shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive fillers to enhance its thermo-mechanical characteristics. A new composition of shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive functionalized graphene sheets (FGS) to enhance its thermo-mechanical characteristics. The elastic modulus of LaRC-SMPC is approximately 2.7 GPa at room temperature and 4.3 MPa above its glass transition temperature. Conductive FGSs-doped LaRC-SMPC exhibited higher conductivity compared to pristine LaRC SMP. Applying an electric field at between 0.1 Hz and 1 kHz induced faster heating to activate the LaRC-SMPC s shape memory effect relative to applying DC electric field or AC electric field at frequencies exceeding1 kHz.

  17. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  18. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  19. An ac biased superconducting flux transformer

    International Nuclear Information System (INIS)

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  20. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  1. Transitioning to Biofuels: A System-of-Systems Perspective; Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Riley, C.; Sandor, D.

    2008-06-01

    Using the existing fuel supply chain infrastructure as a framework, this paper discusses a vision for transitioning to a larger biofuels industry and the challenges associated with a massive market and infrastructure transformation.

  2. Fuel flowmeters - measurements of fuel consumption

    OpenAIRE

    Nešpor, Martin

    2012-01-01

    This work is devoted to measuring the fuel consumption. Generally deals with factors affecting consumption and fuels. Furthermore, it describes methods of measuring fuel consumption under the driving modes. Finally, the paper deals with the calculations, the actual selection of fuel gauge, economy and efficiency evaluation of fuel consumption. The conclusion of this work summarizes the above findings.

  3. AC susceptibility studies of the superconductivity of PrOs4Sb12

    International Nuclear Information System (INIS)

    We report the superconducting phase diagram of PrOs4Sb12 deduced from the real-part χ' and the imaginary part χ'' of the AC susceptibility. The double transition at Tc1=1.85K and Tc2=1.75K seen in the specific heat may be related to features in χ' and χ'', where full diamagnetic shielding is observed below Tc2 only. As function of magnetic field the phase bounded by Tc2 displays features reminiscent of the peak effect

  4. Transit space

    DEFF Research Database (Denmark)

    Raahauge, Kirsten Marie

    2008-01-01

    This article deals with representations of one specific city, Århus, Denmark, especially its central district. The analysis is based on anthropological fieldwork conducted in Skåde Bakker and Fedet, two well-off neighborhoods. The overall purpose of the project is to study perceptions of space...... and the interaction of cultural, social, and spatial organizations, as seen from the point of view of people living in Skåde Bakker and Fedet. The focus is on the city dwellers’ representations of the central district of Århus with specific reference to the concept of transit space. When applied to various Århusian...

  5. Immobilization of a Metal-Nitrogen-Carbon Catalyst on Activated Carbon with Enhanced Cathode Performance in Microbial Fuel Cells.

    Science.gov (United States)

    Yang, Wulin; Logan, Bruce E

    2016-08-23

    Applications of microbial fuel cells (MFCs) are limited in part by low power densities mainly due to cathode performance. Successful immobilization of an Fe-N-C co-catalyst on activated carbon (Fe-N-C/AC) improved the oxygen reduction reaction to nearly a four-electron transfer, compared to a twoelectron transfer achieved using AC. With acetate as the fuel, the maximum power density was 4.7±0.2 W m(-2) , which is higher than any previous report for an air-cathode MFC. With domestic wastewater as a fuel, MFCs with the Fe-N-C/AC cathode produced up to 0.8±0.03 W m(-2) , which was twice that obtained with a Pt-catalyzed cathode. The use of this Fe-N-C/AC catalyst can therefore substantially increase power production, and enable broader applications of MFCs for renewable electricity generation using waste materials.

  6. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    Directory of Open Access Journals (Sweden)

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  7. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica

    OpenAIRE

    Ranz Guerra, Carlos; Cobo, Pedro

    2000-01-01

    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  8. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC03Q....Seq.d/ Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  9. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC20Q.Seq.d/ Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  10. Use of silicide fuel in the Ford Nuclear Reactor - to lengthen fuel element lifetimes

    Energy Technology Data Exchange (ETDEWEB)

    Bretscher, M.M.; Snelgrove, J.L. [Argonne National Lab., IL (United States); Burn, R.R.; Lee, J.C. [Univ. of Michigan, Ann Arbor, MI (United States). Phoenix Memorial Lab.

    1995-12-31

    Based on economic considerations, it has been proposed to increase the lifetime of LEU fuel elements in the Ford Nuclear Reactor by raising the {sup 235}U plate loading from 9.3 grams in aluminide (UAl{sub x}) fuel to 12.5 grams in silicide (U{sub 3}Si{sub 2}) fuel. For a representative core configuration, preliminary neutronic depletion and steady state thermal hydraulic calculations have been performed to investigate core characteristics during the transition from an all-aluminide to an all-silicide core. This paper discusses motivations for this fuel element upgrade, results from the calculations, and conclusions.

  11. Transactions of the Second Annual Congress of the Sociedad Nuclear Mexicana A.C

    International Nuclear Information System (INIS)

    With no doubt, 1991 has been a good year for Nuclear Energy in Mexico. The record imposed by Laguna Verde Nuclear Power Plant, the first in his type in the world, operating without interruption in its first operating cycle, represents a splendid incentive for we all the nuclear workers. This fact is reflected in the percentage of papers presented in this congress, dealing with several aspects of Laguna Verde Central. This achievement should serve as an impulse for the development of other areas of application of nuclear energy in the country and at the same time be a reflection of the participation of the members of our society with good quality papers. In this Second Congress of Sociedad Nuclear Mexicana A.C., around thirty papers were presented in the technical sessions, in areas as: fuel management, radiation protection, reactor physics, transients analysis, nuclear materials and others. A special section is dedicated to present the experiences of the first fuel reload of Unit 1 in Laguna Verde Nuclear Power Plant,as well as different plenary meetings dedicated to subjects of general interest as advanced reactors, waste disposal and others. It is the wish of all the members of Sociedad Nuclear Mexicana A.C., that this annual meetings will be enriched with the enthusiastic participation of the scholars of nuclear field and that they represent the forum that we all need for the exchange of knowledge and experiences. (Author)

  12. Fuel Cells

    Science.gov (United States)

    Hawkins, M. D.

    1973-01-01

    Discusses the theories, construction, operation, types, and advantages of fuel cells developed by the American space programs. Indicates that the cell is an ideal small-scale power source characterized by its compactness, high efficiency, reliability, and freedom from polluting fumes. (CC)

  13. Transport fuel

    DEFF Research Database (Denmark)

    Ronsse, Frederik; Jørgensen, Henning; Schüßler, Ingmar;

    2014-01-01

    Worldwide, the use of transport fuel derived from biomass increased four-fold between 2003 and 2012. Mainly based on food resources, these conventional biofuels did not achieve the expected emission savings and contributed to higher prices for food commod - ities, especially maize and oilseeds...

  14. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...

  15. Estudio acústico del Conservatorio de Piles

    OpenAIRE

    VILLA MORANT, SARA

    2014-01-01

    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  16. Control of high-frequency AC link electronic transformer

    OpenAIRE

    Krishnaswami, H; Ramanarayanan, V.

    2005-01-01

    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  17. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  18. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  19. Characterization of the 309 fuel examination facility

    Energy Technology Data Exchange (ETDEWEB)

    Greenhalgh, W.O.; Cornwell, B.C.

    1997-07-09

    This document identifies radiological, chemical and physical conditions inside the Fuel Examination Facility. It is located inside the Plutonium Recycle Test Reactor containment structure (309 Building.) The facility was a hot cell used for examination of PRTR fuel and equipment during the 1960`s. Located inside the cell is a PRTR shim rod assembly, reported are radiological conditions of the sample. The conditions were assessed as part of overall 309 Building transition.

  20. Evaluation of a.c. conductivity behaviour of graphite filled polysulphide modified epoxy composites

    Indian Academy of Sciences (India)

    Navin Chand; Deepak Jain

    2004-06-01

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled and unfilled epoxy composites. It was observed that the dielectric constant, tan and a.c. conductivity increase with increasing temperature. Near the transition temperature the materials show anomalous behaviour for the observed properties. Peaks of dielectric constant, tan and a.c. conductivity were observed to shift towards lower temperature with increasing frequency. Clear relaxation (tan ) peaks around 169°C were observed in epoxy resin, which shifted to lower temperature side on increasing the frequency. Addition of 2.91 wt% graphite shifted the tan peaks towards higher temperature side by creating hindrances to the rotation of polymer dipoles. Addition of 2.91 wt% graphite leads to an increased relaxation time of dipoles in polysulphide epoxy from 1.44 × 10-5-3.92 × 10-5 (s) at 90°C by creating the hindrance to the rotation of dipoles.

  1. Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing

    CERN Document Server

    Gottardi, Luciano; de Korte, Piet A J; Hartog, Roland Den; Dirks, Bob; Popescu, Manuela; Hoevers, Henk F C; Bruijn, Marcel; Borderias, Maria Parra; Takei, Y

    2016-01-01

    We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDMconfiguration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/RN < 0.5). The measured energy resolution at 5.89keV is 2.7eV for DC bias and 3.7eV for AC bias, while the baseline resolution is 2.8eV and 3.3eV, respectively.

  2. Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing

    International Nuclear Information System (INIS)

    We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDM configuration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10 MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370 kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/RN<0.5). The measured energy resolution at 5.89 keV is 2.7 eV for DC bias and 3.7 eV for AC bias, while the baseline resolution is 2.8 eV and 3.3 eV, respectively.

  3. Technological Change During the Energy Transition

    NARCIS (Netherlands)

    van der Meijden, G.C.; Smulders, Sjak A.

    2014-01-01

    The energy transition from fossil fuels to alternative energy sources has important consequences for technological change and resource extraction. We examine these consequences by incorporating a non-renewable resource and an alternative energy source in a market economy model of endogenous growth t

  4. Energy policy. Framework conditions for the transition from fossil fuels to renewable energies. Ambitions of energy policy in conflict with economic reality?; Energiepolitik. Rahmenbedingungen fuer die Entwicklung von fossilen Brennstoffen zu erneuerbaren Energien. Oekonomische Realitaet im Konflikt zu energiepolitischen Ambitionen?

    Energy Technology Data Exchange (ETDEWEB)

    Reimer, Simon

    2011-07-01

    It is shown how the future development of individual renewable energy resources depends on whether statutory and other measures make it possible to achieve market penetration in conformity with competition law. Economic promotion of renewable energies is warranted for reasons of climate protection. However it is unclear to what extent renewable resources in their entirety can secure an economically sustainable energy supply. The present study looks at the possible future development of selected fossil fuels and renewable energy resources. It also examines what political framework conditions, instruments and measures might serve to steer this development and achieve envisioned goals.

  5. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Science.gov (United States)

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  6. Long Beach Transit: Two-Year Evaluation of Gasoline-Electric Hybrid Transit Buses

    Energy Technology Data Exchange (ETDEWEB)

    Lammert, M.

    2008-06-01

    This report focuses on a gasoline-electric hybrid transit bus propulsion system. The propulsion system is an alternative to standard diesel buses and allows for reductions in emissions (usually focused on reductions of particulate matter and oxides of nitrogen) and petroleum use. Gasoline propulsion is an alternative to diesel fuel and hybrid propulsion allows for increased fuel economy, which ultimately results in reduced petroleum use.

  7. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  8. An ac bridge readout for bolometric detectors

    Science.gov (United States)

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.

    1989-01-01

    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  9. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  10. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  11. Josephson arrays for dc and ac metrology

    International Nuclear Information System (INIS)

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  12. The AC and DC Conductivity of Nanocomposites

    Directory of Open Access Journals (Sweden)

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  13. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC29Q....Seq.d/ Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  14. Fuel trading

    International Nuclear Information System (INIS)

    A first part of this report proposes an overview of trends and predictions. After a synthesis on the sector changes and trends, it indicates and comments the most recent predictions for the consumption of refined oil products and for the turnover of the fuel wholesale market, reports the main highlights concerning the sector's life, and gives a dashboard of the sector activity. The second part proposes the annual report on trends and competition. It presents the main operator profiles and fuel categories, the main determining factors of the activity, the evolution of the sector context between 2005 and 2015 (consumptions, prices, temperature evolution). It analyses the evolution of the sector activity and indicators (sales, turnovers, prices, imports). Financial performances of enterprises are presented. The economic structure of the sector is described (evolution of the economic fabric, structural characteristics, French foreign trade). Actors are then presented and ranked in terms of turnover, of added value, and of result

  15. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  16. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . With the proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion system...

  17. Fuel rod

    International Nuclear Information System (INIS)

    The present invention provide a fuel rod used in a BWR type reactor, preventing the occurrence of defects of weld portions and improving the operationability of test and assembling operation to improve the quality of weld portions. Namely, the fuel rod is formed by loading a plurality of fuel pellets in a cladding tube. The outer diameter of a groove portion of a tightly sealing end plug to be inserted and welded to the open end of the cladding tube is made substantially identical with the inner diameter of the cladding tube. A neck portion having a diameter smaller than the outer diameter of the groove portion is disposed between an end plug main body and the groove portion. As a result, since the outer diameter of the groove portion is substantially identical with the inner diameter of the cladding tube, the positioning is facilitated. Since the neck portion having a smaller diameter than the outer diameter of the groove portion is disposed in the groove portion, a gap is formed in the welded portion thereby enabling to facilitate the confirmation of weld sag for confirming integrity of the weld by a non-destructive test. (I.S.)

  18. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  19. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  20. Equivalent circuit models for ac impedance data analysis

    Science.gov (United States)

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  1. Considerations for an Ac Dipole for the LHC

    CERN Document Server

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  2. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%), for kidneys 20 ± 1% (19...

  3. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  4. AC loss in large-scale superconducting cables

    NARCIS (Netherlands)

    Mulder, G.B.J.

    1993-01-01

    A review is given of recent work on ac losses, carried out at our institute. The emphasis is on large-scale conductors for fusion applications, such as the `cable-in-conduit¿ prototype conductors to be used for NET. Calculation methods for the ac losses are presented together with some experimental

  5. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  6. Resistivity and AC calorimetry measurements on CeNiGe{sub 2} under pressure

    Energy Technology Data Exchange (ETDEWEB)

    Holmes, A.T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan)]. E-mail: alex@djebel.mp.es.osaka-u.ac.jp; Muramatsu, T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Miyake, A. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Kaczorowski, D. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wroclaw (Poland); Bukowski, Z. [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wroclaw (Poland); Kagayama, T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Shimizu, K. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan)

    2007-03-15

    We present resistivity and AC calorimetry measurements of single crystalline CeNiGe{sub 2} under high pressure and low temperature in a diamond anvil cell. CeNiGe{sub 2} is a highly anisotropic, antiferromagnetic Kondo system at ambient pressure, located close to the boundary with non-magnetic systems. It has two ordering temperatures, T{sub N1}=3.9K and T{sub N2}=3.2K, which are suppressed under pressure. Between 0.7 and 1.4GPa only a single transition was identified, with T{sub N} reaching 1.9K by 1.4 GPa. At 1.9GPa two transitions could again be seen by AC calorimetry at 2.0 and 1.3K, accompanied by a qualitative change in the behaviour of the resistivity. The Sommerfeld coefficient showed a maximum of 755mJmol{sup -1}K{sup -2} at 1.4GPa, up from 448mJmol{sup -1}K{sup -2} at close to ambient pressure. The residual resistivity was found to decrease sharply above 1.4GPa after an initial increase with pressure.

  7. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  8. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems

    Science.gov (United States)

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François

    2016-09-01

    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  9. Transition time

    Directory of Open Access Journals (Sweden)

    Carlos Renato Zacharias

    2013-03-01

    Full Text Available 2013 is going to be an interesting year for the High Dilution research field. There is a tendency to revise basic concepts and common beliefs, while refining models and theories. The fundamental research team seems to be open to deeper discussions, aiming to reinforce some hypothesis and discharge others. In somehow, we are stuck in a vicious way of think, trying to manage and describe an informational phenomenon into a molecular framework. The challenge offered to those researchers involved with basic science is to figure out how to deal with such phenomenon, since previous theories and models have not shown to be matched! In the other hand, there is a tendency to explore the HD phenomenon in its technological branch. While basic research is important to describe how things work, the applied research has a more intense social and economic appeal. To develop technology based on HD means to give a different kind of visibility to the field, attracting sponsors, companies, entrepreneurs, always committed to the market regulatory laws. I am expecting for this year some important movements, both in the basic and applied research. Of course, it will be only a new beginning, as these changes require a lot of work, discussions and insights. But this transition time is very welcome!

  10. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    Institute of Scientific and Technical Information of China (English)

    房绪鹏

    2006-01-01

    提出了一种新型AC/AC变流器电路--单相电压型Z源AC/AC变流器;介绍了其电路拓扑、工作原理、控制方法等;给出了相应的仿真和实验结果.仿真和实验证实了该电路拓扑的合理性和优越性.

  11. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  12. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  13. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  14. Spin reorientation transition process in single crystal NdFeO3

    Science.gov (United States)

    Song, Gaibei; Jiang, Junjie; Kang, Baojuan; Zhang, Jincang; Cheng, Zhenxiang; Ma, Guohong; Cao, Shixun

    2015-06-01

    The spin reorientation transition in single crystal NdFeO3 is studied using AC magnetic susceptibility, hysteresis loops, and polarized terahertz (THz) time domain spectroscopy measurements. Different frequency dependence behaviors of AC susceptibility reflect that the dynamic response of magnetization inside the spin reorientation region differs from the phase outside the transition region. The magnetization hysteresis loops at different temperatures reveal that domains formed during the spin reorientation process, which coincides with the abrupt increase of AC magnetic susceptibility during the transition. In addition, temperature dependent THz wave excitation of quasi-antiferromagnetic mode indicates the process of spin reorientation as a continuous rotation of Fe3+ spins rather than a mixed phase of Γ4 and Γ2.

  15. BWXT commercialization activities for GTRI LEU U-Mo fuels

    International Nuclear Information System (INIS)

    BWX Technologies (BWXT), the United States' research reactor fuel supplier for plate type fuel, has been contracted to provide commercialization support activities under the Global Threat Reduction Initiative (GTRI) program to develop and qualify low enrichment uranium (LEU), high density fuels suitable for most of the world's research reactors by the end of 2010. The program's main effort has been testing of uranium-molybdenum alloy fuels (U-Mo), and in light of recent fuel failures with dispersion type fuels, emphasis has now been placed on developing modified and alternative fuels. BWXT's contract scope entails identifying requirements and planning the transition to the new LEU fuels. As there is no clearly preferred fuel technology at this point, multiple commercialization paths must be evaluated. Our baseline approach assumes the fuel is monolithic U-10Mo, and the fuel meat and aluminum alloy plate are hot isostatic pressed (HIP) together. Preliminary results are supportive of this method, however, there is potential for significant interaction between the fuel meat and aluminum alloy plate during the HIP process. Alternative bonding methods, e.g. friction stir welding are being evaluated, as well as modifying the baseline HIP parameters. Additionally, modified dispersed fuel systems are considered. Aspects of each fuel technology and their manufacturing impact are presented and discussed. (author)

  16. Effect of electric fields on the stabilization of premixed laminar bunsen flames at low AC frequency: Bi-ionic wind effect

    KAUST Repository

    Kim, Minkuk

    2012-03-01

    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally by applying AC electric fields at low frequency below 60. Hz together with DC in the single electrode configuration. The blowoff velocity has been measured for varying AC voltage and frequency. A transition frequency between low and high frequency regimes has been identified near 40-50. Hz, where AC electric fields have minimal effect on flame stabilization. In the low frequency regime, the blowoff velocity decreased linearly with AC voltage such that the flames became less stable. This was consistent with the DC result, implying the influence of the ionic wind effect. The variation of blowoff velocity with AC frequency showed a non-monotonic behavior in that the velocity decreased and then increased, exhibiting minimum blowoff velocity near 6-8. Hz. Based on the molecular kinetic theory, the developing degree of ionic wind was derived. By considering the ionic wind effects arising from both positive and negative ions in a flame zone, the bi-ionic wind effect successfully explained the non-monotonic behavior of blowoff velocity with AC frequency in the low frequency regime. © 2011 The Combustion Institute.

  17. High frequency link DC/AC converter using a three-phase output PWM controlled cycloconverter. Sanso shutsuryoku PWM seigyo cycloconverter wo mochiita koshuha link DC/AC converter

    Energy Technology Data Exchange (ETDEWEB)

    Inagaki, K. (Toshiba Corp., Tokyo (Japan)); Okuma, S. (Nagoya University, Nagoya (Japan))

    1992-06-20

    The main circuit configuration and control method were proposed of the high-frequency link DC/AC converter using a three-phase output cycloconverter for UPSs (uninterruptible power supply). The control function approach of the previously proposed PWM controlled cycloconverter was applied to control of the proposed cycloconverter which converts single-phase high-frequency power into three-phase commercial frequency one. The proposed converter could not only charge DC power supplies from a power system but also compensate enough instantaneous reactive power for loads. The circuit configuration was, in particular, effective for such DC power supplies as fuel cell and solar cell which are possible to generate electric power and necessary to be insulated electrically against a power system. The isolated operation and cooperative one of the proposed DC/AC converter were verified by simulation and experiments. 4 refs., 14 figs., 1 tab.

  18. An Ac transposon system based on maize chromosome 4S for isolating long-distance-transposed Ac tags in the maize genome.

    Science.gov (United States)

    Wang, Fei; Li, Zhaoying; Fan, Jun; Li, Pengfei; Hu, Wei; Wang, Gang; Xu, Zhengkai; Song, Rentao

    2010-12-01

    Transposon tagging is an important tool for gene isolation and functional studies. In maize, several transposon-tagging systems have been developed, mostly using Activator/Dissociation (Ac/Ds) and Mutator systems. Here, we establish another Ac-based transposon system with the donor Ac tightly linked with sugary1 (su1) on maize chromosome 4S. Newly transposed Ac (tr-Acs) were detected based on a negative dosage effect, and long-distance-transposed Ac events were identified and isolated from the donor Ac by a simple backcross scheme. In this study, we identified 208 independent long-distance-transposed Ac lines. Thirty-one flanking sequences of these tr-Acs were isolated and localized in the maize genome. As found in previous studies, the tr-Acs preferentially inserted into genic sequences. The distribution of tr-Acs is not random. In our study, the tr-Acs preferentially transposed into chromosomes 1, 2, 9 and 10. We discuss the preferential distribution of tr-Acs from Ac systems. Our system is complementary to two other Ac-based regional-mutagenesis systems in maize, and the combined use of these systems will achieve an even and high-density distribution of Ac elements throughout the maize genome for functional-genomics studies.

  19. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    Science.gov (United States)

    2010-07-01

    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning...

  20. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  1. La acústica submarina y su desarrollo desde la creación del Instituto de Acústica

    OpenAIRE

    Ranz Guerra, Carlos; Cobo, Pedro; Carbó, Rafael; Santiago Páez, José Salvador; Soler, A. M.; Briones, J. M.; Jimeno, I.; Muñoz, N; Camarasa, M.; Recuero López, Manuel

    2000-01-01

    PACS: 43.30.Xm; 43.30.Yj; 43.30.Vh; 43.30.Nb; 43.30.Ma.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  2. LMFBR fuel component costs

    International Nuclear Information System (INIS)

    A significant portion of the cost of fabricating LMFBR fuels is in the non-fuel components such as fuel pin cladding, fuel assembly ducts and end fittings. The contribution of these to fuel fabrication costs, based on FFTF experience and extrapolated to large LMFBR fuel loadings, is discussed. The extrapolation considers the expected effects of LMFBR development programs in progress on non-fuel component costs

  3. ESBWR response to an extended station blackout/loss of all AC power

    International Nuclear Information System (INIS)

    U.S. federal regulations require light water cooled nuclear power plants to cope with Station Blackouts for a predetermined amount of time based on design factors for the plant. U.S. regulations define Station Blackout (SBO) as a loss of the offsite electric power system concurrent with turbine trip and unavailability of the onsite emergency AC power system. According to U.S. regulations, typically the coping period for an SBO is 4 hours and can be as long as 16 hours for currently operating BWR plants. Being able to cope with an SBO and loss of all AC power is required by international regulators as well. The U.S. licensing basis for the ESBWR is a coping period of 72 hours for an SBO based on U.S. NRC requirements for passive safety plants. In the event of an extended SBO (viz., greater than 72 hours), the ESBWR response shows that the design is able to cope with the event for at least 7 days without AC electrical power or operator action. ESBWR is a Generation III+ reactor design with an array of passive safety systems. The ESBWR primary success path for mitigation of an SBO event is the Isolation Condenser System (ICS). The ICS is a passive, closed loop, safety system that initiates automatically on a loss of power. Upon Station Blackout or loss of all AC power, the ICS begins removing decay heat from the Reactor Pressure Vessel (RPV) by (i) condensing the steam into water in heat exchangers located in pools of water above the containment, and (ii) transferring the decay heat to the atmosphere. The condensed water is then returned by gravity to cool the reactor again. The ICS alone is capable of maintaining the ESBWR in a safe shutdown condition after an SBO for an extended period. The fuel remains covered throughout the SBO event. The ICS is able to remove decay heat from the RPV for at least 7 days and maintains the reactor in a safe shutdown condition. The water level in the RPV remains well above the top of active fuel for the duration of the SBO event

  4. Variable valve actuation and dual-fuel combustion

    OpenAIRE

    Törmänen, Juhani

    2015-01-01

    The constantly increasing interest in alternative fuels in transportation has given birth to new strategies in the internal combustion engine technology. The tightening emissions regulations further boost this development. The dual-fuel technology is one of the most promising new concepts for natural gas-fuelled engines and it has already been widely adopted by the marine and power generation industry. However, the transition from Diesel to dual-fuel engines in road and off-road traffic has n...

  5. The modeling and simulation of thermal based modified solid oxide fuel cell (SOFC) for grid-connected systems

    OpenAIRE

    Ayetül Gelen; Tankut Yalcinoz

    2015-01-01

    This paper presents a thermal based modified dynamic model of a Solid Oxide Fuel Cell (SOFC) for grid-connected systems. The proposed fuel cell model involves ohmic, activation and concentration voltage losses, thermal dynamics, methanol reformer, fuel utilization factor and power limiting module. A power conditioning unit (PCU), which consists of a DC-DC boost converter and a DC-AC voltage-source inverter (VSI), their controller, transformer and filter, is designed for grid-connected systems...

  6. Enhanced Activated Carbon Cathode Performance for Microbial Fuel Cell by Blending Carbon Black

    KAUST Repository

    Zhang, Xiaoyuan

    2014-02-04

    Activated carbon (AC) is a useful and environmentally sustainable catalyst for oxygen reduction in air-cathode microbial fuel cells (MFCs), but there is great interest in improving its performance and longevity. To enhance the performance of AC cathodes, carbon black (CB) was added into AC at CB:AC ratios of 0, 2, 5, 10, and 15 wt % to increase electrical conductivity and facilitate electron transfer. AC cathodes were then evaluated in both MFCs and electrochemical cells and compared to reactors with cathodes made with Pt. Maximum power densities of MFCs were increased by 9-16% with CB compared to the plain AC in the first week. The optimal CB:AC ratio was 10% based on both MFC polarization tests and three electrode electrochemical tests. The maximum power density of the 10% CB cathode was initially 1560 ± 40 mW/m2 and decreased by only 7% after 5 months of operation compared to a 61% decrease for the control (Pt catalyst, 570 ± 30 mW/m2 after 5 months). The catalytic activities of Pt and AC (plain or with 10% CB) were further examined in rotating disk electrode (RDE) tests that minimized mass transfer limitations. The RDE tests showed that the limiting current of the AC with 10% CB was improved by up to 21% primarily due to a decrease in charge transfer resistance (25%). These results show that blending CB in AC is a simple and effective strategy to enhance AC cathode performance in MFCs and that further improvement in performance could be obtained by reducing mass transfer limitations. © 2014 American Chemical Society.

  7. To Evaluate Zero Emission Propulsion and Support Technology for Transit Buses

    Energy Technology Data Exchange (ETDEWEB)

    Kevin Chandler; Leslie Eudy

    2006-11-01

    This report provides evaluation results for prototype fuel cell transit buses operating at Santa Clara Valley Transportation Authority (VTA) in San Jose, California, in partnership with the San Mateo County Transit District in San Carlos, California. VTA has been operating three fuel cell transit buses in extra revenue service since February 28, 2005. This report provides descriptions of the equipment used, early experiences, and evaluation results from the operation of the buses and the supporting hydrogen infrastructure from March 2005 through July 2006.

  8. FUEL CELL BUS DEMONSTRATION IN MEXICO CITY

    Science.gov (United States)

    The report discusses the performance of a cull-size, zero-emission, Proton Exchange Membrane (PEM) fuel-cell-powered transit bus in the atmospheric environment of Mexico City. To address the air quality problems caused by vehicle emissions in Mexico City, a seminar on clean vehic...

  9. Synthetic and Biomass Alternate Fueling in Aviation

    Science.gov (United States)

    Hendricks, Robert C.; Bushnell, Dennis M.

    2009-01-01

    Must use earth's most abundant natural resources - Biomass, Solar, Arid land (43%), Seawater (97%) with nutrients (80%) plus brackish waters and nutrients resolve environmental triangle of conflicts energy-food-freshwater and ultrafine particulate hazards. Requires Paradigm Shift - Develop and Use Solar* for energy; Biomass for aviation and hybrid-electric-compressed air mobility fueling with transition to hydrogen long term.

  10. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Directory of Open Access Journals (Sweden)

    Henrik H. El Ali

    2012-10-01

    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  11. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  12. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  13. Faint Galaxies in deep ACS observations

    CERN Document Server

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L

    2003-01-01

    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  14. Design study and evaluation of advanced fuel fabrication systems for FBR fuel cycle

    International Nuclear Information System (INIS)

    The conceptual design study for advanced FBR fuel fabrication system has been performed for the purpose that the feature of small-scale fabrication system in the transition stage from LWR to FBR fuel cycle. On the small-scale of 50 ton heavy metal per year fabrication system, dry type fabrication systems have superior cost performance than the wet type, although waste amount is larger. (authors)

  15. Structural Transitions in Topologically Constrained DNA

    Science.gov (United States)

    Leger, J.; Romano, G.; Sarkar, A.; Robert, J.; Bourdieu, L.; Chatenay, D.; Marko, J. F.

    2000-03-01

    We propose a theoretical explanation for results of recent single molecule micromanipulation experiments (Leger et al, PRL 83, 1066, 1999) on double-stranded DNA with fixed linking number. The topological constraint leads to novel structural transitions, including a shift of the usual 60 pN B-form to S-form transition force plateau up to a force of 100 pN when linking is fixed at zero. Our model needs five distinct states to explain the four different observed transitions. The various constant-force plateaus observed for different fixed values of linking correspond to a mixture of different pairs of states, weighted to satisfy the topological constraint. Our model allows us to conclude that sufficiently overtwisted DNA (positive linkage number) undergoes a transition from B-form DNA to a mixture of S-form and P-form DNA at a force plateau near 45 pN, and then to homogeneous P-form DNA at a force plateau near 110 pN. A similar two-step transition occurs for undertwisted DNA, and by analysing the twisting necessary to produce pure S-form DNA we conclude that the S-state has helix repeat of 38 bp. Support from the Whitaker Foundation, the NSF, the ACS-PRF and Research Corporation is gratefully acknowledged.

  16. SOIL CONTAMINATION BY NITROGEN COMPOUNDS DURING ORGANIC FUEL COMBUSTION

    Directory of Open Access Journals (Sweden)

    V. P. Bubnov

    2010-01-01

    Full Text Available The paper considers a transition mechanism of flue gas nitrogen oxides being formed due to organic fuel combustion from atmosphere into soil. Mechanisms of nitrogen compound origination and transformation in atmosphere and their transition into soil have been presented in the paper. The paper recommends a generalized equation for mathematical description of nitrogen migration into soil. 

  17. Sustainability of Fossil Fuels

    Science.gov (United States)

    Lackner, K. S.

    2002-05-01

    For a sustainable world economy, energy is a bottleneck. Energy is at the basis of a modern, technological society, but unlike materials it cannot be recycled. Energy or more precisely "negentropy" (the opposite of entropy) is always consumed. Thus, one either accepts the use of large but finite resources or must stay within the limits imposed by dilute but self-renewing resources like sunlight. The challenge of sustainable energy is exacerbated by likely growth in world energy demand due to increased population and increased wealth. Most of the world still has to undergo the transition to a wealthy, stable society with the near zero population growth that characterizes a modern industrial society. This represents a huge unmet demand. If ten billion people were to consume energy like North Americans do today, world energy demand would be ten times higher. In addition, technological advances while often improving energy efficiency tend to raise energy demand by offering more opportunity for consumption. Energy consumption still increases at close to the 2.3% per year that would lead to a tenfold increase over the course of the next century. Meeting future energy demands while phasing out fossil fuels appears extremely difficult. Instead, the world needs sustainable or nearly sustainable fossil fuels. I propose the following definition of sustainable under which fossil fuels would well qualify: The use of a technology or resource is sustainable if the intended and unintended consequences will not force its abandonment within a reasonable planning horizon. Of course sustainable technologies must not be limited by resource depletion but this is only one of many concerns. Environmental impacts, excessive land use, and other constraints can equally limit the use of a technology and thus render it unsustainable. In the foreseeable future, fossil fuels are not limited by resource depletion. However, environmental concerns based on climate change and other environmental

  18. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  19. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  20. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  1. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  2. Cyclotron production of Ac-225 for targeted alpha therapy.

    Science.gov (United States)

    Apostolidis, C; Molinet, R; McGinley, J; Abbas, K; Möllenbeck, J; Morgenstern, A

    2005-03-01

    The feasibility of producing Ac-225 by proton irradiation of Ra-226 in a cyclotron through the reaction Ra-226(p,2n)Ac-225 has been experimentally demonstrated for the first time. Proton energies were varied from 8.8 to 24.8 MeV and cross-sections were determined by radiochemical analysis of reaction yields. Maximum yields were reached at incident proton energies of 16.8 MeV. Radiochemical separation of Ac-225 from the irradiated target yielded a product suitable for targeted alpha therapy of cancer.

  3. High performance, high durability non-precious metal fuel cell catalysts

    Energy Technology Data Exchange (ETDEWEB)

    Wood, Thomas E.; Atanasoski, Radoslav; Schmoeckel, Alison K.

    2016-03-15

    This invention relates to non-precious metal fuel cell cathode catalysts, fuel cells that contain these catalysts, and methods of making the same. The fuel cell cathode catalysts are highly nitrogenated carbon materials that can contain a transition metal. The highly nitrogenated carbon materials can be supported on a nanoparticle substrate.

  4. Consolidated Fuel Reprocessing Program. Progress report, January 1 to March 31, 1979

    Energy Technology Data Exchange (ETDEWEB)

    Unger, W.E. (comp.)

    1979-06-01

    On Oct. 1, 1978, a transition phase was begun to concentrate all US fuel reprocessing research in one major program, the Consolidated Fuel Reprocessing Program (CFRP). The CFRP is organized into the following: process R and D, engineering research, engineering systems, technical support, HTGR fuel reprocessing, and pyrochemical and dry processing methods. Progress is reported in each area. (DLC)

  5. Single-Phase Four Switch Z-Source AC-AC Converters%单相四开关Z源AC-AC变换器

    Institute of Scientific and Technical Information of China (English)

    汤雨; 谢少军; 张超华

    2007-01-01

    提出了一种单相四开关Z源AC-AC变换器,它包括电压型与电流型两类.与传统脉宽调制AC-AC变换器相比,它具有如下特点:输出电压范围宽且可升可降,输出电压与输入电压可同相或反相,冲击和谐波电流小,可靠性高.针对AC-AC变换器中固有的开关管换流问题,提出了一种适用于单相四开关Z源AC-AC变换器的换流方案,无需外加缓冲吸收电路即可实现开关管的安全换流.以电压型单相四开关Z源AC-AC变换器为例,对其进行了理论分析、仿真和原理试验研究.实验结果证实了Z源变换器的特性及换流方案的可行性.

  6. Fuel processors for fuel cell APU applications

    Science.gov (United States)

    Aicher, T.; Lenz, B.; Gschnell, F.; Groos, U.; Federici, F.; Caprile, L.; Parodi, L.

    The conversion of liquid hydrocarbons to a hydrogen rich product gas is a central process step in fuel processors for auxiliary power units (APUs) for vehicles of all kinds. The selection of the reforming process depends on the fuel and the type of the fuel cell. For vehicle power trains, liquid hydrocarbons like gasoline, kerosene, and diesel are utilized and, therefore, they will also be the fuel for the respective APU systems. The fuel cells commonly envisioned for mobile APU applications are molten carbonate fuel cells (MCFC), solid oxide fuel cells (SOFC), and proton exchange membrane fuel cells (PEMFC). Since high-temperature fuel cells, e.g. MCFCs or SOFCs, can be supplied with a feed gas that contains carbon monoxide (CO) their fuel processor does not require reactors for CO reduction and removal. For PEMFCs on the other hand, CO concentrations in the feed gas must not exceed 50 ppm, better 20 ppm, which requires additional reactors downstream of the reforming reactor. This paper gives an overview of the current state of the fuel processor development for APU applications and APU system developments. Furthermore, it will present the latest developments at Fraunhofer ISE regarding fuel processors for high-temperature fuel cell APU systems on board of ships and aircrafts.

  7. GSPEL - Fuel Cell Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Fuel Cell Lab (FCL) Provides testing for technology readiness of fuel cell systems The FCL investigates, tests and verifies the performance of fuel-cell systems...

  8. KMRR fuel design

    International Nuclear Information System (INIS)

    KMRR fuel rod design criteria on fuel swelling, blistering and oxide spallation have been reexamined. Fuel centerline temperature limit of 250deg C in normal operation condition and fuel swelling limit of 12 % at the end of life have been proposed to prevent fuel failure due to excessive fuel swelling. Fuel temperature limit of 485deg C has been proposed to exclude the possibility of fuel failures during transients or under accident condition. Further analyses are needed to decide the fuel cladding temperature limit to preclude the oxide spallation. Design changes in fuel assembly structure and their effects on related systems have been reviewed from a structural integrity viewpoint. The remained works in fuel mechanical design area have been identified and further efforts of fuel design group will be focused on these aspects. (Author)

  9. Highly sensitive pseudo-differential ac-nanocalorimeter for the study of the glass transition

    Energy Technology Data Exchange (ETDEWEB)

    Laarraj, Mohcine [Institut NÉEL, CNRS, 25 Avenue des Martyrs, F-38042 Grenoble (France); University Grenoble Alpes, Institut NEEL, F-38042 Grenoble (France); Laboratoire d’Ingénierie et des Matériaux (LIMAT), Université Hassan II de Casablanca, Faculté des Sciences Ben M’Sik, Casablanca Maroc (Morocco); Adhiri, Rahma; Moussetad, Mohamed [Laboratoire d’Ingénierie et des Matériaux (LIMAT), Université Hassan II de Casablanca, Faculté des Sciences Ben M’Sik, Casablanca Maroc (Morocco); Ouaskit, Said [Laboratoire de Physique de la Matière Condensée (LPMC), Université Hassan II de Casablanca, Faculté des Sciences Ben M’Sik, Casablanca Maroc (Morocco); Guttin, Christophe; Richard, Jacques; Garden, Jean-Luc [Institut NÉEL, CNRS, 25 Avenue des Martyrs, F-38042 Grenoble (France); University Grenoble Alpes, Institut NEEL, F-38042 Grenoble (France)

    2015-11-15

    We present a nanocalorimeter designed for the measurement of the dynamic heat capacity of thin films. The microfabricated sensor, the thermal conditioning of the sensor, as well as the highly stable and low noise electronic chain allow measurements of the real and imaginary parts of the complex specific heat with a resolution Δ C/C of about 10{sup −5}. The performances of this quasi-differential nanocalorimeter were tested on a model of polymeric glass-former, the polyvinyl acetate (PVAc). The high stability and low noise of the device are essential for accurate studies on non-equilibrium slow relaxing systems such as glasses.

  10. Comparison of the Accuracy and Speed of Transient Mobile A/C System Simulation Models: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Kiss, T.; Lustbader, J.

    2014-03-01

    The operation of air conditioning (A/C) systems is a significant contributor to the total amount of fuel used by light- and heavy-duty vehicles. Therefore, continued improvement of the efficiency of these mobile A/C systems is important. Numerical simulation has been used to reduce the system development time and to improve the electronic controls, but numerical models that include highly detailed physics run slower than desired for carrying out vehicle-focused drive cycle-based system optimization. Therefore, faster models are needed even if some accuracy is sacrificed. In this study, a validated model with highly detailed physics, the 'Fully-Detailed' model, and two models with different levels of simplification, the 'Quasi-Transient' and the 'Mapped- Component' models, are compared. The Quasi-Transient model applies some simplifications compared to the Fully-Detailed model to allow faster model execution speeds. The Mapped-Component model is similar to the Quasi-Transient model except instead of detailed flow and heat transfer calculations in the heat exchangers, it uses lookup tables created with the Quasi-Transient model. All three models are set up to represent the same physical A/C system and the same electronic controls. Speed and results of the three model versions are compared for steady state and transient operation. Steady state simulated data are also compared to measured data. The results show that the Quasi-Transient and Mapped-Component models ran much faster than the Fully-Detailed model, on the order of 10- and 100-fold, respectively. They also adequately approach the results of the Fully-Detailed model for steady-state operation, and for drive cycle-based efficiency predictions

  11. Fuel processor for fuel cell power system

    Science.gov (United States)

    Vanderborgh, Nicholas E.; Springer, Thomas E.; Huff, James R.

    1987-01-01

    A catalytic organic fuel processing apparatus, which can be used in a fuel cell power system, contains within a housing a catalyst chamber, a variable speed fan, and a combustion chamber. Vaporized organic fuel is circulated by the fan past the combustion chamber with which it is in indirect heat exchange relationship. The heated vaporized organic fuel enters a catalyst bed where it is converted into a desired product such as hydrogen needed to power the fuel cell. During periods of high demand, air is injected upstream of the combustion chamber and organic fuel injection means to burn with some of the organic fuel on the outside of the combustion chamber, and thus be in direct heat exchange relation with the organic fuel going into the catalyst bed.

  12. Dicty_cDB: FCL-AC22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC22 (Link to dictyBase) - G03266 DDB0186811 Contig-U14995-1 FCL-...AC22P (Link to Original site) FCL-AC22F 430 FCL-AC22Z 521 FCL-AC22P 951 - - Show FCL-AC22 Library FC...L (Link to library) Clone ID FCL-AC22 (Link to dictyBase) Atlas ID - NBRP ID G03266 dictyBase ID DDB0186811 ...Link to Contig Contig-U14995-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC22Q.Seq.d/ Representative seq. ID FCL-AC22P (Link to Original site) Representative DNA sequence >FCL-

  13. Dicty_cDB: FCL-AC23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC23 (Link to dictyBase) - G01760 DDB0186002 Contig-U16043-1 FCL-...AC23P (Link to Original site) FCL-AC23F 132 FCL-AC23Z 582 FCL-AC23P 714 - - Show FCL-AC23 Library FC...L (Link to library) Clone ID FCL-AC23 (Link to dictyBase) Atlas ID - NBRP ID G01760 dictyBase ID DDB0186002 ...Link to Contig Contig-U16043-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC23Q.Seq.d/ Representative seq. ID FCL-AC23P (Link to Original site) Representative DNA sequence >FCL-

  14. PROSPECTS OF MULTIFILAMENTARY SUPERCONDUCTOR AC 50 Hz APPLICATIONS

    OpenAIRE

    Hlásnik, I.

    1984-01-01

    It is shown that parameters of modern multifilamentary superconductors and their possible improvements allow their application to AC 50 Hz windings working at Bm of about 1 T and giving energy and total cost savings.

  15. Dc to ac converter operates efficiently at low input voltages

    Science.gov (United States)

    1965-01-01

    Self-oscillating dc to ac converter with transistor switching to produce a square wave output is used for low and high voltage power sources. The converter has a high efficiency throughout a wide range of loads.

  16. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  17. A precursor of β-delayed fission:230Ac

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  18. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  19. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  20. Strongly correlated perovskite fuel cells.

    Science.gov (United States)

    Zhou, You; Guan, Xiaofei; Zhou, Hua; Ramadoss, Koushik; Adam, Suhare; Liu, Huajun; Lee, Sungsik; Shi, Jian; Tsuchiya, Masaru; Fong, Dillon D; Ramanathan, Shriram

    2016-05-16

    Fuel cells convert chemical energy directly into electrical energy with high efficiencies and environmental benefits, as compared with traditional heat engines. Yttria-stabilized zirconia is perhaps the material with the most potential as an electrolyte in solid oxide fuel cells (SOFCs), owing to its stability and near-unity ionic transference number. Although there exist materials with superior ionic conductivity, they are often limited by their ability to suppress electronic leakage when exposed to the reducing environment at the fuel interface. Such electronic leakage reduces fuel cell power output and the associated chemo-mechanical stresses can also lead to catastrophic fracture of electrolyte membranes. Here we depart from traditional electrolyte design that relies on cation substitution to sustain ionic conduction. Instead, we use a perovskite nickelate as an electrolyte with high initial ionic and electronic conductivity. Since many such oxides are also correlated electron systems, we can suppress the electronic conduction through a filling-controlled Mott transition induced by spontaneous hydrogen incorporation. Using such a nickelate as the electrolyte in free-standing membrane geometry, we demonstrate a low-temperature micro-fabricated SOFC with high performance. The ionic conductivity of the nickelate perovskite is comparable to the best-performing solid electrolytes in the same temperature range, with a very low activation energy. The results present a design strategy for high-performance materials exhibiting emergent properties arising from strong electron correlations.

  1. Strongly correlated perovskite fuel cells

    Science.gov (United States)

    Zhou, You; Guan, Xiaofei; Zhou, Hua; Ramadoss, Koushik; Adam, Suhare; Liu, Huajun; Lee, Sungsik; Shi, Jian; Tsuchiya, Masaru; Fong, Dillon D.; Ramanathan, Shriram

    2016-06-01

    Fuel cells convert chemical energy directly into electrical energy with high efficiencies and environmental benefits, as compared with traditional heat engines. Yttria-stabilized zirconia is perhaps the material with the most potential as an electrolyte in solid oxide fuel cells (SOFCs), owing to its stability and near-unity ionic transference number. Although there exist materials with superior ionic conductivity, they are often limited by their ability to suppress electronic leakage when exposed to the reducing environment at the fuel interface. Such electronic leakage reduces fuel cell power output and the associated chemo-mechanical stresses can also lead to catastrophic fracture of electrolyte membranes. Here we depart from traditional electrolyte design that relies on cation substitution to sustain ionic conduction. Instead, we use a perovskite nickelate as an electrolyte with high initial ionic and electronic conductivity. Since many such oxides are also correlated electron systems, we can suppress the electronic conduction through a filling-controlled Mott transition induced by spontaneous hydrogen incorporation. Using such a nickelate as the electrolyte in free-standing membrane geometry, we demonstrate a low-temperature micro-fabricated SOFC with high performance. The ionic conductivity of the nickelate perovskite is comparable to the best-performing solid electrolytes in the same temperature range, with a very low activation energy. The results present a design strategy for high-performance materials exhibiting emergent properties arising from strong electron correlations.

  2. Property Rights, Institutions and Source of Fuel Wood in Rural Ethiopia

    OpenAIRE

    Abebe Damte; Steven F. Koc

    2011-01-01

    This study examines the relationship between property rights, defined by land tenure security and the strength of local-level institutions, and household demand for fuel wood, as measured by the source from which fuel wood is collected. A multinomial regression model is applied to survey data collected in rural Ethiopia. Results from the discrete choice model indicate that active local-level institutions increase household dependency on open access forests, while land security reduces open ac...

  3. DIGESTER GAS - FUEL CELL - PROJECT

    Energy Technology Data Exchange (ETDEWEB)

    Dr.-Eng. Dirk Adolph; Dipl.-Eng. Thomas Saure

    2002-03-01

    GEW has been operating the first fuel cell in Europe producing heat and electricity from digester gas in an environmentally friendly way. The first 9,000 hours in operation were successfully concluded in August 2001. The fuel cell powered by digester gas was one of the 25 registered ''Worldwide projects'' which NRW presented at the EXPO 2000. In addition to this, it is a key project of the NRW State Initiative on Future Energies. All of the activities planned for the first year of operation were successfully completed: installing and putting the plant into operation, the transition to permanent operation as well as extended monitoring till May 2001.

  4. Spent fuel corrosion and dissolution

    International Nuclear Information System (INIS)

    This paper presents the current status of the Swedish programme for the study of the corrosion of spent fuel in bicarbonate groundwaters. Results from the on-going experimental programme are presented and compared with the data base accumulated over the past ten years. Release of uranium and the other actinides was solubility-controlled under the semi-static type of experiments performed. The limiting solubility for uranium under oxic conditions was consistent with the hypothesis that the redox potential of the system is assumed to correspond to the U3O7/U3O8 transition. The measured release fractions for 137Cs, 90Sr and 99Tc are discussed and used to exemplify the probable dissolution and corrosion processes involved. A substantial part of the Swedish programme is directed to the characterization of spent fuel before and after corrosion tests. Recent results are presented on the identification of possible corrosion sites. (26 refs.) (au)

  5. Development of the Field of Flexible AC Transmission Systems (FACTS)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Theoretical and technological development of large capacity power electronics and flexible AC transmission systems are one of the most important projects developed by Tsinghua University. The Flexible AC Transmission System (FACTS) technology which uses power electronics to improve the efficiency and quality of the electrical generation, transmission and distribution system is considered to be one of the most significant technological innovations for power systems in the 20th century. The advanced static var generator (ASVG) is a key FACTS device.

  6. Muc5ac mucin expression during rat skin development

    OpenAIRE

    V. Ferretti; Á. Segal-Eiras; Barbeito, C.G.; Croce, M. V.

    2015-01-01

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  7. Theory of the ac spin-valve effect

    OpenAIRE

    Kochan, Denis; Gmitra, Martin; Fabian, Jaroslav

    2011-01-01

    The spin-valve complex magnetoimpedance of symmetric ferromagnet/normal metal/ferromagnet junctions is investigated within the drift-diffusion (standard) model of spin injection. The ac magnetoresistance---the real part difference of the impedances of the parallel and antiparallel magnetization configurations---exhibits an overall damped oscillatory behavior, as an interplay of the diffusion and spin relaxation times. In wide junctions the ac magnetoresistance oscillates between positive and ...

  8. Fractal AC circuits and propagating waves on fractals

    CERN Document Server

    Akkermans, Eric; Dunne, Gerald; Rogers, Luke G; Teplyaev, Alexander

    2015-01-01

    We extend Feynman's analysis of the infinite ladder AC circuit to fractal AC circuits. We show that the characteristic impedances can have positive real part even though all the individual impedances inside the circuit are purely imaginary. This provides a physical setting for analyzing wave propagation of signals on fractals, by analogy with the Telegrapher's Equation, and generalizes the real resistance metric on a fractal, which provides a measure of distance on a fractal, to complex impedances.

  9. AC resistivity of d-wave ceramic superconductors

    OpenAIRE

    Li, Mai Suan; Dominguez, Daniel

    2000-01-01

    We model d-wave ceramic superconductors with a three-dimensional lattice of randomly distributed $\\pi$ Josephson junctions with finite self-inductance. The linear and nonlinear ac resistivity of the d-wave ceramic superconductors is obtained as function of temperature by solving the corresponding Langevin dynamical equations. We find that the linear ac resistivity remains finite at the temperature $T_p$ where the third harmonics of resistivity has a peak. The current amplitude dependence of t...

  10. Neutronics and Fuel Performance Evaluation of Accident Tolerant Fuel under Normal Operation Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Xu Wu; Piyush Sabharwall; Jason Hales

    2014-07-01

    This report details the analysis of neutronics and fuel performance analysis for enhanced accident tolerance fuel, with Monte Carlo reactor physics code Serpent and INL’s fuel performance code BISON, respectively. The purpose is to evaluate two of the most promising candidate materials, FeCrAl and Silicon Carbide (SiC), as the fuel cladding under normal operating conditions. Substantial neutron penalty is identified when FeCrAl is used as monolithic cladding for current oxide fuel. From the reactor physics standpoint, application of the FeCrAl alloy as coating layer on surface of zircaloy cladding is possible without increasing fuel enrichment. Meanwhile, SiC brings extra reactivity and the neutron penalty is of no concern. Application of either FeCrAl or SiC could be favorable from the fuel performance standpoint. Detailed comparison between monolithic cladding and hybrid cladding (cladding + coating) is discussed. Hybrid cladding is more practical based on the economics evaluation during the transition from current UO2/zircaloy to Accident Tolerant Fuel (ATF) system. However, a few issues remain to be resolved, such as the creep behavior of FeCrAl, coating spallation, inter diffusion with zirconium, etc. For SiC, its high thermal conductivity, excellent creep resistance, low thermal neutron absorption cross section, irradiation stability (minimal swelling) make it an excellent candidate materials for future nuclear fuel/cladding system.

  11. Update on bedside ultrasound (US) diagnosis of acute cholecystitis (AC).

    Science.gov (United States)

    Zenobii, Maria Francesca; Accogli, Esterita; Domanico, Andrea; Arienti, Vincenzo

    2016-03-01

    Acute cholecystitis (AC) represents a principal cause of morbidity worldwide and is one of the most frequent reasons for hospitalization due to gastroenteric tract diseases. AC should be suspected in presence of clinical signs and of gallstones on an imaging study. Upper abdominal US represents the first diagnostic imaging step in the case of suspected AC. Computed tomography (CT) with intravenous contrast (IV) or magnetic resonance imaging (MRI) with gadolinium contrast and technetium hepatobiliary iminodiacetic acid (Tc-HIDA) can be employed to exclude complications. US examination should be performed with right subcostal oblique, with longitudinal and intercostal scans. Normal gallbladder US findings and AC major and minor US signs are described. Polyps, sludge and gallbladder wall thickening represent the more frequent pitfalls and they must be differentiated from stones, duodenal artifacts and many other non-inflammatory conditions that cause wall thickening, respectively. By means of bedside ultrasound, the finding of gallstones in combination with acute pain, when the clinician presses the gallbladder with the US probe (the sonographic Murphy's sign), has a 92.2 % positive predictive value for AC. In our preliminary experience, bedside US-performed by echoscopy (ES) and/or point-of-care US (POCUS) demonstrated good reliability in detecting signs of AC, and was always integrated with physical examination and performed by a skilled operator.

  12. AC electrophoretic deposition of organic-inorganic composite coatings.

    Science.gov (United States)

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R

    2013-02-15

    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials.

  13. Temperature integration at the AC thermosensory neurons in Drosophila.

    Science.gov (United States)

    Tang, Xin; Platt, Michael D; Lagnese, Christopher M; Leslie, Jennifer R; Hamada, Fumika N

    2013-01-16

    Temperature sensation has a strong impact on animal behavior and is necessary for animals to avoid exposure to harmful temperatures. It is now well known that thermoTRP (transient receptor potential) channels in thermosensory neurons detect a variable range of temperature stimuli. However, little is known about how a range of temperature information is relayed and integrated in the neural circuits. Here, we show novel temperature integration between two warm inputs via Drosophila TRPA channels, TRPA1 and Pyrexia (Pyx). The internal AC (anterior cell) thermosensory neurons, which express TRPA1, detect warm temperatures and mediate temperature preference behavior. We found that the AC neurons were activated twice when subjected to increasing temperatures. The first response was at ∼25°C via TRPA1 channel, which is expressed in the AC neurons. The second response was at ∼27°C via the second antennal segments, indicating that the second antennal segments are involved in the detection of warm temperatures. Further analysis reveals that pyx-Gal4-expressing neurons have synapses on the AC neurons and that mutation of pyx eliminates the second response of the AC neurons. These data suggest that AC neurons integrate both their own TRPA1-dependent temperature responses and a Pyx-dependent temperature response from the second antennal segments. Our data reveal the first identification of temperature integration, which combines warm temperature information from peripheral to central neurons and provides the possibility that temperature integration is involved in the plasticity of behavioral outputs.

  14. A Novel High Performance Bridgeless Ac-Dc Boost Converter

    Directory of Open Access Journals (Sweden)

    S.M.AshrafulAlam Mohon

    2016-08-01

    Full Text Available A new single phase high performance bridgeless AC-DC Boost converter is proposed. The converter is made bridgeless by the use of two unidirectional switches and two diodes at the input ac side for power conversion for both positive and negative half cycle. Because of the high frequency switching, the power factor of the circuit is inherently corrected and it requires a small filter to make the input current near sinusoidal with limited THD. The significant improvement in THD makes the circuit a good choice in applications needing AC-DC conversion with power conditioning. The circuit exhibits such better performances than conventional AC-DC boost converter with variable loads at constant frequency switching with no additional control circuits. The efficiency of the circuit is also satisfactory. Analysis and simulation results of the circuit are obtained by using software simulation. The main advantage of this new AC-DC converter is its superior power quality over conventional AC-DC boost converter

  15. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  16. Controlo de um conversor AC-DC-AC para turbinas eólicas baseadas no PMSG

    OpenAIRE

    Bulhosa, João Paulo Rodrigues

    2009-01-01

    A dissertação teve como objectivo o estudo e implementação do controlo de um conversor AC-DC-AC, constituído por um conversor DC/DC elevador e um inversor de tensão monofásico, para efectuar a ligação à rede de turbinas eólicas baseadas no gerador síncrono de ímanes permanentes. O controlo global do conversor AC-DC-AC seguiu uma estratégia na qual o controlo do conversor elevador e do inversor de tensão monofásico é implementado de modo independente. O primeiro visa maximizar a potência ex...

  17. A nuclear reactor core fuel reload optimization using artificial ant colony connective networks

    International Nuclear Information System (INIS)

    The core of a nuclear Pressurized Water Reactor (PWR) may be reloaded every time the fuel burn-up is such that it is not more possible to maintain the reactor operating at nominal power. The nuclear core fuel reload optimization problem consists in finding a pattern of burned-up and fresh-fuel assemblies that maximize the number of full operational days. This is an NP-Hard problem, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Moreover, the problem is non-linear and its search space is highly discontinuous and multi-modal. Ant Colony System (ACS) is an optimization algorithm based on artificial ants that uses the reinforcement learning technique. The ACS was originally developed to solve the Traveling Salesman Problem (TSP), which is conceptually similar to the nuclear core fuel reload problem. In this work a parallel computational system based on the ACS, called Artificial Ant Colony Networks is introduced to solve the core fuel reload optimization problem

  18. A nuclear reactor core fuel reload optimization using artificial ant colony connective networks

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Alan M.M. de [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: alanmmlima@yahoo.com.br; Schirru, Roberto [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: schirru@lmp.ufrj.br; Carvalho da Silva, Fernando [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: fernando@con.ufrj.br; Medeiros, Jose Antonio Carlos Canedo [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: canedo@lmp.ufrj.br

    2008-09-15

    The core of a nuclear Pressurized Water Reactor (PWR) may be reloaded every time the fuel burn-up is such that it is not more possible to maintain the reactor operating at nominal power. The nuclear core fuel reload optimization problem consists in finding a pattern of burned-up and fresh-fuel assemblies that maximize the number of full operational days. This is an NP-Hard problem, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Moreover, the problem is non-linear and its search space is highly discontinuous and multi-modal. Ant Colony System (ACS) is an optimization algorithm based on artificial ants that uses the reinforcement learning technique. The ACS was originally developed to solve the Traveling Salesman Problem (TSP), which is conceptually similar to the nuclear core fuel reload problem. In this work a parallel computational system based on the ACS, called Artificial Ant Colony Networks is introduced to solve the core fuel reload optimization problem.

  19. Economics of Direct Hydrogen Polymer Electrolyte Membrane Fuel Cell Systems

    Energy Technology Data Exchange (ETDEWEB)

    Mahadevan, Kathyayani

    2011-10-04

    Battelle's Economic Analysis of PEM Fuel Cell Systems project was initiated in 2003 to evaluate the technology and markets that are near-term and potentially could support the transition to fuel cells in automotive markets. The objective of Battelle?s project was to assist the DOE in developing fuel cell systems for pre-automotive applications by analyzing the technical, economic, and market drivers of direct hydrogen PEM fuel cell adoption. The project was executed over a 6-year period (2003 to 2010) and a variety of analyses were completed in that period. The analyses presented in the final report include: Commercialization scenarios for stationary generation through 2015 (2004); Stakeholder feedback on technology status and performance status of fuel cell systems (2004); Development of manufacturing costs of stationary PEM fuel cell systems for backup power markets (2004); Identification of near-term and mid-term markets for PEM fuel cells (2006); Development of the value proposition and market opportunity of PEM fuel cells in near-term markets by assessing the lifecycle cost of PEM fuel cells as compared to conventional alternatives used in the marketplace and modeling market penetration (2006); Development of the value proposition of PEM fuel cells in government markets (2007); Development of the value proposition and opportunity for large fuel cell system application at data centers and wastewater treatment plants (2008); Update of the manufacturing costs of PEM fuel cells for backup power applications (2009).

  20. Possibility of Different Fuel Cycles Usage in GT-MHR

    International Nuclear Information System (INIS)

    The GT-MHR reactor core is characterized by flexibility of neutronic characteristics at the given average power density and fixed geometrical dimensions of reactor core. Such flexibility makes it possible to start the reactor operation with one fuel cycle, and then to turn to another type of core fuel load without changes of main reactor elements: fuel block design, core and reflector size, control rod number etc. Preliminary analysis re-indicates the commercial viability of the GT-MHR, part of which is due to the ability to accommodate different fuel types and cycles. This paper presents the results of studies of the neutronic characteristics of reactor cores using different fuel (low- and high-enriched uranium, MOX fuel). Comparison of different fuel cycles is carried out for a three-batch refueling option with respect to following characteristics: discharged fuel burnup, reactivity change during one partial cycle of fuel burnup, consumption of fissile isotopes per unit of produced energy, power distribution, reactivity effects, control rods worth. It is shown, that the considered options of fuel loads provide the three-year fuel campaign (with accounting of capacity factor ∼ 0,8) without change of core design, number and design of control rods at transition from the one fuel type to another. (authors)

  1. Study on AC/A ratio in myopia%近视患者AC/A率的临床意义

    Institute of Scientific and Technical Information of China (English)

    肖婉莉; 孙建宁

    2011-01-01

    目的:探讨AC/A率在近视发生发展中的作用及机制.方法:选择30名正视眼者(正视眼组)及90名近视眼者.对近视眼者根据屈光程度分为轻、中、高度近视眼3组;根据平时戴镜情况,分为从未戴镜、间断戴镜和持续戴镜组.采用同视机法测量AC/A率并进行分析和比较.结果:轻度近视眼组AC/A率平均值为(3.22±1.51)Δ/D,中度(3.46±1.00)Δ/D,高度(3.97±1.36)Δ/D,均高于正视眼组(P<0.05).从未戴镜组AC/A率高于间断戴镜及持续戴镜组(P<0.05).结论:近视患者高AC/A率是调节与辐辏功能不协调的一种表现,高AC/A率可导致眼球近视性改变.近视患者应进行矫正,恢复调节与辐辏的平衡.%Objective: To assess the difterence of accommodative convergence to accommodation (AC/A) ratio in myopia and emmetropia, then evaluate the relationship between AC/A ratio and myopia. Methods: Thirty emmetropia and 90 myopia cases were included in this study. The myopia cases were divided into mild myopia,moderate myopia and high myopia. The AC/A ratios were measured with a synoptophore, and the results were analyzed. Results: Average values of mild myopia group, moderate myopia group and high myopia group were (3.22 ± 1.51 ) Δ/D, (3.46 ± 1.00) Δ/D, (3.46 ± 1.00) Δ/D, a significant difference was found between each group and emmetropia group ( P < 0.05 ). The AC/A ratio of non- wearing glasses group was higher than that of discontinuous wearing and continued wearing glasses group. Conclusion: The increased AC/A ratio represents the incoordination of accommodations and convergences, which can lead to an aggravation of myopia, which should be readjusted.

  2. dc and ac Josephson effect in a superconductor endash Luttinger-liquid endash superconductor system

    International Nuclear Information System (INIS)

    We calculate both the dc and the ac Josephson current through a 1-D system of interacting electrons, connected to two superconductors by tunnel junctions. We treat the (repulsive) Coulomb interaction in the framework of the one-channel, spin-1/2 Luttinger model. The Josephson current is obtained for two geometries of experimental relevance: a quantum wire and a ring. At T=0, the critical current is found to decay algebraically with increasing distance d between the junctions. The decay is characterized by an exponent which depends on the strength of the interaction. At finite temperatures T, lower than the superconducting transition temperature Tc, there is a crossover from algebraic to exponential decay of the critical current as a function of d, at a distance of the order of ℎvF/kBT. Moreover, the dependence of critical current on temperature shows nonmonotonic behavior. If the Luttinger liquid is confined to a ring of circumference L, coupled capacitively to a gate voltage and threaded by a magnetic flux, the Josephson current shows remarkable parity effects under the variation of these parameters. For some values of the gate voltage and applied flux, the ring acts as a π junction. These features are robust against thermal fluctuations up to temperatures on the order of ℎvF/kBL. For the wire geometry, we have also studied the ac-Josephson effect. The amplitude and the phase of the time-dependent Josephson current are affected by electron-electron interactions. Specifically, the amplitude shows pronounced oscillations as a function of the bias voltage due to the difference between the velocities of spin and charge excitations in the Luttinger liquid. Therefore, the ac-Josephson effect can be used as a tool for the observation of spin-charge separation. copyright 1996 The American Physical Society

  3. Enhanced Oxygen and Hydroxide Transport in a Cathode Interface by Efficient Antibacterial Property of a Silver Nanoparticle-Modified, Activated Carbon Cathode in Microbial Fuel Cells.

    Science.gov (United States)

    Li, Da; Qu, Youpeng; Liu, Jia; Liu, Guohong; Zhang, Jie; Feng, Yujie

    2016-08-17

    A biofilm growing on an air cathode is responsible for the decreased performance of microbial fuel cells (MFCs). For the undesired biofilm to be minimized, silver nanoparticles were synthesized on activated carbon as the cathodic catalyst (Ag/AC) in MFCs. Ag/AC enhanced maximum power density by 14.6% compared to that of a bare activated carbon cathode (AC) due to the additional silver catalysis. After operating MFCs over five months, protein content on the Ag/AC cathode was only 38.3% of that on the AC cathode, which resulted in a higher oxygen concentration diffusing through the Ag/AC cathode. In addition, a lower pH increment (0.2 units) was obtained near the Ag/AC catalyst surface after biofouling compared to 0.8 units of the AC cathode, indicating that less biofilm on the Ag/AC cathode had a minor resistance on hydroxide transported from the catalyst layer interfaces to the bulk solution. Therefore, less decrements of the Ag/AC activity and MFC performance were obtained. This result indicated that accelerated transport of oxygen and hydroxide, benefitting from the antibacterial property of the cathode, could efficiently maintain higher cathode stability during long-term operation.

  4. Enhanced Oxygen and Hydroxide Transport in a Cathode Interface by Efficient Antibacterial Property of a Silver Nanoparticle-Modified, Activated Carbon Cathode in Microbial Fuel Cells.

    Science.gov (United States)

    Li, Da; Qu, Youpeng; Liu, Jia; Liu, Guohong; Zhang, Jie; Feng, Yujie

    2016-08-17

    A biofilm growing on an air cathode is responsible for the decreased performance of microbial fuel cells (MFCs). For the undesired biofilm to be minimized, silver nanoparticles were synthesized on activated carbon as the cathodic catalyst (Ag/AC) in MFCs. Ag/AC enhanced maximum power density by 14.6% compared to that of a bare activated carbon cathode (AC) due to the additional silver catalysis. After operating MFCs over five months, protein content on the Ag/AC cathode was only 38.3% of that on the AC cathode, which resulted in a higher oxygen concentration diffusing through the Ag/AC cathode. In addition, a lower pH increment (0.2 units) was obtained near the Ag/AC catalyst surface after biofouling compared to 0.8 units of the AC cathode, indicating that less biofilm on the Ag/AC cathode had a minor resistance on hydroxide transported from the catalyst layer interfaces to the bulk solution. Therefore, less decrements of the Ag/AC activity and MFC performance were obtained. This result indicated that accelerated transport of oxygen and hydroxide, benefitting from the antibacterial property of the cathode, could efficiently maintain higher cathode stability during long-term operation. PMID:27441786

  5. A Comparison of Materials Issues for Cermet and Graphite-Based NTP Fuels

    Science.gov (United States)

    Stewart, Mark E.; Schnitzler, Bruce G.

    2013-01-01

    This paper compares material issues for cermet and graphite fuel elements. In particular, two issues in NTP fuel element performance are considered here: ductile to brittle transition in relation to crack propagation, and orificing individual coolant channels in fuel elements. Their relevance to fuel element performance is supported by considering material properties, experimental data, and results from multidisciplinary fluid/thermal/structural simulations. Ductile to brittle transition results in a fuel element region prone to brittle fracture under stress, while outside this region, stresses lead to deformation and resilience under stress. Poor coolant distribution between fuel element channels can increase stresses in certain channels. NERVA fuel element experimental results are consistent with this interpretation. An understanding of these mechanisms will help interpret fuel element testing results.

  6. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  7. Instrumentation of fuel elements and fuel plates

    International Nuclear Information System (INIS)

    When controlling the behaviour of a reactor or developing a new fuel concept, it is of utmost interest to have the possibility to confirm the thermohydraulic calculations by actual measurements in the fuel elements or in the fuel plates. For years, CERCA has developed the technology and supplied its customers with fuel elements equipped with pressure or temperature measuring devices according to the requirements. Recent customer projects have lead to the development of a new method to introduce thermocouples directly into the fuel plate meat instead of the cladding. The purpose of this paper is to review the various instrumentation possibilities available at CERCA. (author)

  8. Instrumentation of fuel elements and fuel plates

    International Nuclear Information System (INIS)

    When controlling the behaviour of a reactor or developing a new fuel concept, it is of utmost interest to have the possibility to confirm the thermohydraulic calculations by actual measurements in the fuel elements or in the fuel plates. For years, CERCA has developed the technology and supplied its customers with fuel elements equipped with pressure or temperature measuring devices according to the requirements. Recent customer projects have led to the development of a new method to introduce thermocouples directly into the fuel plate meat instead of the cladding. The purpose of this paper is to review the various instrumentation possibilities available at CERCA. (author)

  9. Gifts from Exoplanetary Transits

    OpenAIRE

    Narita, Norio

    2009-01-01

    The discovery of transiting extrasolar planets has enabled us a number of interesting stduies. Transit photometry reveals the radius and the orbital inclination of transiting planets, and thereby we can learn the true mass and the density of respective planets by the combined information of radial velocity measurements. In addition, follow-up observations of transiting planets such as secondary eclipse, transit timing variations, transmission spectroscopy, and the Rossiter-McLaughlin effect p...

  10. Magic Wavelength for the Hydrogen 1S-2S Transition

    Science.gov (United States)

    Kawasaki, Akio

    2016-05-01

    The state of the art precision measurement of the transition frequencies of neutral atoms is performed with atoms trapped by the magic wavelength optical lattice that cancels the ac Stark shift of the transitions. Trapping with magic wavelength lattice is also expected to improve the precision of the hydrogen 1S-2S transition frequency, which so far has been measured only with the atomic beam. In this talk, I discuss the magic wavelength for the hydrogen 1S-2S transition, and the possibility of implementing the optical lattice trapping for hydrogen. Optical trapping of hydrogen also opens the way to perform magnetic field free spectroscopy of antihydrogen for the test of CPT theorem.

  11. Power generation using an activated carbon and metal mesh cathode in a microbial fuel cell

    KAUST Repository

    Zhang, Fang

    2009-11-01

    An inexpensive activated carbon (AC) air cathode was developed as an alternative to a platinum-catalyzed electrode for oxygen reduction in a microbial fuel cell (MFC). AC was cold-pressed with a polytetrafluoroethylene (PTFE) binder to form the cathode around a Ni mesh current collector. This cathode construction avoided the need for carbon cloth or a metal catalyst, and produced a cathode with high activity for oxygen reduction at typical MFC current densities. Tests with the AC cathode produced a maximum power density of 1220 mW/m2 (normalized to cathode projected surface area; 36 W/m3 based on liquid volume) compared to 1060 mW/m2 obtained by Pt catalyzed carbon cloth cathode. The Coulombic efficiency ranged from 15% to 55%. These findings show that AC is a cost-effective material for achieving useful rates of oxygen reduction in air cathode MFCs. © 2009 Elsevier B.V. All rights reserved.

  12. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae)

    Indian Academy of Sciences (India)

    Manoj Chugh; B R Gulati; S K Gakhar

    2010-03-01

    A repertoire of monoclonal antibodies (mAbs) was generated against the midgut proteins of Anopheles culicifacies mosquitoes. The mAbs AC-43 and AC-29 significantly inhibited Plasmodium vivax development inside the mosquito midgut. The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 recognized 52, 44, 40 and 29 kDa polypeptides. These female midgut-specific polypeptides are shared between An. culicifacies and An. stephensi, two major vectors of malaria in India. Deglycosylation assays revealed that -linked carbohydrates are the major components in epitopes corresponding to AC-43 and AC-29. Gold particle labelling revealed that both these mAbs preferentially bind to glycoproteins at the apical microvilli and the microvillus-associated network present inside transverse sections of the gut epithelium. These regions are particularly known to have receptors for ookinetes, which enable them to cross this epithelial barrier and provide them with certain necessary chemicals or components for further development into oocysts. Therefore, these glycoproteins appear to be potential candidates for a vectordirected transmission-blocking vaccine (TBV).

  13. A New Very-High-Efficiency R4 Converter for High-Power Fuel Cell Applications

    DEFF Research Database (Denmark)

    Nymand, Morten; Andersen, Michael Andreas E.

    2009-01-01

    A new very high efficiency 10 kW isolated R4 boost converter for low-voltage high-power fuel cell applications is presented. Using a new concept for partially paralleling of isolated boost converters, only the critical high ac-current parts are paralleled. Four 2.5 kW power stages, consisting...

  14. Satellite Attitude Control System Design Taking into Account the Fuel Slosh and Flexible Dynamics

    Directory of Open Access Journals (Sweden)

    Alain G. de Souza

    2014-01-01

    Full Text Available The design of the spacecraft Attitude Control System (ACS becomes more complex when the spacecraft has different type of components like, flexible solar panels, antennas, mechanical manipulators and tanks with fuel. The interaction between the fuel slosh motion, the panel’s flexible motion and the satellite rigid motion during translational and/or rotational manoeuvre can change the spacecraft center of mass position damaging the ACS pointing accuracy. This type of problem can be considered as a Fluid-Structure Interaction (FSI where some movable or deformable structure interacts with an internal fluid. This paper develops a mathematical model for a rigid-flexible satellite with tank with fuel. The slosh dynamics is modelled using a common pendulum model and it is considered to be unactuated. The control inputs are defined by a transverse body fixed force and a moment about the centre of mass. A comparative investigation designing the satellite ACS by the Linear Quadratic Regulator (LQR and Linear Quadratic Gaussian (LQG methods is done. One has obtained a significant improvement in the satellite ACS performance and robustness of what has been done previously, since it controls the rigid-flexible satellite and the fuel slosh motion, simultaneously.

  15. Perceptions of breath alcohol concentration (BrAC) levels among a sample of bar patrons with BrAC values of 0.08% or higher.

    Science.gov (United States)

    Martin, Ryan J; Chaney, Beth H; Cremeens-Matthews, Jennifer; Vail-Smith, Karen

    2016-09-01

    Breath alcohol concentration (BrAC) is a commonly used measure of alcohol intoxication. Because of the potential negative consequences of excessive alcohol consumption, it is important to examine how accurately intoxicated individuals can estimate their BrAC values, especially individuals over the legal BrAC driving threshold (i.e., 0.08%). To better understand perceptions of BrAC values among intoxicated individuals, this field study examined actual BrAC values and BrAC range estimates (0.08% and above, 0.02-0.07%, less than 0.02%) among a sample of bar patrons (N = 454) with BrAC levels at 0.08% or higher. Bivariate and multivariate analyses were conducted to examine the relationship between actual BrAC values and perceived BrAC levels. We also examined whether the following demographic and drinking variables were associated with underestimating BrAC in this sample: gender, age, race, college student status, plans to get home, and hazardous drinking. Results indicated that the majority (60.4%) of participants underestimated their BrAC (i.e., less than 0.08%) and lower BrAC values correlated with underestimating BrAC ranges (p young (less than 21) intoxicated females are a group at high risk for sexual assault on college campuses. (PsycINFO Database Record PMID:27631614

  16. HTGR fuel and fuel cycle technology

    Energy Technology Data Exchange (ETDEWEB)

    Lotts, A.L.; Coobs, J.H.

    1976-08-01

    The status of fuel and fuel cycle technology for high-temperature gas-cooled reactors (HTGRs) is reviewed. The all-ceramic core of the HTGRs permits high temperatures compared with other reactors. Core outlet temperatures of 740/sup 0/C are now available for the steam cycle. For advanced HTGRs such as are required for direct-cycle power generation and for high-temperature process heat, coolant temperatures as high as 1000/sup 0/C may be expected. The paper discusses the variations of HTGR fuel designs that meet the performance requirements and the requirements of the isotopes to be used in the fuel cycle. Also discussed are the fuel cycle possibilities, which include the low-enrichment cycle, the Th-/sup 233/U cycle, and plutonium utilization in either cycle. The status of fuel and fuel cycle development is summarized.

  17. 21 CFR 880.6320 - AC-powered medical examination light.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate...

  18. AC electrified jets in a flow-focusing device: Jet length scaling.

    Science.gov (United States)

    Castro-Hernández, Elena; García-Sánchez, Pablo; Alzaga-Gimeno, Javier; Tan, Say Hwa; Baret, Jean-Christophe; Ramos, Antonio

    2016-07-01

    We use a microfluidic flow-focusing device with integrated electrodes for controlling the production of water-in-oil drops. In a previous work, we reported that very long jets can be formed upon application of AC fields. We now study in detail the appearance of the long jets as a function of the electrical parameters, i.e., water conductivity, signal frequency, and voltage amplitude. For intermediate frequencies, we find a threshold voltage above which the jet length rapidly increases. Interestingly, this abrupt transition vanishes for high frequencies of the signal and the jet length grows smoothly with voltage. For frequencies below a threshold value, we previously reported a transition from a well-behaved uniform jet to highly unstable liquid structures in which axisymmetry is lost rather abruptly. These liquid filaments eventually break into droplets of different sizes. In this work, we characterize this transition with a diagram as a function of voltage and liquid conductivity. The electrical response of the long jets was studied via a distributed element circuit model. The model allows us to estimate the electric potential at the tip of the jet revealing that, for any combination of the electrical parameters, the breakup of the jet occurs at a critical value of this potential. We show that this voltage is around 550 V for our device geometry and choice of flow rates. PMID:27375826

  19. Vehicle technologies, fuel-economy policies, and fuel-consumption rates of Chinese vehicles

    International Nuclear Information System (INIS)

    One of the principal ways to reduce transport-related energy use is to reduce fuel-consumption rates of motor vehicles (usually measured in liters of fuel per 100 km). Since 2004, China has implemented policies to improve vehicle technologies and lower the fuel-consumption rates of individual vehicles. Policy evaluation requires accurate and adequate information on vehicle fuel-consumption rates. However, such information, especially for Chinese vehicles under real-world operating conditions, is rarely available from official sources in China. For each vehicle type we first review the vehicle technologies and fuel-economy policies currently in place in China and their impacts. We then derive real-world (or on-road) fuel-consumption rates on the basis of information collected from various sources. We estimate that the real-world fuel-consumption rates of vehicles in China sold in 2009 are 9 L/100 km for light-duty passenger vehicles, 11.4 L/100 km for light-duty trucks, 22 L/100 km for inter-city transport buses, 40 L/100 km for urban transit buses, and 24.9 L/100 km for heavy-duty trucks. These results aid in understanding the levels of fuel consumption of existing Chinese vehicle fleets and the effectiveness of policies in reducing on-road fuel consumption, which can help in designing and evaluating future vehicle energy-efficiency policies. - Highlights: ► Vehicle fuel-consumption rate (VFCR) data are rarely available in China. ► We review the fuel-economy policies currently in place in China and their impacts. ► We derive real-world VFCRs on the basis of information collected from various sources. ► Results aid in understanding the fuel consumption levels of Chinese vehicle fleets. ► Results help in designing and evaluating future vehicle energy-efficiency policies.

  20. How can we ensure the energy transition? Comment assurer la transition energetique?

    Energy Technology Data Exchange (ETDEWEB)

    Rojey, Alexandre

    2007-07-01

    With a continuously growing energy demand, the present energy model is clearly unsustainable due to the decline of fossil fuel resources and the risks of climate change A transition towards a sustainable model is therefore needed. However, there are no immediate alternatives leading to a sharp reduction in the use of fossil fuels, which are expected to maintain a major role for many years. The energy transition will therefore require a long time period The risks of climate change will require urgent measures and the 'carbon transition' has to be achieved more rapidly than the energy transition itself. A whole set of solutions will be needed in the technical but also economic and regulatory areas, for achieving a successful transition: energy conservation, diversification of energy . sources, reduction of the carbon content of the energy mix, CO{sub 2}, capture and storage. Hybrid options will be favoured. The paper describes the main features of the upcoming transition and the actions which are required. (auth)

  1. The AC (Alternating Current) Electrical Behavior of Multi-layered Thermoelectric Devices

    Science.gov (United States)

    Alim, Mohammad A.; Budak, Satilmis; Bhattacharjee, Sudip

    2016-08-01

    In this study the ac (alternating current) small-signal electrical data in the frequency range 5 Hz ≤ f ≤ 13 MHz are obtained for the multi-layered thermoelectric (TE) devices to extract underlying operative mechanisms via an equivalent circuit model. This model is developed from the complex plane plots in conjunction with the Bode plot. It is observed that the inductive behavior is prevalent for both unbombarded and bombarded TE devices regardless of the doses as both types are observed as somewhat weak in thermoelectric properties. The bombarded multi-layered devices followed a systematic pattern in ac behavior via semicircular relaxation both in the impedance and admittance planes for the same measured data. This pattern is attributed to the transition from one lumped behavior to two distinct mechanisms. It is observed that the␣conductive nature of the equivalent circuit model via non-blocking (non-capacitive) elements, attributed to the underlying operative electrical paths between the two opposite electrodes across the multi-layered device exists, satisfying direct current conditions of the equivalent circuit model. The inductive behavior at high frequencies originates from the conductive aspect of the lumped response of the device in addition to the contribution of the electrode leads. Thus, the proposed equivalent circuit model contains external inductance that verifies a meaningful representation of the multi-layered TE device, though weak in thermoelectric properties.

  2. A.c. susceptibility study of CaCl2 doped copper–zinc ferrite system

    Indian Academy of Sciences (India)

    A Y Lipare; P N Vasambekar; A S Vaingankar

    2003-08-01

    Polycrystalline soft ferrites, Zn$_x$ Cu$_{1–x}$ Fe2O4 ( = 0.30, 0.50, 0.70, 0.80 and 0.90), doped with controlled amount of calcium chloride (CaCl2) were prepared by standard ceramic route and studied for a.c. susceptibility. X-ray diffraction studies of the compositions reveal formation of single-phase cubic spinel. The values of lattice constant increase as doping percentage of CaCl2 increased from 0.01% to 0.05% and afterwards decrease slightly. The presence of chlorine ions is confirmed by absorption peak in far IR spectra near 650 cm-1 for all the samples. The variation of a.c. susceptibility with temperature shows the existence of single domain structure for = 0.3 and exhibits transition from single domain to multidomain structure with increased Ca2+ contents from 0.01 to 0.1%. The composition, = 0.5, shows multidomain structure independent of Ca2+ content. The samples for = 0.70, 0.80 and 0.90 show paramagnetic behaviour at and above room temperature.

  3. Ac-dc conversion effect in Y-Ba-Cu-O ceramics

    International Nuclear Information System (INIS)

    In Y-Ba-Cu-O ceramics, the dc voltage (V/sub dc/ ) induced by an rf current of 2--20 MHz, which had been previously reported as ''reverse ac Josephson effect,'' was observed at 77--300 K. The observed V/sub dc/ is not found to be due to reverse ac Josephson effect but due to nonlinear current-voltage characteristics, as in the case of BaPb/sub 1-//sub x/Bi/sub x/O3. However, behavior of the V/sub dc/ is different from that in BaPb/sub 1-//sub x/Bi/sub x/O3, which was related to bulk superconducting transition. The V/sub dc/ is observed only in the sample with particular electrical contacts and only when the rf current can flow through the potential electrical contacts. The origin of the rf-to-dc conversion effect in Y-Ba-Cu-O is ascribed to local nonlinear resistance near potential contacts

  4. Single stage AC-DC converter for Galfenol-based micro-power energy harvesters

    Science.gov (United States)

    Cavaroc, Peyton; Curtis, Chandra; Naik, Suketu; Cooper, James

    2014-06-01

    Military based sensor systems are often hindered in operational deployment and/or other capabilities due to limitations in their energy storage elements. Typically operating from lithium based batteries, there is a finite amount of stored energy which the sensor can use to collect and transmit data. As a result, the sensors have reduced sensing and transmission rates. However, coupled with the latest advancements in energy harvesting, these sensors could potentially operate at standard sensing and transition rates as well as dramatically extend lifetimes. Working with the magnetostrictive material Galfenol, we demonstrate the production of enough energy to supplement and recharge a solid state battery thereby overcoming the deficiencies faced by unattended sensors. As with any vibration-based energy harvester, this solution produces an alternating current which needs to be rectified and boosted to a level conducive to recharge the storage element. This paper presents a power converter capable of efficiently converting an ultra-low AC voltage to a solid state charging voltage of 4.1VDC. While we are working with Galfenol transducers as our energy source, this converter may also be applied with any AC producing energy harvester, particularly at operating levels less than 2mW and 200mVAC.

  5. The AC (Alternating Current) Electrical Behavior of Multi-layered Thermoelectric Devices

    Science.gov (United States)

    Alim, Mohammad A.; Budak, Satilmis; Bhattacharjee, Sudip

    2016-11-01

    In this study the ac (alternating current) small-signal electrical data in the frequency range 5 Hz ≤ f ≤ 13 MHz are obtained for the multi-layered thermoelectric (TE) devices to extract underlying operative mechanisms via an equivalent circuit model. This model is developed from the complex plane plots in conjunction with the Bode plot. It is observed that the inductive behavior is prevalent for both unbombarded and bombarded TE devices regardless of the doses as both types are observed as somewhat weak in thermoelectric properties. The bombarded multi-layered devices followed a systematic pattern in ac behavior via semicircular relaxation both in the impedance and admittance planes for the same measured data. This pattern is attributed to the transition from one lumped behavior to two distinct mechanisms. It is observed that the conductive nature of the equivalent circuit model via non-blocking (non-capacitive) elements, attributed to the underlying operative electrical paths between the two opposite electrodes across the multi-layered device exists, satisfying direct current conditions of the equivalent circuit model. The inductive behavior at high frequencies originates from the conductive aspect of the lumped response of the device in addition to the contribution of the electrode leads. Thus, the proposed equivalent circuit model contains external inductance that verifies a meaningful representation of the multi-layered TE device, though weak in thermoelectric properties.

  6. AC Read-Out Circuits for Single Pixel Characterization of TES Microcalorimeters and Bolometers

    Science.gov (United States)

    Gottardi, L.; van de Kuur, J.; Bandler, S.; Bruijn, M.; de Korte, P.; Gao, J. R.; den Hartog, R.; Hijmering, R. A.; Hoevers, H.; Koshropanah, P.; Kilbourne, C.; Lindemann, M. A.; Parra Borderias, M.; Ridder, M.

    2011-01-01

    SRON is developing Frequency Domain Multiplexing (FDM) for the read-out of transition edge sensor (TES) soft x-ray microcalorimeters for the XMS instrument of the International X-ray Observatory and far-infrared bolometers for the SAFARI instrument on the Japanese mission SPICA. In FDM the TESs are AC voltage biased at frequencies from 0.5 to 6 MHz in a superconducting LC resonant circuit and the signal is read-out by low noise and high dynamic range SQUIDs amplifiers. The TES works as an amplitude modulator. We report on several AC bias experiments performed on different detectors. In particular, we discuss the results on the characterization of Goddard Space Flight Center x-ray pixels and SRON bolometers. The paper focuses on the analysis of different read-out configurations developed to optimize the noise and the impedance matching between the detectors and the SQUID amplifier. A novel feedback network electronics has been developed to keep the SQUID in flux locked loop, when coupled to superconducting high Q circuits, and to optimally tune the resonant bias circuit. The achieved detector performances are discussed in view of the instrument requirement for the two space missions.

  7. OPTIMIZING IGNITION AND COMBUSTION OF FUELS TO THE NAVAL STEAM GENERATORS

    OpenAIRE

    Corneliu MOROIANU

    2013-01-01

    The continuous damage of the used fuel quality, of its dispersion due to the increasingviscosity, make necessary the volume expansion and the rise of the e electric spark power used at ignition. Asimilar situation appears to the transition of the generator operation from the marine Diesel heavy fuel to theresidues of water-fuel mixture. So, it feels like using an ignition system with high specific energy and power ableto perform the starting and burning of the fuels mentioned above. Such a sy...

  8. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...

  9. Planning the HEU to LEU Transition for the NBSR

    Energy Technology Data Exchange (ETDEWEB)

    Hanson, A.L.; Diamond, D.

    2011-10-24

    A study has been carried out to understand how the NIST research reactor (NBSR) might be converted from using high-enriched uranium (HEU) to using low-enriched uranium (LEU) fuel. An LEU fuel design had previously been determined which provides an equilibrium core with the desirable fuel cycle length—a very important parameter for maintaining the experimental, scientific program supported by the NBSR. In the present study two options for getting to the equilibrium state are considered. One option starts with the loading of an entire core of fresh fuel. This was determined to be unacceptable. The other option makes use of the current fuel management scheme wherein four fresh fuel elements are loaded at the beginning of each cycle. However, it is shown that without some alterations to the fuel cycle, none of the transition cores containing both HEU and LEU fuel have sufficient excess reactivity to enable reactor operation for the required amount of time. It was determined that operating the first mixed cycle for a sufficiently reduced length of time provides the excess reactivity which enables subsequent transition cycles to be run for the desired number of days.

  10. Behaviour analysis of AC-600 passive safety systems

    International Nuclear Information System (INIS)

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  11. Fuel element design handbook

    Energy Technology Data Exchange (ETDEWEB)

    Merckx, K.R.

    1958-09-01

    The economic development of nuclear reactors depends upon the integrated progress in the fields of reactor design, fuel element design, reactor operation, and fuel production and separation. Broad criteria, which restrict the fuel element design, are determined by the mutual consideration of the problems encountered in all the above fields. Hence, no stage of reactor design or operation is independent of the fuel element problem, nor can the fuel element designer disregard the interest of any one field. As an introduction to the fuel element design problem, this chapter describes how the general criteria for a fuel element are determined.

  12. AC susceptibility studies of the superconductivity of PrOs{sub 4}Sb{sub 12}

    Energy Technology Data Exchange (ETDEWEB)

    Drobnik, S. [Physikalisches Institut, Universitaet Karlsruhe, Wolfgang Gaede Str. 1, D-76128 Karlsruhe (Germany); Forschungszentrum Karlsruhe, Institut fuer Festkoerperphysik, D-76021 Karlsruhe (Germany); Grube, K. [Forschungszentrum Karlsruhe, Institut fuer Festkoerperphysik, D-76021 Karlsruhe (Germany); Pfleiderer, C. [Physikalisches Institut, Universitaet Karlsruhe, Wolfgang Gaede Str. 1, D-76128 Karlsruhe (Germany) and Forschungszentrum Karlsruhe, Institut fuer Festkoerperphysik, D-76021 Karlsruhe (Germany)]. E-mail: christian.pfleiderer@pi.uka.de; Loehneysen, H.V. [Physikalisches Institut, Universitaet Karlsruhe, Wolfgang Gaede Str. 1, D-76128 Karlsruhe (Germany); Forschungszentrum Karlsruhe, Institut fuer Festkoerperphysik, D-76021 Karlsruhe (Germany); Bauer, E.D. [Department of Physics and Institute of Pure and Applied Physical Sciences, University of California at San Diego, La Jolla, CA 92093 (United States); Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Maple, M.B. [Department of Physics and Institute of Pure and Applied Physical Sciences, University of California at San Diego, La Jolla, CA 92093 (United States)

    2005-04-30

    We report the superconducting phase diagram of PrOs{sub 4}Sb{sub 12} deduced from the real-part {chi}{sup '} and the imaginary part {chi}{sup '}' of the AC susceptibility. The double transition at T{sub c1}=1.85K and T{sub c2}=1.75K seen in the specific heat may be related to features in {chi}{sup '} and {chi}{sup '}', where full diamagnetic shielding is observed below T{sub c2} only. As function of magnetic field the phase bounded by T{sub c2} displays features reminiscent of the peak effect.

  13. Surface area considerations for corroding N reactor fuel

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, A.B. Jr.; Pitner, A.L.

    1996-06-01

    The N Reactor fuel is corroding at sites where the Zircaloy cladding was damaged when the fuel was discharged from the reactor. Corroding areas are clearly visible on the fuel stored in open cans in the K East Basin. There is a need to estimate the area of the corroding uranium to analyze aspects of fuel behavior as it is transitioned. from current wet storage to dry storage. In this report, the factors that contribute to {open_quotes}true{close_quotes} surface area are analyzed in terms of what is currently known about the N Reactor fuel. Using observations from a visual examinations of the fuel in the K East wet storage facility, a value for the corroding geometric area is estimated. Based on observations of corroding uranium and surface roughness values for other metals, a surface roughness factor is also estimated and applied to the corroding K East fuel to provide an estimated {open_quotes}true{close_quotes} surface area. While the estimated area may be modified as additional data become available from fuel characterization studies, the estimate provides a basis to assess effects of exposed uranium metal surfaces on fuel behavior in operations involved in transitioning from wet to dry storage, during shipment and staging, conditioning, and dry interim storage.

  14. Surface area considerations for corroding N reactor fuel

    International Nuclear Information System (INIS)

    The N Reactor fuel is corroding at sites where the Zircaloy cladding was damaged when the fuel was discharged from the reactor. Corroding areas are clearly visible on the fuel stored in open cans in the K East Basin. There is a need to estimate the area of the corroding uranium to analyze aspects of fuel behavior as it is transitioned. from current wet storage to dry storage. In this report, the factors that contribute to open-quotes trueclose quotes surface area are analyzed in terms of what is currently known about the N Reactor fuel. Using observations from a visual examinations of the fuel in the K East wet storage facility, a value for the corroding geometric area is estimated. Based on observations of corroding uranium and surface roughness values for other metals, a surface roughness factor is also estimated and applied to the corroding K East fuel to provide an estimated open-quotes trueclose quotes surface area. While the estimated area may be modified as additional data become available from fuel characterization studies, the estimate provides a basis to assess effects of exposed uranium metal surfaces on fuel behavior in operations involved in transitioning from wet to dry storage, during shipment and staging, conditioning, and dry interim storage

  15. Automotive Fuels Survey. Part 3. Comparison and selection

    Energy Technology Data Exchange (ETDEWEB)

    Elam, N.; Van Walwijk, M.; Bueckmann, M.; Troelstra, W.P.; Elam, N. [eds.

    1998-01-01

    A method is presented to compare automotive fuels, which enables answering strategic questions. Five comparisons are made, each covering one specific theme: oil dependency in chapter 2 (which fuels enable a considerable reduction of the oil dependency), ease of transition in chapter 3 (comparison of the ease of transition to alternative fuels), local environmental effects of road transport in chapter 4 (which fuels can result in a substantial improvement of local air quality), greenhouse effect in chapter 5 (which fuels can realize a substantial reduction of well to wheel greenhouse gas emissions), and finally, costs in chapter 6 (a comparison of well to wheel costs for all fuels). The fuels compared are gasoline or reformulated gasoline from crude oil, diesel oil and reformulated diesel oil from crude oil, LPG from refineries and associated gas, natural gas, methanol from natural gas or cellulosic material, ethanol from starch rich crops or sugar rich crops or from cellulosic material, biodiesel (esterified oil from oil containing crops), hydrogen from natural gas, biomass or by electrolysis of water, and dimethylether (DME) from natural gas or cellulosic material. In part 1 of the title survey an overview of important aspects of raw materials and their conversion to automotive fuels is presented, while part is concerned with distribution and use of conventional and alternative automotive fuels. figs., tabs., refs.

  16. Analysis of AC loss in superconducting power devices calculated from short sample data

    OpenAIRE

    Rabbers, J.J.; Haken, ten, Bennie; Kate, ten, F.J.W.

    2003-01-01

    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile and the transport current, the local AC loss is calculated. Integration over the conductor length yields the AC loss of the device. The total AC loss of the device is split up in different compone...

  17. Temas de Física para Ingeniería: Acústica

    OpenAIRE

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  18. Magic wavelengths for the 5s-18s transition in rubidium

    NARCIS (Netherlands)

    Goldschmidt, E.A.; Norris, D.G.; Koller, S.B.; Wyllie, R.; Brown, R.C.; Porto, J.; Safronova, M.S.; Safronova, U.I.

    2015-01-01

    Magic wavelengths, for which there is no differential ac Stark shift for the ground and excited state of the atom, allow trapping of excited Rydberg atoms without broadening the optical transition. This is an important tool for implementing quantum gates and other quantum information protocols with

  19. 75 FR 20541 - Homeless Emergency Assistance and Rapid Transition to Housing: Defining “Homeless”

    Science.gov (United States)

    2010-04-20

    ... the proposal by name and docket number (FR-5333-P-01) and must be sent to: HUD Desk Officer, Office of... URBAN DEVELOPMENT 24 CFR Part 577 RIN 2506-AC26 Homeless Emergency Assistance and Rapid Transition to Housing: Defining ``Homeless'' AGENCY: Office of the Assistant Secretary for Community Planning...

  20. Energy Released During the H-L Back Transition

    Science.gov (United States)

    Eldon, D.; Kolemen, E.; Gohil, P.; McKee, G. R.; Yan, Z.; Schmitz, L.

    2015-11-01

    Prompt energy loss (ΔW) at the H-L transition, as a fraction of total stored energy before the transition, is about 30 % and is insensitive to density in ITER-similar DIII-D plasmas. Occasionally, some ELMs will appear before the transition and reduce total energy, thus reducing ΔW across the following transition. Other results (not in the ITER-similar shape) have shown that ELMs can be triggered in low powered H-modes, prior to H-L transitions, when the plasma is stable to ideal P-B modes (these are not typical type-I ELMs, despite superficial similarities) and E × B shear is strong. These are indeed ELMs occurring in H-mode and not part of a dithering transition. Finally, ELM ΔW is sensitive to edge toroidal rotation and becomes smaller than uncertainty (point to a strategy where ΔW for the H-L transition may be reduced by the presence of (not type-I) ELMs before the transition, and ΔW for the ELMs may be reduced by controlling rotation. Work supported by the US Department of Energy under DE-AC02-09CH11466 and DE-FC02-04ER54698.

  1. 一种简单新型拓扑Cuk AC/AC变换器及其仿真研究%A New Simple Topology of Cuk AC/AC Converter and Its Simulation

    Institute of Scientific and Technical Information of China (English)

    陈溪; 刘韬; 谭光慧; 纪延超

    2006-01-01

    由Cuk DC/DC变换器的拓扑结构导出一种只具有两个开关的PWM AC/AC变换器的简单新型拓扑--Cuk AC/AC变换器.给出单相和三相Cuk AC/AC变换器的拓扑结构,分析Cuk AC/AC变换器的外特性及小信号特性.仿真结果验证了所提的Cuk AC/AC变换器的合理性和可行性.

  2. Modelling ac ripple currents in HTS coated conductors

    Science.gov (United States)

    Xu, Zhihan; Grilli, Francesco

    2015-10-01

    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  3. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  4. AC losses in circular arrangements of parallel superconducting tapes

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;

    1998-01-01

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  5. AC Zeeman potentials for atom chip-based ultracold atoms

    Science.gov (United States)

    Fancher, Charles; Pyle, Andrew; Ziltz, Austin; Aubin, Seth

    2015-05-01

    We present experimental and theoretical progress on using the AC Zeeman force produced by microwave magnetic near-fields from an atom chip to manipulate and eventually trap ultracold atoms. These AC Zeeman potentials are inherently spin-dependent and can be used to apply qualitatively different potentials to different spin states simultaneously. Furthermore, AC Zeeman traps are compatible with the large DC magnetic fields necessary for accessing Feshbach resonances. Applications include spin-dependent trapped atom interferometry and experiments in 1D many-body physics. Initial experiments and results are geared towards observing the bipolar detuning-dependent nature of the AC Zeeman force at 6.8 GHz with ultracold 87Rb atoms trapped in the vicinity of an atom chip. Experimental work is also underway towards working with potassium isotopes at frequencies of 1 GHz and below. Theoretical work is focused on atom chip designs for AC Zeeman traps produced by magnetic near-fields, while also incorporating the effect of the related electric near-fields. Electromagnetic simulations of atom chip circuits are used for mapping microwave propagation in on-chip transmission line structures, accounting for the skin effect, and guiding impedance matching.

  6. Impedance, AC conductivity and dielectric behavior Adeninium Trichloromercurate (II)

    Science.gov (United States)

    Fersi, M. Amine; Chaabane, I.; Gargouri, M.

    2016-09-01

    In this work, we report the measurements impedance spectroscopy technique for the organic-inorganic hybrid compound (C5H6N5) HgCl3, 11/2H2O measured in the 209 Hz-5 MHz frequency range from 378 to 428 K. Besides, the Cole-Cole (Z″ versus Z‧) plots were well fitted to an equivalent circuit built up by a parallel combination of resistance (R), fractal capacitance (CPE) and capacitance (C). Furthermore, the AC conductivity was investigated as a function of temperature and frequency in the same range. The experiment results indicated that AC conductivity (σac) was proportional to σdc + A ωS . The obtained results are discussed in terms of the correlated barrier hopping (CBH) model. An agreement between the experimental and theoretical results suggests that the AC conductivity behavior of Adeninium Trichloromercurate (II) can be successfully explained by CBH model. The contribution of single polaron hopping to AC conductivity in a present alloy was also studied.

  7. Structured analysis of iron-based amorphous alloy coating dep osited by AC-HVAF spray%通过AC-HVAF方法制备铁基非晶合金涂层的结构分析

    Institute of Scientific and Technical Information of China (English)

    叶凤霞; 陈燕; 余鹏; 罗强; 曲寿江; 沈军

    2014-01-01

    本研究通过活性燃烧高速燃气喷涂(AC-HVAF)方法制备出了均匀致密的铁基非晶化合金涂层。通过调制AC-HVAF喷涂过程的工艺参数,研究了喷涂枪长、喷涂距离和送粉率对涂层非晶化程度的影响,得出控制枪长是形成高质量非晶化涂层的关键,而喷涂距离和送粉率决定了涂层的厚度和形成速率。制备出的铁基非晶合金与基体结合致密,孔隙率较低,完全的非晶化结构有效的保持了铁基非晶合金优异的力学性能,可以对基体材料进行很好的防护。%The uniform and compact Fe-based amorphous alloy coating was prepared by active combustion high velocity air fuel (AC-HVAF) spray method. By tuning the parameters of AC-HVAF spray process, the influence of the spraying gun length, spraying distance, and powder feed rate on non-crystallization has been studied carefully. Results indicate that spraying gun length is the key factor in forming perfect amorphous coating. Spraying distance and powder feed rate may determine the thickness and formation rate of the coating. The prepared coatings have a tight adhesion with the substrate, low porosity, and good non-crystallization, which would effectively maintain the excellent mechanical properties of the Fe-based amorphous alloy. The coating can provide a good protection for the substrate material.

  8. Utilization of spent PWR fuel-advanced nuclear fuel cycle of PWR/CANDU synergism

    Institute of Scientific and Technical Information of China (English)

    HUO Xiao-Dong; XIE Zhong-Sheng

    2004-01-01

    High neutron economy, on line refueling and channel design result in the unsurpassed fuel cycle flexibility and variety for CANDU reactors. According to the Chinese national conditions that China has both PWR and CANDU reactors and the closed cycle policy of reprocessing the spent PWR fuel is adopted, one of the advanced nuclear fuel cycles of PWR/CANDU synergism using the reprocessed uranium of spent PWR fuel in CANDU reactor is proposed, which will save the uranium resource (~22.5%), increase the energy output (~41%), decrease the quantity of spent fuels to be disposed (~2/3) and lower the cost of nuclear power. Because of the inherent flexibility of nuclear fuel cycle in CANDU reactor, and the low radiation level of recycled uranium(RU), which is acceptable for CANDU reactor fuel fabrication, the transition from the natural uranium to the RU can be completed without major modification of the reactor core structure and operation mode. It can be implemented in Qinshan Phase Ⅲ CANDU reactors with little or no requirement of big investment in new design. It can be expected that the reuse of recycled uranium of spent PWR fuel in CANDU reactor is a feasible and desirable strategy in China.

  9. New techniques for the characterization of refuse-derived fuels and solid recovered fuels.

    Science.gov (United States)

    Rotter, Vera Susanne; Lehmann, Annekatrin; Marzi, Thomas; Möhle, Edda; Schingnitz, Daniel; Hoffmann, Gaston

    2011-02-01

    Solid recovered fuel (SRF) today refers to a waste-derived fuel meeting defined quality specifications, in terms of both origin (produced from non-hazardous waste) and levels of certain fuel properties. Refuse-derived fuel (RDF) nowadays is more used for unspecified waste after a basic processing to increase the calorific value and therefore this term usually refers to the segregated, high calorific fraction of municipal solid waste (MSW), commercial or industrial wastes. In comparison with conventional fuels, both types of secondary fuel show waste of inherently varying quality and an increased level of waste-specific contaminants.The transition from RDF to SRF in the emerging national and European market requires a quality assurance system with defined quality parameters and analytical methods to ensure reliable fuel characterization. However, due to the quality requirements for RDF and SRF, the current standardized analysis methods often do not meet these practical demands. Fast test methods, which minimize personnel, financial and time efforts and which are applicable for producers as well as users can be an important supporting tool for RDF- and SRF-characterization. Currently, a fast test system based on incineration and correlation analyses which enable the determination of relevant fuel parameters is under development. Fast test methods are not aimed at replacing current standardized test methods, but have to be considered as practical supporting tools for the characterization of RDF and SRF. PMID:20392788

  10. Microstructure and mechanical properties of AC AlSi9CuX alloys

    Directory of Open Access Journals (Sweden)

    L.A. Dobrzański

    2007-10-01

    Full Text Available Purpose: In order to gain a better understanding of how to control the as-cast microstructure, it is important to understand the evaluation of microstructure during solidification and understanding how influence the changes of chemical concentration on this microstructure and mechanical properties. In this research, the effect of Cu content on the microstructure and mechanical properties of AC AlSi9CuX series alloys has been investigated.Design/methodology/approach: The experimental alloy used in this investigation were prepared at the University of Windsor (Canada in the Light Metals Casting Laboratory, by mixing the AC AlSi5Cu1(Mg commercial alloys and two master alloys AlSi49 and AlCu55, in a 10 kg capacity ceramic crucible. Optical microscope, transition electron microscope and scanning electron microscope were used to characterize the microstructure and intermetallic phases. Secondary dendrite arm spacing measurements were carried out using an Leica Q-WinTM image analyzer. Compression tests were conducted at room temperature using a Zwick universal testing machine. Rockwell F–scale hardness tests were conducted at room temperature using a Zwick HR hardness testing machine. Vickers microhardness tests were conducted using a DUH 202 microhardness testing machine.Findings: It was found that the increase of Cu content to 2 wt% leads to change of the Al+Si eutectic morphology, resulting in a grate increase in the ultimate tensile strength and ductility values compared to the alloys include 1 and 4 wt % of Cu. Based on the X–ray phase analysis was found, that change of Cu content don’t influences on the phases composition of investigated alloy.Practical implications: The aim of this work is describe in detail the solidification process in a number of AC AlSi9CuX foundry alloys. In investigated alloys there were identified five phases, which can suggest together witch thermal analysis, that in these alloys occur four solidification reactions

  11. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    OpenAIRE

    Qin, Zian

    2015-01-01

    After a century of fast developing, the society is facing energy issues again, e.g. the exhaustion of fossil fuel, emission caused air pollution, radiation leakage of nuclear generation, and so on. How to produce and use electricity in a more sustainable, efficient, and cost-effective way thus becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power ele...

  12. COMPARISON OF BACTERIAL ADSORPTION AND ANTIBACTERIAL PROPERTIES BETWEEN AC AND AC(Ag)%AC及AC(Ag)对细菌的吸附及灭菌功能的对比研究

    Institute of Scientific and Technical Information of China (English)

    万怡灶; 王玉林; 董向红; 周福刚; 成国祥; 温廷益; 韩森

    2000-01-01

    测定了活性碳(AC)及载银活性碳(AC(Ag))的比表面积和孔径分布曲线,对比研究了AC及AC(Ag))对大肠杆菌的吸附能力和灭菌性能.结果表明,载银后,虽然AC(Ag)的比表面积下降,但由于银的存在,使其吸附的大肠杆菌数量高于AC,而吸附速率低于AC.灭菌试验表明,AC对大肠杆菌没有杀灭能力,而AC(Ag)对大肠杆菌有较好的灭菌功能.

  13. Feasibility Study on AFR-100 Fuel Conversion from Uranium-based Fuel to Thorium-based Fuel

    International Nuclear Information System (INIS)

    The feasibility study of converting a fast reactor from uranium-based fuel to thorium-based fuel was studied using the 100 MWe Advanced Fast Reactor (AFR-100). Several fuel conversion scenarios were envisioned in this study. The first scenario is a progressive fuel conversion without fissile support. It consists of progressively replacing the burnt uranium-based fuel with pure thorium-based fuel without fissile material addition. This was found to be impractical because the low excess reactivity of the uranium-fuelled AFR-100 core, resulting in an extremely short cycle length even when only a few assemblies are replaced. A second scenario consists in operating the reference LEU fuelled AFR-100 core for 24 years and then replacing one fuel batch out of four every 7.04 years with thorium-based fuel mixed with transuranics. The transuranics weight fraction required during the transition period is identical to that required at equilibrium and is equal to 18.6%. The original uranium-based fuel is discharged with an average burnup of 120 GWd/t and the Th-TRU fuel with an average burnup of 101 GWd/t. The thermal-hydraulic and passive safety performances of this core are similar to those of the reference AFR-100 design. However, Th-TRU fuel fabrication and performance needs to be demonstrated and TRU separation from the LWR used nuclear fuel is necessary. The third scenario proposed consists of replacing the whole AFR-100 core with fuel assemblies made of several thorium and 20% enriched LEU layers. The mode of operation is similar to that of the reference AFR-100 core with the exception of the cycle length which needs to be reduced from 30 to 18 years. The average LEU and thorium discharge burnups are 79 GWd/t and 23 GWd/t, respectively. The major benefit of this approach is the improved inherent safety of the reactor due to the reduced coolant void worth. (author)

  14. Variable transposition of eight maize activator (ac) elements located on the short arm of chromosome 1.

    Science.gov (United States)

    Sheridan, William F

    2011-09-01

    Eight Activator (Ac) transposable elements mapped to the maize chromosome arm 1S were assessed for Ac transposition rates. For each of the Ac stocks, plants homozygous for the single Ac element and the Ds reporter r1-sc:m3 on chromosome 10 were crossed as females by a homozygous r1-sc:m3 tester color-converted W22 line. The resulting ears produced mostly coarsely spotted kernels and a low frequency of either near-colorless fine-spotted kernels or nonspotted kernels. The relative frequency of these two types of near-colorless kernels differed among the eight Ac stocks. The extent to which increased Ac dosage results in nonspotted kernels may be Ac-specific. Although all of the Ac elements are in near-isogenic inbred W22 lines, they varied to a large extent in their transposition frequency. These differences might possibly result from structural differences among the Ac elements. Because one pair of Ac elements derived from Ac33 on chromosome arm 5S differed about 13-fold in transposition frequency and a second pair of Ac elements derived from Ac12 on chromosome arm 1S differed about 3-fold in transposition frequency, this is not a likely explanation for all eight Ac elements. The data presented here support the notion that the differences in transposition frequency of the eight Ac elements may be a reflection of variability in Ac transcription or accessibility of the transposase to the Ac element, resulting from differences in the chromatin environments wherein the Ac elements are located. This is the first report of variability in transposition rates among different Ac donor lines.

  15. The Managerial Transition.

    Science.gov (United States)

    Kneeland, Steven J.

    1980-01-01

    Having identified the problem of managerial transition in a previous article (CE 510 277), the author outlines a strategy for change which includes performance appraisal, definition of the management structure, and counselling for the individual in transition. (SK)

  16. HTGR Fuel performance basis

    International Nuclear Information System (INIS)

    The safety characteristics of the high-temperature gas-cooled reactor (HTGR) during normal and accident conditions are determined in part by HTGR fuel performance. During normal operation, less than 0.1% fuel failure occurs, primarily from defective particles. This low fuel failure fraction limits circulating activity to acceptable levels. During severe accidents, the radiological consequence is influenced by high-temperature fuel particle behavior. An empirical fuel failure model, supported by recent experimental data, is presented. The onset of significant fuel particle failure occurs at temperatures in excess of 16000C, and complete fuel failure occurs at 26600C. This indicates that the fuel is more retentive at higher temperatures than previously assumed. The more retentive nature of the fuel coupled with the high thermal capacitance of the core results in slow release of fission products from the core during severe accidents

  17. BWR fuel performance

    International Nuclear Information System (INIS)

    The General Electric experience base on BWR fuel includes over 29,000 fuel assemblies which contain 1,600,000 fuel rods. Over the last five years, design, process and operating changes have been introduced which have had major effects in improving fuel performance. Monitoring this fuel performance in BWRs has been accomplished through cooperative programs between GE and utilities. Activities such as plant fission product monitoring, fuel sipping and fuel and channel surveillance programs have jointly contributed to the value of this extensive experience base. The systematic evaluation of this data has established well-defined fuel performance trends which provide the assurance and confidence in fuel reliability that only actual operating experience can provide

  18. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  19. Strongly nonlinear dynamics of electrolytes in large ac voltages

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    We study the response of a model microelectrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes...... in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasiequilibrium structure of the double layers. The former leads to the prediction of “ac capacitive desalination” since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion...... nonlinear responses to large ac voltages, such as Faradaic reactions, electro-osmotic instabilities, and induced-charge electrokinetic phenomena....

  20. The minimization of ac phase noise in interferometric systems

    DEFF Research Database (Denmark)

    Filinski, Ignacy; Gordon, R A

    1994-01-01

    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using....... Such a change will lead to a reduction of both low-frequency and high-frequency ac phase noise by more than an order of magnitude and can be carried out for all interferometers with the exception of multiple pass optical systems and high-resolution FFT spectrometers. It is pointed out that most homemade air...

  1. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  2. Offshore windfarm connection with low frequency AC transmission technology

    DEFF Research Database (Denmark)

    Qin, Nan; Xu, Zhao; You, Shi;

    2009-01-01

    This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared to the c......This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared...... to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...

  3. Experiments on Corona Discharge Under AC and DC Composite Voltage

    Institute of Scientific and Technical Information of China (English)

    ZHU Zhengyi; LI Ruihai; WANG Guoli; CHEN Can; JIA Zhidong; GUAN Zhicheng

    2012-01-01

    Converter transformers are one of the most important electrical apparatuses in the ultra high voltage(UHV) DC transmission systems.The valve side and the low voltage(LV) bushing are stressed by long-term AC and DC composite voltage leading to significant partial discharge(PD) and posing great danger to the insulation system.In this paper AC and DC composite voltage is applied on a metal needle-plate model to produce PD signal sequences,and then the pulse waveshape and frequency spectrum are analyzed and compared with PD signals under conventional AC or DC voltage.In the end,the phase-resolved distribution is analyzed to depict the new characteristics of PD under this composite voltage.

  4. Harmonic-free line-commutated ac/dc rectifiers

    Energy Technology Data Exchange (ETDEWEB)

    Villablanca, Miguel E. [Electrical Engineering Department, University of Santiago, P.O. Box 10233, Santiago (Chile)

    2009-11-15

    In this paper both a method and apparatus are applied to different configurations of line-commutated ac/dc rectifiers to reduce the distortion of currents flowing from the ac supply. The load may be either inductive or capacitive. The technology involves an accurate shaping of the dc current by using two self-commutated switches. This dc-current shaping is reflected back into the shaping of the ac input currents, which become pure sine waves. Thyristor-based rectifying operation is possible with a simple control circuit, which is able to deal with both rapid load variations and failures in the self-commutated switches. Furthermore, the overlap conduction of bridge thyristors is eliminated completely. Experimental verification is provided from a 400-V 30-kVA 50-Hz laboratory prototype. (author)

  5. Theory of the ac spin-valve effect.

    Science.gov (United States)

    Kochan, Denis; Gmitra, Martin; Fabian, Jaroslav

    2011-10-21

    The spin-valve complex magnetoimpedance of symmetric ferromagnet-normal-metal-ferromagnet junctions is investigated within the drift-diffusion (standard) model of spin injection. The ac magnetoresistance-the real part difference of the impedances of the parallel and antiparallel magnetization configurations-exhibits an overall damped oscillatory behavior, as an interplay of the diffusion and spin relaxation times. In wide junctions the ac magnetoresistance oscillates between positive and negative values, reflecting resonant amplification and depletion of the spin accumulation, while the line shape for thin tunnel junctions is predicted to be purely Lorentzian. The ac spin-valve effect could be a technique to extract spin transport and spin relaxation parameters in the absence of a magnetic field and for a fixed sample size. PMID:22107552

  6. Measurement and comparison of AC parameters of silicon (BSR and BSFR) and gallium arsenide (GaAs/Ge) solar cells used in space applications

    Energy Technology Data Exchange (ETDEWEB)

    Anil Kumar, R.; Suresh, M.S. [ISRO Satellite Centre, ISRO, Bangalore 560, 017 Kolhapur (India); Nagaraju, J. [Department of Instrumentation, Indian Institute of Science, Bangalore 560, 012 Kolhapur (India)

    2000-01-15

    The AC parameters of silicon (BSR and BSFR) solar cells and GaAs/Ge solar cell have been measured using impedance spectroscopy. Each cell capacitance, dynamic resistance and series resistance were measured and compared. GaAs/Ge solar cell has shown only the transition capacitance throughout its operating range while silicon (BSR and BSFR) solar cells exhibited both transition and diffusion capacitance. The theoretical and experimental values of dynamic resistance were compared and found in good agreement while the diode factor in silicon solar cells varies from 2 to 1, where as in GaAs/Ge solar cell it varies from 4 to 2 to 1.

  7. DUPIC fuel compatibility assessment

    International Nuclear Information System (INIS)

    The purpose of this study is to assess the compatibility of DUPIC (Direct Use of Spent PWR Fuel in CANDU Reactors) fuel with the current CANDU 6 reactor, which is one of the technology being developed to utilize the spent PWR fuel in CANDU reactors. The Phase II study of this project includes the analysis of impact on the reactor safety, the development of core design technology, the development of fuel supply technology of optimal composition, and feasibility analysis on localization and license of DUPIC fuel. From the reactor safety analysis results, it is known that DUPIC fuel satisfies the safety limit of reactor containment and public dose for single failure. But, the safety limit may be exceeded for dual failure. Therefore, more analysis is needed for the removal of excessive conservatism in accident analysis methodology and modification of transient fuel behavior analysis methodology. The results of the validation calculations of core design methodology have confirmed that the current core analysis system is acceptable for the feasibility study of the DUPIC fuel compatibility analysis. The results of compatibility and fuel fabrication have shown that DUPIC fuel is technically feasible. For practical use and licensing, however, more research items required in the practical use, fuel rod and bundle design and fuel loading are should be performed. When these items are performed and resolved, the compatibility of the DUPIC fuel is achieved, and, eventually, the possibility of DUPIC fuel licensing can be confirmed

  8. PUREX transition project case study

    Energy Technology Data Exchange (ETDEWEB)

    Jasen, W.G.

    1996-04-15

    In December 1992, the US Department of Energy (DOE) directed that the Plutonium-Uranium Extraction (PUREX) Plant be shut down and deactivated because it was no longer needed to support the nation`s production of weapons-grade plutonium. The PUREX/UO{sub 2} Deactivation Project will establish a safe and environmentally secure configuration for the facility and preserve that configuration for 10 years. The 10-year span is used to predict future maintenance requirements and represents the estimated time needed to define, authorize, and initiate the follow-on decontamination and decommissioning activities. Accomplishing the deactivation project involves many activities. Removing major hazards, such as excess chemicals, spent fuel, and residual plutonium are major goals of the project. The scope of the PUREX Transition Project is described within.

  9. F2AC: A Lightweight, Fine-Grained, and Flexible Access Control Scheme for File Storage in Mobile Cloud Computing

    Directory of Open Access Journals (Sweden)

    Wei Ren

    2016-01-01

    Full Text Available Current file storage service models for cloud servers assume that users either belong to single layer with different privileges or cannot authorize privileges iteratively. Thus, the access control is not fine-grained and flexible. Besides, most access control methods at cloud servers mainly rely on computationally intensive cryptographic algorithms and, especially, may not be able to support highly dynamic ad hoc groups with addition and removal of group members. In this paper, we propose a scheme called F2AC, which is a lightweight, fine-grained, and flexible access control scheme for file storage in mobile cloud computing. F2AC can not only achieve iterative authorization, authentication with tailored policies, and access control for dynamically changing accessing groups, but also provide access privilege transition and revocation. A new access control model called directed tree with linked leaf model is proposed for further implementations in data structures and algorithms. The extensive analysis is given for justifying the soundness and completeness of F2AC.

  10. Cities in Transition

    OpenAIRE

    Shepotylo Oleksandr

    2012-01-01

    This paper looks at the urban development of transition countries in 1991–2010, primarily focusing on the last decade. Cities in transition face a unique set of challenges that came forth due to interplay of the legacy of socialist urban policies and the transition to the market economy. The socialist urban policies restrained growth of the largest cities and distorted the spatial equilibrium towards more uniform distribution of urban population. The transition to the market economy reduces d...

  11. Cosmological phase transitions

    Energy Technology Data Exchange (ETDEWEB)

    Kolb, E.W. [Fermi National Accelerator Lab., Batavia, IL (United States)]|[Chicago Univ., IL (United States)

    1993-10-01

    If modern ideas about the role of spontaneous symmetry breaking in fundamental physics are correct, then the Universe should have undergone a series of phase transitions early in its history. The study of cosmological phase transitions has become an important aspect of early-Universe cosmology. In this lecture I review some very recent work on three aspects of phase transitions: the electroweak transition, texture, and axions.

  12. Introducing high performance distributed logging service for ACS

    Science.gov (United States)

    Avarias, Jorge A.; López, Joao S.; Maureira, Cristián; Sommer, Heiko; Chiozzi, Gianluca

    2010-07-01

    The ALMA Common Software (ACS) is a software framework that provides the infrastructure for the Atacama Large Millimeter Array and other projects. ACS, based on CORBA, offers basic services and common design patterns for distributed software. Every properly built system needs to be able to log status and error information. Logging in a single computer scenario can be as easy as using fprintf statements. However, in a distributed system, it must provide a way to centralize all logging data in a single place without overloading the network nor complicating the applications. ACS provides a complete logging service infrastructure in which every log has an associated priority and timestamp, allowing filtering at different levels of the system (application, service and clients). Currently the ACS logging service uses an implementation of the CORBA Telecom Log Service in a customized way, using only a minimal subset of the features provided by the standard. The most relevant feature used by ACS is the ability to treat the logs as event data that gets distributed over the network in a publisher-subscriber paradigm. For this purpose the CORBA Notification Service, which is resource intensive, is used. On the other hand, the Data Distribution Service (DDS) provides an alternative standard for publisher-subscriber communication for real-time systems, offering better performance and featuring decentralized message processing. The current document describes how the new high performance logging service of ACS has been modeled and developed using DDS, replacing the Telecom Log Service. Benefits and drawbacks are analyzed. A benchmark is presented comparing the differences between the implementations.

  13. Minimization of actinide waste by multi-recycling of thoriated fuels in the EPR reactor

    OpenAIRE

    Nuttin A.; Siem S.; Ivanov E.; Méplan O.; David S; Guillemin P.; Wilson J.N.; Capellan N.; Rose S.J.

    2012-01-01

    The multi-recycling of innovative uranium/thorium oxide fuels for use in the European Pressurized water Reactor (EPR) has been investigated. If increasing quantities of 238U, the fertile isotope in standard UO2 fuel, are replaced by 232Th, then a greater yield of new fissile material (233U) is produced during the cycle than would otherwise be the case. This leads to economies of natural uranium of around 45% if the uranium in the spent fuel is multi-recycled. In addition we show that minor ac...

  14. Trends in catalytic NO decomposition over transition metal surfaces

    DEFF Research Database (Denmark)

    Falsig, Hanne; Bligaard, Thomas; Rass-Hansen, Jeppe;

    2007-01-01

    The formation of NOx from combustion of fossil and renewable fuels continues to be a dominant environmental issue. We take one step towards rationalizing trends in catalytic activity of transition metal catalysts for NO decomposition by combining microkinetic modelling with density functional...... theory calculations. We show specifically why the key problem in using transition metal surfaces to catalyze direct NO decomposition is their significant relative overbinding of atomic oxygen compared to atomic nitrogen....

  15. Transitivity of Preferences

    Science.gov (United States)

    Regenwetter, Michel; Dana, Jason; Davis-Stober, Clintin P.

    2011-01-01

    Transitivity of preferences is a fundamental principle shared by most major contemporary rational, prescriptive, and descriptive models of decision making. To have transitive preferences, a person, group, or society that prefers choice option "x" to "y" and "y" to "z" must prefer "x" to "z". Any claim of empirical violations of transitivity by…

  16. Aligned Immobilization of Proteins Using AC Electric Fields.

    Science.gov (United States)

    Laux, Eva-Maria; Knigge, Xenia; Bier, Frank F; Wenger, Christian; Hölzel, Ralph

    2016-03-01

    Protein molecules are aligned and immobilized from solution by AC electric fields. In a single-step experiment, the enhanced green fluorescent proteins are immobilized on the surface as well as at the edges of planar nanoelectrodes. Alignment is found to follow the molecules' geometrical shape with their longitudinal axes parallel to the electric field. Simultaneous dielectrophoretic attraction and AC electroosmotic flow are identified as the dominant forces causing protein movement and alignment. Molecular orientation is determined by fluorescence microscopy based on polarized excitation of the proteins' chromophores. The chromophores' orientation with respect to the whole molecule supports X-ray crystal data. PMID:26779699

  17. Droop-free Distributed Control for AC Microgrids

    DEFF Research Database (Denmark)

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.;

    2016-01-01

    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...

  18. AC and Phase Sensing of Nanowires for Biosensing.

    Science.gov (United States)

    Crescentini, Marco; Rossi, Michele; Ashburn, Peter; Lombardini, Marta; Sangiorgi, Enrico; Morgan, Hywel; Tartagni, Marco

    2016-04-19

    Silicon nanowires are label-free sensors that allow real-time measurements. They are economical and pave the road for point-of-care applications but require complex readout and skilled personnel. We propose a new model and technique for sensing nanowire sensors using alternating currents (AC) to capture both magnitude and phase information from the sensor. This approach combines the advantages of complex impedance spectroscopy with the noise reduction performances of lock-in techniques. Experimental results show how modifications of the sensors with different surface chemistries lead to the same direct-current (DC) response but can be discerned using the AC approach.

  19. Active Power Regulation based on Droop for AC Microgrid

    DEFF Research Database (Denmark)

    Li, Chendan; Coelho, Ernane A. A.; Firoozabadi, Mehdi Savaghebi;

    2015-01-01

    In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed to succes......In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed...

  20. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    DEFF Research Database (Denmark)

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig

    2016-01-01

    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling. The vol......This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling...