WorldWideScience

Sample records for ac transit demos

  1. Alameda-Contra Costa Transit District (AC Transit) Fuel Cell Transit Buses: Preliminary Evaluation Results

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2007-03-01

    This report provides an evaluation of three prototype fuel cell-powered transit buses operating at AC Transit in Oakland, California, and six baseline diesel buses similar in design to the fuel cell buses.

  2. Breeding blanket for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Proust, E. (Commissariat a l' Energie Atomique (CEA), DRN/DMT/SERMA, CE, Saclay (France)); Anzidei, L. (ENEA/FUS, C.R.E., Frascati (Italy)); Casini, G. (Commission of the European Communities, Joint Research Center, Ispara (Italy)); Dalle Donne, M. (Kernforschungszentrum Karlsruhe GmbH (Germany)); Giancarli, L. (Commissariat a l' Energie Atomique (CEA), DRN/DMT/SERMA, CE, Saclay (France)); Malang, S. (Kernforschungszentrum Karlsruhe GmbH (Germany))

    1993-03-01

    This paper presents the main design features, their rationale, and the main critical issues for the development, of the four DEMO-relevant blanket concepts presently being investigated within the framework of the European Test-Blanket Development Programme. (orig.)

  3. Breeding blanket for Demo

    Energy Technology Data Exchange (ETDEWEB)

    Proust, E.; Giancarli, L. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. de Mecanique et de Technologie; Anzidei, L. [ENEA, Frascati (Italy). Centro Ricerche Energia; Casini, G. [Commission of the European Communities, Ispra (Italy). Joint Research Centre; Dalle Donne, M.; Malang, S. [Kernforschungszentrum Karlsruhe GmbH (Germany)

    1992-12-31

    This paper presents the main design features, their rationale, and the main critical issues for the development, of the four DEMO-relevant blanket concepts presently investigated within the framework of the European Test-Blanket Development Programme.

  4. National Fuel Cell Bus Program: Accelerated Testing Evaluation Report and Appendices, Alameda-Contra Costa Transit District (AC Transit)

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 through October 2008. Evaluation results include implementation experience, fueling station operation, fuel cell bus operations at Golden Gate Transit, and evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and roadcalls).

  5. National Fuel Cell Bus Program: Accelerated Testing Evaluation Report #2, Alameda-Contra Costa Transit District (AC Transit) and Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2010-06-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006, comparing similar diesel buses operating from the same depot. It covers November 2007 through February 2010. Results include implementation experience, fueling station operation, evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and road calls), and a summary of achievements and challenges encountered during the demonstration.

  6. DEMO diagnostics and burn control

    NARCIS (Netherlands)

    Biel, W.; de M. Baar,; Dinklage, A.; Felici, F.; Konig, R.; Meister, H.; Treutterer, W.; Wenninger, R.

    2015-01-01

    The development of the control system for a tokamak demonstration fusion reactor (DEMO) faces unprecedented challenges. First, the requirements for control reliability and accuracy are more stringent than on existing fusion devices: any loss of plasma control on DEMO may result in a disruption which

  7. DEMO diagnostics and burn control

    NARCIS (Netherlands)

    Biel, W.; de M. Baar,; Dinklage, A.; Felici, F.; Konig, R.; Meister, H.; Treutterer, W.; Wenninger, R.

    2015-01-01

    The development of the control system for a tokamak demonstration fusion reactor (DEMO) faces unprecedented challenges. First, the requirements for control reliability and accuracy are more stringent than on existing fusion devices: any loss of plasma control on DEMO may result in a disruption which

  8. International Perspectives on a Path to MFE DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Neilson, George H.; Abdou, M.; Federici, Gianfranco; Garofalo, A. M.; Kamendje, R.; Kaw, Predhiman K.; Kim, Keeman; Kurtz, Richard J.; Kuteev, Boris V.; Ward, David; Yamada, Hiroshi; Zohm, Hartmut

    2013-01-07

    The establishment of the ITER project marks a transition in the world fusion program to one increasingly focused on the demonstration of electricity generation from fusion, or DEMO. In recent years, planning and design activities for next steps toward DEMO have intensified in many countries, and international discussions have identified both needs and opportunities for greater international collaboration in developing a DEMO Programme. The scientific and technical issues for fusion are well known and, while there is no agreement on a single roadmap to fusion, there is substantial scope to add value through international cooperation, particularly in promoting a coordinated DEMO programme. The International Atomic Energy Agency, as a world organization dedicated to fostering international collaboration in the development of nuclear energy for peaceful purposes, is well suited to provide auspices for an activity promoting an international exchange of technical information and strategic thinking that would benefit all parties. Accordingly, an IAEA DEMO Programme Workshop series focus on the scientific and technical issues for fusion development toward DEMO has been established. The first workshop will be held 15-18 October 2012 in the U.S.A.

  9. DemoCensus_BLCK2000

    Data.gov (United States)

    Vermont Center for Geographic Information — DemoCensus_BLCK2000 includes Census 2000 Block boundaries and SF1 attributes. The data was downloaded (http://arcdata.esri.com/data/tiger2000/tiger_download.cfm) by...

  10. Stick-slip to sliding transition of dynamic contact lines under AC electrowetting

    NARCIS (Netherlands)

    Mannetje, 't D.J.C.M.; Mugele, F.; Ende, van den D.

    2013-01-01

    We show that at low velocities the dynamics of a contact line of a water drop moving over a Teflon-like surface under ac electrowetting must be described as stick–slip motion, rather than one continuous movement. At high velocities we observe a transition to a slipping regime. In the slipping regime

  11. Status of DEMO-FNS development

    Science.gov (United States)

    Kuteev, B. V.; Shpanskiy, Yu. S.; DEMO-FNS Team

    2017-07-01

    Fusion-fission hybrid facility based on superconducting tokamak DEMO-FNS is developed in Russia for integrated commissioning of steady-state and nuclear fusion technologies at the power level up to 40 MW for fusion and 400 MW for fission reactions. The project status corresponds to the transition from a conceptual design to an engineering one. This facility is considered, in RF, as the main source of technological and nuclear science information, which should complement the ITER research results in the fields of burning plasma physics and control.

  12. The DEMO Quasisymmetric Stellarator

    Directory of Open Access Journals (Sweden)

    Geoffrey B. McFadden

    2010-02-01

    Full Text Available The NSTAB nonlinear stability code solves differential equations in conservation form, and the TRAN Monte Carlo test particle code tracks guiding center orbits in a fixed background, to provide simulations of equilibrium, stability, and transport in tokamaks and stellarators. These codes are well correlated with experimental observations and have been validated by convergence studies. Bifurcated 3D solutions of the 2D tokamak problem have been calculated that model persistent disruptions, neoclassical tearing modes (NTMs and edge localized modes (ELMs occurring in the International Thermonuclear Experimental Reactor (ITER, which does not pass the NSTAB simulation test for nonlinear stability. So we have designed a quasiaxially symmetric (QAS stellarator with similar proportions as a candidate for the demonstration (DEMO fusion reactor that does pass the test [1]. The configuration has two field periods and an exceptionally accurate 2D symmetry that furnishes excellent thermal confinement and good control of the prompt loss of alpha particles. Robust coils are found from a filtered form of the Biot-Savart law based on a distribution of current over a control surface for the coils and the current in the plasma defined by the equilibrium calculation. Computational science has addressed the issues of equilibrium, stability, and transport, so it remains to develop an effective plan to construct the coils and build a diverter.

  13. The DEMO wall load challenge

    Science.gov (United States)

    Wenninger, R.; Albanese, R.; Ambrosino, R.; Arbeiter, F.; Aubert, J.; Bachmann, C.; Barbato, L.; Barrett, T.; Beckers, M.; Biel, W.; Boccaccini, L.; Carralero, D.; Coster, D.; Eich, T.; Fasoli, A.; Federici, G.; Firdaouss, M.; Graves, J.; Horacek, J.; Kovari, M.; Lanthaler, S.; Loschiavo, V.; Lowry, C.; Lux, H.; Maddaluno, G.; Maviglia, F.; Mitteau, R.; Neu, R.; Pfefferle, D.; Schmid, K.; Siccinio, M.; Sieglin, B.; Silva, C.; Snicker, A.; Subba, F.; Varje, J.; Zohm, H.

    2017-04-01

    For several reasons the challenge to keep the loads to the first wall within engineering limits is substantially higher in DEMO compared to ITER. Therefore the pre-conceptual design development for DEMO that is currently ongoing in Europe needs to be based on load estimates that are derived employing the most recent plasma edge physics knowledge. An initial assessment of the static wall heat load limit in DEMO infers that the steady state peak heat flux limit on the majority of the DEMO first wall should not be assumed to be higher than 1.0 MW m-2. This compares to an average wall heat load of 0.29 MW m-2 for the design {\\tt {EU}}{\\tt {~}}{\\tt {DEMO1}}{\\tt {~2015}} assuming a perfect homogeneous distribution. The main part of this publication concentrates on the development of first DEMO estimates for charged particle, radiation, fast particle (all static) and disruption heat loads. Employing an initial engineering wall design with clear optimization potential in combination with parameters for the flat-top phase (x-point configuration), loads up to 7 MW m-2 (penalty factor for tolerances etc not applied) have been calculated. Assuming a fraction of power radiated from the x-point region between 1/5 and 1/3, peaks of the total power flux density due to radiation of 0.6-0.8 MW m-2 are found in the outer baffle region. This first review of wall loads, and the associated limits in DEMO clearly underlines a significant challenge that necessitates substantial engineering efforts as well as a considerable consolidation of the associated physics basis.

  14. Divertor power spreading in DEMO reactor by impurity seeding

    Energy Technology Data Exchange (ETDEWEB)

    Zagórski, Roman, E-mail: Roman.Zagorski@ipplm.pl; Gałązka, Krzysztof; Ivanova-Stanik, Irena

    2016-11-01

    Highlights: • The COREDIV code has been used to simulate DEMO inductive discharges with different impurity seeding (Ne, Ar, Kr) and different sputtering models (with and w/o prompt re-deposition process). • It has been shown that only for Ar and Kr seeding it is possible to achieve H-mode plasma operation with acceptable level of the power to the tungsten target plates. • For neon seeding, such regime of operation seems not to be possible. • Prompt re-deposition model extends the DEMO operation window. - Abstract: Numerical simulation with COREDIV code of DEMO H-mode discharges (tungsten divertor and wall) are performed considering the influence of seeding impurities with different atomic numbers: Ne, Ar and Kr on the DEMO scenarios. The approach is based on integrated numerical modeling using the COREDIV code, which self-consistently solves radial transport equations in the core region and 2D multi-fluid transport in the SOL. In this paper we focus on investigations how the operational domain of DEMO can be influenced by seeding gasses. Simulations with the updated prompt re-deposition model implemented in the code show that only for Ar and Kr, for high enough radial diffusion in the SOL, it is possible to achieve H-mode plasma operation (power to the SOL> L-H transition threshold power) with acceptable level of the power to the target plates. For neon seeding such regime of operation seems not to be possible.

  15. DEMO diagnostics and burn control

    Energy Technology Data Exchange (ETDEWEB)

    Biel, Wolfgang, E-mail: w.biel@fz-juelich.de [Institute of Energy and Climate Research, Forschungszentrum Jülich GmbH, Jülich (Germany); Department of Applied Physics, Ghent University (Belgium); Baar, Marco de [FOM-Institute DIFFER, Nieuwegein (Netherlands); Eindhoven University of Technology (Netherlands); Dinklage, Andreas [Max-Planck-Institut für Plasmaphysik, Greifswald (Germany); Felici, Federico [Eindhoven University of Technology (Netherlands); König, Ralf [Max-Planck-Institut für Plasmaphysik, Greifswald (Germany); Meister, Hans; Treutterer, Wolfgang [Max-Planck-Institut für Plasmaphysik, Garching (Germany); Wenninger, Ronald [Max-Planck-Institut für Plasmaphysik, Garching (Germany); EFDA Power Plant Physics and Technology, Garching (Germany)

    2015-10-15

    Highlights: • An initial concept for the DEMO diagnostic and control system is presented. • A preliminary list of control functions and candidate diagnostics is developed. • Challenges regarding disruptions, power exhaust and radiation control are highlighted. • The need for introducing realistic control margins is emphasized. • On outline of the future R&D plan is presented. - Abstract: The development of the control system for a tokamak demonstration fusion reactor (DEMO) faces unprecedented challenges. First, the requirements for control reliability and accuracy are more stringent than on existing fusion devices: any loss of plasma control on DEMO may result in a disruption which could damage the inner wall of the machine, while operating the device with larger margins against the operational limits would lead to a reduction of the electrical output power. Second, the performance of DEMO control is limited by space restrictions for the implementation of components (optimization of the tritium breeding rate), by lifetime issues for the front-end parts (neutron and gamma radiation, erosion and deposition acting on all components) and by slow, weak and indirect action of the available actuators (plasma shaping, heating and fuelling). The European DEMO conceptual design studies include the development of a reliable control system, since the details of the achievable plasma scenario and the machine design may depend on the actual performance of the control system. In the first phase of development, an initial understanding of the prime choices of diagnostic methods applicable to DEMO, implementation and performance issues, the interrelation with the plasma scenario definition, and the planning of necessary future R&D have been obtained.

  16. Demo of Gaze Controlled Flying

    DEFF Research Database (Denmark)

    Alapetite, Alexandre; Hansen, John Paulin; Scott MacKenzie, I.

    2012-01-01

    Development of a control paradigm for unmanned aerial vehicles (UAV) is a new challenge to HCI. The demo explores how to use gaze as input for locomotion in 3D. A low-cost drone will be controlled by tracking user’s point of regard (gaze) on a live video stream from the UAV....

  17. Influence of the ac Stark effect on multiphoton transitions in molecules

    Science.gov (United States)

    Meerts, W. Leo; Ozier, Irving; Hougen, Jon T.

    1989-05-01

    A multiphoton mechanism for molecular beam transitions is presented which relies on a large first-order ac Stark effect to modulate the energy separation of the initial and final states of the multiphoton transition, but which does not require the presence of any intermediate level(s). The theoretical formalism uses ideas from the laser multiphoton literature for a two-level system interacting with a monochromatic electromagnetic radiation field, together with a close analog of the rotating wave approximation. The diagonal matrix elements of the Hamiltonian operator corresponding to the large ac Stark effect are removed by a mathematical substitution which in effect transforms appropriate differences of these diagonal elements into transition moments involving higher harmonics of the frequency of the monochromatic radiation field. The electric field strength of the true monochromatic radiation field is ``distributed'' among the higher harmonics of the effective field according to an expression involving Bessel functions. Because these Bessel functions are bounded, there exists for a given time t of exposure to the radiation, a threshold for the magnitude of the transition dipole matrix element coupling the two levels: Below this threshold, the transition probability in a traditional one-photon molecular beam electric resonance experiment cannot be made unity simply by increasing the amplitude of the radiation field. In fact, if the coupling matrix element is small enough, the molecular beam electric resonance signal cannot be detected within exposure time t. The algebraic formalism described above is checked by computer solution of an initial value problem involving four real coupled linear differential equations. It is then used to explain the multiphoton transitions previously observed in molecular beam electric resonance studies on the two symmetric top molecules OPF3 and CH3 CF3, where the number of photons involved in a given transition varies from 1

  18. RF H and CD systems for DEMO - Challenges and opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Franke, T.; Wenninger, R. [EFDA Close Support Unit, Boltzmannstr. 2, D - 85748 Garching, Germany and Max-Planck-Institut für Plasmaphysik, EURATOM Association, Boltzmannstr. 2, D - 85748 Garching (Germany); Barbato, E.; Cardinali, A.; Cesario, R.; Mirizzi, F.; Tuccillo, A. A. [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044-Frascati, Rome (Italy); Ceccuzzi, S. [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044-Frascati, Rome, Italy and Applied Electronics Department, Roma Tre University, Via della Vasca Navale, 84 00146, Roma (Italy); Eester, D. V.; Lerche, E. [Association EURATOM-Belgian State, LPP-ERM/KMS, TEC partner, Brussels (Belgium); Mayoral, M.-L. [EFDA Close Support Unit, Boltzmannstr. 2, D - 85748 Garching, Germany and Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Nightingale, M. [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Noterdaeme, J.-M.; Poli, E.; Zohm, H. [Max-Planck-Institut für Plasmaphysik, EURATOM Association, Boltzmannstr. 2, D - 85748 Garching (Germany)

    2014-02-12

    The aim of driving a sufficient amount of plasma current with an appropriate radial current density profile is considered as one of the key challenges for a tokamak fusion power plant in steady state operation. Furthermore, efficient heating to enable transition to regime of enhanced confinement and to achieve breakeven plasma temperatures as well as MHD control and plasma breakdown assistance are required. In the framework of the EFDA Power Plant Physics and Technology (PPPT) activities, the ability of the Electron cyclotron (EC), Ion Cyclotron (IC) and Lower Hybrid (LH) systems to fulfil these requirements, was studied for a demonstration fusion power plant (DEMO). As boundary condition, a 1D description of the plasma for a pulsed DEMO based on system code studies combined with transport analysis was developed. The predicted 1D plasma parameters were used to calculate the current drive (CD) efficiency of each system and eventually optimised it. As an example, the EC current drive efficiency could be increased strongly by top launch compared to equatorial launch at least by a factor of two. For the IC system, two possible windows of operation for standard and higher frequencies were highlighted, whereby again top launch leads to higher CD-efficiencies. The efficiencies predicted for DEMO for the RF current drive systems will be presented. Finally, gaps in the feasibility of RF systems under DEMO relevant conditions will be identified.

  19. Investigation of the hydrogen release incident at the AC Transit Emeryville Facility.

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Aaron P.; San Marchi, Christopher W.; Levin, Jamie; Butler, Dennis

    2012-06-01

    This report summarizes the investigation of the release of approximately 300kg of hydrogen at the AC Transit Facility in Emeryville, CA. The hydrogen release was avoidable in both the root cause and contributing factors. The report highlights the need for communication in all phases of project planning and implementation. Apart from the failed valve, the hydrogen system functioned as designed, venting the hydrogen gas a safe distance above surrounding structures and keeping the subsequent fire away from personnel and equipment. The Emeryville Fire Department responded appropriately given the information provided to the Incident Commander. No injuries or fatalities resulted from the incident.

  20. The ac Stark shifts of the terahertz clock transitions of barium

    Institute of Scientific and Technical Information of China (English)

    余庚华; 耿鹰鸽; 李隆; 周超; 段丞博; 柴瑞鹏; 杨永明

    2015-01-01

    Wavelength-dependent AC Stark shifts and magic wavelengths of the terahertz clock transitions between the metastable triplet states 6s5d 3D1 and 6s5d 3D2 are investigated with considering the optical lattice trapping of barium atoms with the linearly polarized laser. The trap depths and the slopes of light shift difference with distinct magic wave-lengths of the optical lattices are also discussed in detail. Several potentially suitable working points for the optical lattice trapping laser are recommended and selected from these magic wavelengths.

  1. Pulsed DEMO design assessment studies

    CERN Document Server

    Todd, T N

    2013-01-01

    Now that ITER is under construction, interest is increasing in the specification and design of the successor machine, a Demonstration Power Plant (DEMO), which in Europe is coordinated by the EFDA Power Plant Physics and Technology programme. This paper summarises the work carried out for EFDA in 2011-2012 on design issues pertinent to a pulsed version of DEMO, intended to be implemented with little or no extrapolation of technology available today. The work was carried out by the Euratom Fusion Associations CCFE, CEA, CRPP, ENEA and KIT, and in addition to a review of recent relevant literature addressed systems code analyses (pulse length vs. size), erosion of plasma facing components, thermomechanical fatigue in the blanket and first wall, a range of energy storage issues, and fatigue life improvements in Nb3Sn CICC superconductors.

  2. PSO-Ensemble Demo Application

    DEFF Research Database (Denmark)

    2004-01-01

    Within the framework of the PSO-Ensemble project (FU2101) a demo application has been created. The application use ECMWF ensemble forecasts. Two instances of the application are running; one for Nysted Offshore and one for the total production (except Horns Rev) in the Eltra area. The output...... is available via two password-protected web-pages hosted at IMM and is used daily by Elsam and E2....

  3. PSO-Ensemble Demo Application

    DEFF Research Database (Denmark)

    2004-01-01

    Within the framework of the PSO-Ensemble project (FU2101) a demo application has been created. The application use ECMWF ensemble forecasts. Two instances of the application are running; one for Nysted Offshore and one for the total production (except Horns Rev) in the Eltra area. The output is a...... is available via two password-protected web-pages hosted at IMM and is used daily by Elsam and E2....

  4. AC-field-induced quantum phase transitions in density of states

    Science.gov (United States)

    Yang, Kai-Hua; Liu, Kai-Di; Wang, Huai-Yu; Qin, Chang-Dong

    2016-02-01

    We investigate the joint effects of the intralead electron interaction and an external alternating gate voltage on the time-averaged local density of states (DOSs) of a quantum dot coupled to two Luttinger-liquid leads in the Kondo regime. A rich dependence of the DOSs on the driving amplitude and intralead interaction is demonstrated. We show that the feature is quite different for different interaction strengths in the presence of the ac field. It is shown that the photon-assisted transport processes cause an additional splitting of the Kondo peak or dip, which exhibits photon-assisted single-channel (1CK) or two-channel Kondo (2CK) physics behavior. The phase transition between photon-assisted 1CK and 2CK physics occurs when the interaction strength is moderately strong. The inelastic channels associated with photon-assisted electron tunneling can dominate electron transport for weak interaction when the ac amplitude is greater than the frequency by one order of magnitude. In the limit of strong interaction the DOSs scale as a power-law behavior which is strongly affected by the ac field.

  5. A Demo Processor as an Educational Tool

    NARCIS (Netherlands)

    van Moergestel, L.; van Nieuwland, K.; Vermond, L.; Meyer, John-Jules Charles

    2014-01-01

    Explaining the workings of a processor can be done in several ways. Just a written explanation, some pictures, a simulator program or a real hardware demo. The research presented here is based on the idea that a slowly working hardware demo could be a nice tool to explain to IT students the inner

  6. Stick-Slip to Sliding Transition of Dynamic Contact Lines under AC Electrowetting.

    Science.gov (United States)

    't Mannetje, D J C M; Mugele, F; van den Ende, D

    2013-12-03

    We show that at low velocities the dynamics of a contact line of a water drop moving over a Teflon-like surface under ac electrowetting must be described as stick-slip motion, rather than one continuous movement. At high velocities we observe a transition to a slipping regime. In the slipping regime the observed dependence of the contact angle is well described by a linearization of both the hydrodynamic and the molecular-kinetic model for the dynamic contact line behavior. The overall geometry of the drop also has a strong influence on the contact angle: if the drop is confined to a disk-like shape with radius R, much larger than the capillary length, and height h, smaller than the capillary length, the advancing angle increases steeper with velocity as the aspect ratio h/R is smaller. Although influence of the flow field near a contact line on the contact angle behavior has also been observed in other experiments, these observations do not fit either model. Finally, in our ac experiments no sudden increase of the hysteresis beyond a certain voltage and velocity was observed, as reported by other authors for a dc voltage, but instead we find with increasing voltage a steady decrease of the hysteresis.

  7. Compact Stellarator Path to DEMO

    Science.gov (United States)

    Lyon, J. F.

    2007-11-01

    Issues for a DEMO reactor are sustaining an ignited/high-Q plasma in steady state, avoiding disruptions and large variations in power flux to the wall, adequate confinement of thermal plasma and alpha-particles, control of a burning plasma, particle and power handling, etc. Compact stellarators have key advantages -- steady-state high-plasma-density operation without external current drive or disruptions, stability without a close conducting wall or active feedback systems, and low recirculating power -- in addition to moderate plasma aspect ratio, good confinement, and high-beta potential. The ARIES-CS study established that compact stellarators can be competitive with tokamaks as reactors. Many of the issues for a compact stellarator DEMO can be answered using results from large tokamaks, ITER D-T experiments and fusion materials, technology and component development programs, in addition to stellarators in operation, under construction or in development. However, a large next-generation stellarator will be needed to address some physics issues: size scaling and confinement at higher parameters, burning plasma issues, and operation with a strongly radiative divertor. Technology issues include simpler coils, structure, and divertor fabrication, and better cost information.

  8. Constructing a Tibetan Demos in Exile

    DEFF Research Database (Denmark)

    Brox, Trine

    2012-01-01

    homeland. Two specific instances of the construction of a transnational exile demos are investigated: citizenship and political representation. The Tibetan Government-in-Exile's formalized idea of citizenship builds upon ideals of equal and loyal members who form a single unit bounded by a common cause....... This also constitutes the foundation for Tibetan citizens' political representation in the Tibetan Parliament-in-Exile. The parliament's definition of the demos enhances regional and religious adherence as essentials for determining who the Tibetan people are. The article refers to problems regarding how...... this construct, which defines who is included into the demos, inevitably means that some are excluded as well....

  9. Beyond ITER: Neutral beams for DEMO

    CERN Document Server

    McAdams, R

    2013-01-01

    In the development of magnetically confined fusion as an economically sustainable power source, ITER is currently under construction. Beyond ITER is the DEMO programme in which the physics and engineering aspects of a future fusion power plant will be demonstrated. DEMO will produce net electrical power. The DEMO programme will be outlined and the role of neutral beams for heating and current drive will be described. In particular, the importance of the efficiency of neutral beam systems in terms of injected neutral beam power compared to wallplug power will be discussed. Options for improving this efficiency including advanced neutralisers and energy recovery are discussed.

  10. Impurity radiation in DEMO systems modelling

    Energy Technology Data Exchange (ETDEWEB)

    Lux, H., E-mail: Hanni.Lux@ccfe.ac.uk [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Kemp, R.; Ward, D.J. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Sertoli, M. [Max-Planck-Institut für Plasma Physik, D-85748 Garching (Germany)

    2015-12-15

    Highlights: • Solving the exhaust problem is crucial for DEMO. • Here, we discuss the new impurity radiation model in the systems code PROCESS. • Furthermore, we assess its effect on DEMO design. • More appropriate scalings will significantly enhance predictions for DEMO. • The controllability of highly radiative scenarios remains to be shown. - Abstract: For fusion reactors with ITER divertor technology, it will be imperative to significantly reduce the heat flux into the divertor e.g. by seeded impurity radiation. This has to be done without affecting the accessibility of a high performance scenario. To assess the implications of seeded plasma impurities on DEMO design, we have developed an impurity radiation model for radiation inside the separatrix. Evaluating the validity of our model, we find the assumption of a local ionisation equilibrium to be appropriate for our purposes and the assumption of flat impurity profiles – even though not satisfactory – to represent the best currently possible. Benchmarking our model against other codes highlights the need to use up to date atomic loss function data. From the impurity radiation perspective, the main uncertainties in current DEMO design stem from the lack of confinement and L-H-threshold scalings that can be robustly extrapolated to highly radiative DEMO scenarios as well as the lack of appropriate models for the power flow from the separatrix into the divertor that include radiation in the scrape off layer. Despite these uncertainties in the model we can exclude that significant fuel dilution through seeded impurities (with Z ≥ Z{sub Ar}) will be an issue for DEMO, but the controllability of highly radiative scenarios still needs to be coherently shown.

  11. Considerations on the DEMO pellet fuelling system

    Energy Technology Data Exchange (ETDEWEB)

    Lang, P.T., E-mail: peter.lang@ipp.mpg.de [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Day, Ch. [Karlsruhe Institute of Technology, 76021 Karlsruhe (Germany); Fable, E. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Igitkhanov, Y. [Karlsruhe Institute of Technology, 76021 Karlsruhe (Germany); Köchl, F. [Association EURATOM-Ö AW/ATI, Atominstitut, TU Wien, 1020 Vienna (Austria); Mooney, R. [Culham Centre for Fusion Energy, Culham Science Centre, Oxfordshire OX14 3DB (United Kingdom); Pegourie, B. [CEA, IRFM, 13108 Saint-Paul-lez-Durance (France); Ploeckl, B. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Wenninger, R. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); EFDA, Garching (Germany); Zohm, H. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany)

    2015-10-15

    Graphical abstract: - Highlights: • Considerations are made for a core particle fuelling system covering all DEMO requirements. • Particle deposition beyond the pedestal top is needed to achieve efficient fuelling. • Conventional pellet technology enabling launching from the torus inboard side can be used. • Efforts have been taken for integrating a suitable pellet guiding system into the EU DEMO model. • In addition, further techniques bearing potential for advanced fuelling performance are considered. - Abstract: The Demonstration Fusion Power Reactor DEMO is the step foreseen to bridge the gap between ITER and the first commercial fusion power plant. One key element in the European work plan for DEMO is the elaboration of a conceptual design for a suitable core particle fuelling system. First considerations for such a system are presented in this contribution. Following the well-considered ITER solution, most analysis performed in this study assumes conventional pellet technology will be used for the fuelling system. However, taking advantage of the less compressed time frame for the DEMO project, several other techniques thought to bear potential for advanced fuelling performance are considered as well. In a first, basic analysis all actuation parameters at hand and their implications on the fuelling performance were considered. Tentative transport modeling of a reference scenario strongly indicates only particles deposited inside the plasma pedestal allow for efficient fuelling. Shallow edge fuelling results in an unbearable burden on the fuel cycle. Sufficiently deep particle deposition seems technically achievable, provided pellets are launched from the torus inboard at sufficient speed. All components required for a DEMO pellet system capable for high speed inboard pellet launch are already available or can be developed in due time with reasonable efforts. Furthermore, steps to integrate this solution into the EU DEMO model are taken.

  12. Spin density wave (SDW) transition in Ru doped BaFeAs{sub 2} investigated by AC steady state calorimetry

    Energy Technology Data Exchange (ETDEWEB)

    Vinod, K., E-mail: vinod@igcar.gov.in; Sharma, Shilpam; Sundar, C. S.; Bharathi, A. [Low Temperature Studies Section, Condensed Matter Physics Division, Materials Science Group, Indira Gandhi Centre for Atomic Research (IGCAR), Kalpakkam-603102 (India)

    2015-06-24

    Heat capacity measurements were done on sub-micron sized BaFe{sub 2−x}Ru{sub x}As{sub 2} single crystals using thin film membrane based the AC steady state calorimetry technique. Noticeable thermal hysteresis is observed in the heat capacity of the BaFe{sub 2−x}Ru{sub x}As{sub 2} during cooling and warming cycles, indicating first order nature of the SDW transition.

  13. Initial DEMO tokamak design configuration studies

    Energy Technology Data Exchange (ETDEWEB)

    Bachmann, Christian, E-mail: christian.bachmann@efda.org [EFDA, Boltzmannstraße 2, 85748 Garching (Germany); Aiello, G. [CEA-Saclay, DEN, DM2S, SEMT, F-91191 Gif-Sur-Yvette (France); Albanese, R.; Ambrosino, R. [ENEA/CREATE, Universita di Napoli Federico II, Naples (Italy); Arbeiter, F. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Aubert, J. [CEA-Saclay, DEN, DM2S, SEMT, F-91191 Gif-Sur-Yvette (France); Boccaccini, L.; Carloni, D. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Federici, G. [EFDA, Boltzmannstraße 2, 85748 Garching (Germany); Fischer, U. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Kovari, M. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Li Puma, A. [CEA-Saclay, DEN, DM2S, SEMT, F-91191 Gif-Sur-Yvette (France); Loving, A. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Maione, I. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Mattei, M. [ENEA/CREATE, Universita di Napoli Federico II, Naples (Italy); Mazzone, G. [ENEA C.R. Frascati, via E. Fermi 45, 00044 Frascati, Roma (Italy); Meszaros, B. [EFDA, Boltzmannstraße 2, 85748 Garching (Germany); Palermo, I. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (CIEMAT), Madrid (Spain); Pereslavtsev, P. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Riccardo, V. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); and others

    2015-10-15

    Highlights: • A definition of main DEMO requirements. • A description of the DEMO tokamak design configuration. • A description of issues yet to be solved. - Abstract: To prepare the DEMO conceptual design phase a number of physics and engineering assessments were carried out in recent years in the frame of EFDA concluding in an initial design configuration of a DEMO tokamak. This paper gives an insight into the identified engineering requirements and constraints and describes their impact on the selection of the technologies and design principles of the main tokamak components. The EU DEMO program aims at making best use of the technologies developed for ITER (e.g., magnets, vessel, cryostat, and to some degree also the divertor). However, other systems in particular the breeding blanket require design solutions and advanced technologies that will only partially be tested in ITER. The main differences from ITER include the requirement to breed, to extract, to process and to recycle the tritium needed for plasma operation, the two orders of magnitude larger lifetime neutron fluence, the consequent radiation dose levels, which limit remote maintenance options, and the requirement to use low-activation steel for in-vessel components that also must operate at high temperature for efficient energy conversion.

  14. Diagnostic systems in DEMO: engineering design issues

    CERN Document Server

    Todd, T N

    2014-01-01

    The diagnostic systems of DEMO that are mounted on or near the torus, whether intended for the monitoring and control functions of the engineering aspects or the physics behaviour of the machine, will have to be designed to suit the hostile nuclear environment. This will be necessary not just for their survival and correct functioning but also to satisfy the pertinent regulatory bodies, especially where any of them relate to machine protection or the prevention or mitigation of accidents foreseen in the safety case. This paper aims to indicate the more important of the reactor design considerations that are likely to apply to diagnostics for DEMO, drawn from experience on JET, the provisions in hand for ITER and modelling results for the wall erosion and neutron damage effects in DEMO.

  15. Versatile Desktop Experiment Module (DEMo) on Heat Transfer

    Science.gov (United States)

    Minerick, Adrienne R.

    2010-01-01

    This paper outlines a new Desktop Experiment Module (DEMo) engineered for a chemical engineering junior-level Heat Transfer course. This new DEMo learning tool is versatile, fairly inexpensive, and portable such that it can be positioned on student desks throughout a classroom. The DEMo system can illustrate conduction of various materials,…

  16. Constructing a Tibetan Demos in Exile

    DEFF Research Database (Denmark)

    Brox, Trine

    2012-01-01

    homeland. Two specific instances of the construction of a transnational exile demos are investigated: citizenship and political representation. The Tibetan Government-in-Exile's formalized idea of citizenship builds upon ideals of equal and loyal members who form a single unit bounded by a common cause....... This also constitutes the foundation for Tibetan citizens' political representation in the Tibetan Parliament-in-Exile. The parliament's definition of the demos enhances regional and religious adherence as essentials for determining who the Tibetan people are. The article refers to problems regarding how...

  17. Efficiency of water coolant for DEMO divertor

    Energy Technology Data Exchange (ETDEWEB)

    Fetzer, Renate, E-mail: renate.fetzer@kit.edu; Igitkhanov, Yuri; Bazylev, Boris

    2015-10-15

    Up to now, water-cooled divertor concepts have been developed for limited incident fluxes without taking into account transient power loadings. In this paper we analyzed the efficiency of water as a coolant for the particular PFC tungsten monoblock shield with a cooling tube made from Cu alloy (Cu OFHC) as a laminate adjacent to W and a low activation martensitic steel (Eurofer) as inner tube contacting the coolant. Thermal analysis is carried out by using the code MEMOS, which simulates W armour damage under the repetitive ELM heat loads. We consider cooling conditions which allow one to keep relatively high material temperatures (in the range 300–600 °C) thus minimizing Eurofer embrittlement under neutron irradiation. Expected DEMO I and DEMO II heat loads including type I ELMs are found to cause melting of the W surface during unmitigated ELMs. By mitigation of the ELMs melting of W is avoided. DEMO I operation under these conditions is save for cooling at water pressure 15.5 MPa and temperature 325 °C, while for DEMO II with mitigated ELMs the critical heat flux is exceeded and safe operation is not provided.

  18. The potential role of Neutral Beam Injection in EU DEMO

    Science.gov (United States)

    Vincenzi, Pietro; Artaud, Jean-Francois; Bolzonella, Tommaso; Giruzzi, Gerardo

    2016-10-01

    EU DEMO studies for pulsed (DEMO1) and steady-state (DEMO2) concepts are currently in the pre-conceptual phase. Present DEMO1 design is based on ITER baseline H-mode scenario, while DEMO2 is based on advanced scenarios with moderate reversed q profile sustained by non-inductive currents. One of the possible flattop heating power systems currently considered is Neutral Beam Injection (NBI). In this work the role of NBI in DEMO1 and DEMO2 is investigated by means of integrated simulations of DEMO scenarios using METIS fast tokamak modelling tool. Limitations, requirements and benefits of the use of a NBI system are discussed. For DEMO1 pulsed concept, the role of NBI is mainly central plasma heating for scenario stability (high fusion power H-mode). As a by-product of the tangential injection, NBI is capable of current drive, which is favorable in order to extend the discharge duration. Regarding a steady-state DEMO2 concept, in addition to plasma heating, NBI becomes a direct actuator for the advanced scenario by driving a considerable part of the plasma current. This requires more than 100MW with off-axis injection. The effect of an increase of the injection energy on the driven current density profile is also presented for DEMO2.

  19. Contribution to DEMO reactor RH maintenance assessment

    Energy Technology Data Exchange (ETDEWEB)

    Bonnemason, Julie [CEA, LIST, Service de Robotique Interactive 18 route du Panorama, BP6, FONTENAY AUX ROSES, F-92265 (France)], E-mail: julie.bonnemason@cea.fr; Friconneau, Jean-Pierre [CEA, LIST, Service de Robotique Interactive 18 route du Panorama, BP6, FONTENAY AUX ROSES, F-92265 (France); Maisonnier, David [EFDA, Boltzmannstrasse 2, 85748 Garching (Germany); Perrot, Yann [CEA, LIST, Service de Robotique Interactive 18 route du Panorama, BP6, FONTENAY AUX ROSES, F-92265 (France)

    2009-06-15

    The scope of this paper is a preliminary assessment of the maintenance scheme in support of the European study for the next generation of fusion reactor: DEMO. Despite other fusion machine requiring remote handling maintenance operations, DEMO is supposed to work under steady state operational conditions. Therefore, requirement on the maintenance scheme is stronger. To target a good availability of the machine along machine operation plan, it is necessary to draw an adequate maintenance scheme. Indeed, due to the high fluxes generated by the plasma in the vacuum vessel, the first wall lifetime is limited, so the frequent replacement is necessary. On current fusion experimental machine, as first wall load conditions are less severe, DEMO condition implies high level of requirement on maintenance time. During DEMO lifetime, several full first wall replacements are expected. To provide access to the vacuum vessel machine for first wall removal, preparatory work is required to set the machine to adequate maintenance conditions and to open the machine properly, the same situation at the end of the maintenance period. Shutdown duration for first wall replacement should be as short as possible to reach the availability target of the machine. From this statement, the maintenance duration should not exceed 20% of the total lifetime of the reactor operation. First wall segmentation (i.e. total number of component to replace) has a high impact onto the replacement time. Considering the number of feasible designs for the first wall segmentation, we concentrate remote handling concept assessments one type of segmentation, the one minimizing the numbers of modules to replace . Assumption on Divertor segmentation for these DEMO studies have similarities with Divertor ITER design; therefore ITER design output is relevant . We assume divertor removal performed in shadow time, while removing the other first wall modules.

  20. ac hopping magnetotransport across the spin-flop transition in lightly doped La2CuO4

    Science.gov (United States)

    Sushkov, Oleg P.; Kotov, Valeri N.

    2008-02-01

    The weak ferromagnetism present in insulating La2CuO4 at low doping leads to a spin flop transition, and to transverse (interplane) hopping of holes in a strong external magnetic field. This results in a dimensional crossover 2D→3D for the in-plane transport, which in turn leads to an increase of the hole’s localization length and increased conduction. We demonstrate theoretically that as a consequence of this mechanism, a frequency-dependent jump of the in-plane ac hopping conductivity occurs at the spin flop transition. We predict the value and the frequency dependence of the jump. Experimental studies of this effect would provide important confirmation of the emerging understanding of lightly doped insulating La2-xSrxCuO4 .

  1. Tritium extraction technologies and DEMO requirements

    Energy Technology Data Exchange (ETDEWEB)

    Demange, D., E-mail: david.demange@kit.edu [Karlsruhe Institute of Technology, Institute for Technical Physics, Tritium Laboratory Karlsruhe, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Antunes, R.; Borisevich, O.; Frances, L. [Karlsruhe Institute of Technology, Institute for Technical Physics, Tritium Laboratory Karlsruhe, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Rapisarda, D. [Laboratorio Nacional de Fusión, EURATOM-CIEMAT, 28040 Madrid (Spain); Santucci, A. [ENEA for EUROfusion, Via E. Fermi 45, 00044 Frascati, Roma (Italy); Utili, M. [ENEA CR Brasimone, 40032 Camugnano, BO (Italy)

    2016-11-01

    Highlights: • We detail the R&D plan for tritium technology of the European DEMO breeding blanket. • We study advanced and efficient extraction techniques to improve tritium management. • We consider inorganic membranes and catalytic membrane reactor for solid blankets. • We consider permeator against vacuum and vacuum sieve tray for liquid blankets. - Abstract: The conceptual design of the tritium extraction system (TES) for the European DEMO reactor is worked out in parallel for four different breeding blankets (BB) retained by EUROfusion. The TES design has to be tackled in an integrated manner optimizing the synergy with the directly interfacing inner fuel cycle, while minimizing the tritium permeation into the coolant. Considering DEMO requirements, it is most likely that only advanced technologies will be suitable for the tritium extraction systems of the BB. This paper overviews the European work programme for R&D on tritium technology for the DEMO BB, summaries the general first outcomes, and details the specific and comprehensive R&D program to study experimentally immature but promising technologies such as vacuum sieve tray or permeator against vacuum for tritium extraction from PbLi, and advanced inorganic membranes and catalytic membrane reactor for tritium extraction from He. These techniques are simple, fully continuous, likely compact with contained energy consumption. Several European Laboratories are joining their efforts to deploy several new experimental setups to accommodate the tests campaigns that will cover small scale experiments with tritium and inactive medium scale tests so as to improve the technology readiness level of these advanced processes.

  2. Modelling of pulsed and steady-state DEMO scenarios

    Science.gov (United States)

    Giruzzi, G.; Artaud, J. F.; Baruzzo, M.; Bolzonella, T.; Fable, E.; Garzotti, L.; Ivanova-Stanik, I.; Kemp, R.; King, D. B.; Schneider, M.; Stankiewicz, R.; Stępniewski, W.; Vincenzi, P.; Ward, D.; Zagórski, R.

    2015-07-01

    Scenario modelling for the demonstration fusion reactor (DEMO) has been carried out using a variety of simulation codes. Two DEMO concepts have been analysed: a pulsed tokamak, characterized by rather conventional physics and technology assumptions (DEMO1) and a steady-state tokamak, with moderately advanced physics and technology assumptions (DEMO2). Sensitivity to impurity concentrations, radiation, and heat transport models has been investigated. For DEMO2, the impact of current driven non-inductively by neutral beams has been studied by full Monte Carlo simulations of the fast ion distribution. The results obtained are a part of a more extensive research and development (R&D) effort carried out in the EU in order to develop a viable option for a DEMO reactor, to be adopted after ITER for fusion energy research.

  3. Diagnostics for machine protection of DEMO

    Science.gov (United States)

    Felton, R.

    2014-08-01

    DEMO aims to (i) integrate, demonstrate and validate all relevant technology necessary to convert fusion energy to electrical energy and (ii) that the machine and its operations are economically and environmentally acceptable. To maintain the efficiency and availability of the machine, there are several physics and combined physics/technology issues as well as the engineering issues. Machine Protection (also known as Protection of Investment) addresses both the risks to plant (to avoid costly repair or replacement) and the risks to normal operating time (to avoid loss of productivity and the return on investment). The plasma-related Machine Protection issues involve measurement and control of plasma stability, plasma purity, and plasma-wall interactions. Machine Protection aims to avoid hitting catastrophic limits by using early warning alarm systems, and controlled termination or avoidance, involving coordinated actions of the magnets, gas and auxiliary heating or current-drive systems. This article outlines the key processes, some of which are used in present-day tokamaks and some of which are new specifically for DEMO (e.g. First wall and divertor power handling) and reveals the need to research and develop new science and technology for Machine Protections in DEMO's high radiation and thermal fields. This work was funded by the RCUK Energy Programme under grant EP/I501045 and the European Communities under the contract of Association between EURATOM and CCFE and conducted partly under EFDA PPPT (WP13-DAS04). The views and opinions expressed herein do not necessarily reflect those of the European Commission.

  4. Diagnostics for plasma control on DEMO: challenges of implementation

    NARCIS (Netherlands)

    Donne, A. J. H.; Costley, A. E.; Morris, A. W.

    2012-01-01

    As a test fusion power plant, DEMO will have to demonstrate reliability and very long pulse/steady-state operation, which calls for unprecedented robustness and reliability of all diagnostic systems (also requiring adequate redundancy). But DEMO will have higher levels of neutron and gamma fluxes, a

  5. Diagnostics for plasma control on DEMO: challenges of implementation

    NARCIS (Netherlands)

    Donne, A. J. H.; Costley, A. E.; Morris, A. W.

    2012-01-01

    As a test fusion power plant, DEMO will have to demonstrate reliability and very long pulse/steady-state operation, which calls for unprecedented robustness and reliability of all diagnostic systems (also requiring adequate redundancy). But DEMO will have higher levels of neutron and gamma fluxes,

  6. Demo: Personal Competence Manager (Sofia, 04-09-2007)

    NARCIS (Netherlands)

    Lemmers, Ruud

    2007-01-01

    The presentation is a brief introduction explaining the relation of the PCM to the TENCompetence objectives and explanation of basic TENCompetence ideas, as info before starting a PCM demo. The PCM demo showed functionality and also gave teachers guidance and tips on how they can use it in their

  7. Photon trapping effects in DEMO divertor plasma

    Energy Technology Data Exchange (ETDEWEB)

    Hoshino, K.; Tokunaga, S.; Asakura, N. [Japan Atomic Energy Agency, Rokkasho, Aomori (Japan); Sawada, K.; Idei, R. [Faculty of Engineering, Shinshu Univ., Nagano (Japan); Shimizu, K. [Japan Atomic Energy Agency, Naka, Ibaraki (Japan); Ohno, N. [Graduate School of Engineering, Nagoya Univ, Aichi (Japan)

    2016-08-15

    In the DEMO divertor, the neutral density becomes high to produce the full detachment and therefore the photon trapping can become important. In this paper, effects of the photon trapping on the DEMO divertor plasma has been studied. The pre-evaluation of the photon trapping effects on the fixed background plasma profile was carried out by using an iterative self-consistent collisional radiative model. The recombining plasma near the inner target and the private region changed to the ionizing plasma by the photon-excitation. Based on the preevaluation result, the database of the effective ionization rate coefficient including the photon transport inside a 2 mm sphere. Advantage of the 2 mm sphere approximation is that the extra calculation cost is not necessary. Iterative calculation of the SONIC including the photon trapping effects was carried out. While the electron density increased and the neutral density decreased in the wide region, the electron density decreases close to the inner strike point. This may be due to decrease in the ionization rate by decrease in the neutral density. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  8. Superconducting transition in ruthenocuprate RuSr2GdCu2O8 viewed from the studies of the imaginary part of ac susceptibility

    Science.gov (United States)

    Zivkovic, I.; Drobac, D.; Ariosa, D.; Berger, H.; Pavuna, D.; Prester, M.

    2002-12-01

    We have measured two structurally similar superconducting systems, RuSr2GdCu2O8 and GdBa2Cu3O7 by means of high-resolution ac susceptibility. The real and the imaginary part of ac susceptibility of both bulk-ceramic and powdered samples have been studied down to the very small magnetic-field levels. We show that there are significant differences in the evolution of superconductivity in the two studied superconducting systems. In particular, we show that the superconducting transition in the grains in RuSr2GdCu2O8 system is masked with intrinsic magnetism of complex origin.

  9. Neutronics requirements for a DEMO fusion power plant

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, U., E-mail: ulrich.fischer@kit.edu [Karlsruhe Institute of Technology (KIT), Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Bachmann, C. [EUROfusion Consortium , Boltzmannstraße 2, 85748 Garching (Germany); Palermo, I. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (CIEMAT), Madrid (Spain); Pereslavtsev, P. [Karlsruhe Institute of Technology (KIT), Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Villari, R. [ENEA UT-FUS C.R. Frascati, Via E. Fermi 45, 00044 Frascati (Italy)

    2015-10-15

    Highlights: • Discussion and specification of neutronic requirements for a DEMO power plant. • TBR uncertainties are reviewed/discussed and design margins are elaborated. • Limits are given for radiation loads to super-conducting magnets and steel structural components. • Available DEMO results are compared to recommended limits and TBR design target. - Abstract: This paper addresses the neutronic requirements a DEMO fusion power plant needs to fulfil for a reliable and safe operation. The major requirement is to ensure Tritium self-sufficiency taking into account the various uncertainties and plant-internal losses that occur during DEMO operation. A further major requirement is to ensure sufficient protection of the superconducting magnets against the radiation penetrating in-vessel components and vessel. Reliable criteria for the radiation loads need to be defined and verified to ensure the reliable operation of the magnets over the lifetime of DEMO. Other issues include radiation induced effects on structural materials such as the accumulated displacement damage, the generation of gases such as helium which may deteriorate the material performance. The paper discusses these issues and their impact on design options for DEMO taking into account results obtained in the frame of European Power Plant Physics and Technology (PPPT) 2013 programme activities with DEMO models employing the helium cooled pebble bed (HCPB), the helium cooled lithium lead (HCLL), and the water-cooled (WCLL) blanket concepts.

  10. Immune modelling and programming of a mobile robot demo

    Institute of Scientific and Technical Information of China (English)

    GONG Tao; CAI Zi-xing; HE Han-gen

    2006-01-01

    An artificial immune system was modelled with self/non-self selection to overcome abnormity in a mobile robot demo. The immune modelling includes the innate immune modelling and the adaptive immune modelling. The self/non-self selection includes detection and recognition, and the self/non-self detection is based on the normal model of the demo. After the detection, the non-self recognition is based on learning unknown non-self for the adaptive immunization. The learning was designed on the neural network or on the learning mechanism from examples. The last step is elimination of all the non-self and failover of the demo. The immunization of the mobile robot demo is programmed with Java to test effectiveness of the approach. Some worms infected the mobile robot demo, and caused the abnormity. The results of the immunization simulations show that the immune program can detect 100% worms,recognize all known Worms and most unknown worms, and eliminate the worms. Moreover, the damaged files of the mobile robot demo can all be repaired through the normal model and immunization. Therefore, the immune modelling of the mobile robot demo is effective and programmable in some anti-worms and abnormity detection applications.

  11. Overview of EU DEMO design and R and D activities

    Energy Technology Data Exchange (ETDEWEB)

    Federici, G., E-mail: gianfranco.federici@efda.org [EFDA PPPT, Boltzmannstr. 2, Garching 85748 (Germany); Kemp, R.; Ward, D. [CCFE Culham, EURATOM Association, Oxfordshire OX14 3DB (United Kingdom); Bachmann, C.; Franke, T.; Gonzalez, S.; Lowry, C.; Gadomska, M.; Harman, J.; Meszaros, B.; Morlock, C.; Romanelli, F.; Wenninger, R. [EFDA PPPT, Boltzmannstr. 2, Garching 85748 (Germany)

    2014-10-15

    Highlights: • An important objective of the new EU fusion roadmap is to lay the foundation of a DEMO Fusion Power Reactor to follow ITER. • DEMO should be capable of generating several 100 MW of net electricity and operating with a closed fuel-cycle by 2050. • The paper outlines the DEMO design and R and D approach recently being undertaken in Europe. • The paper presents some preliminary design options that are under evaluation as well as the most urgent R and D work needed. • The R and D on materials for a near-term DEMO is discussed in detail elsewhere. - Abstract: One important objective of the EU fusion roadmap Horizon 2020 is to lay the foundation of a Demonstration Fusion Power Reactor (DEMO) to follow ITER, with the capability of generating several 100 MW of net electricity to the grid and operating with a closed fuel-cycle by 2050. This is currently viewed by many of the nations engaged in the construction of ITER as the remaining crucial step towards the exploitation of fusion power. This paper outlines the DEMO design and R and D approach that is being adopted in Europe and presents some of the preliminary design options that are under evaluation as well as the most urgent R and D work that is expected to be launched in the near-future. The R and D on materials for a near-term DEMO is discussed in detail elsewhere.

  12. Comparative evaluation of remote maintenance schemes for fusion DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Utoh, Hiroyasu, E-mail: uto.hiroyasu@jaea.go.jp; Tobita, Kenji; Someya, Youji; Asakura, Nobuyuki; Sakamoto, Yoshiteru; Hoshino, Kazuo; Nakamura, Makoto

    2015-10-15

    Highlights: • Various remote maintenance schemes for DEMO were comparatively assessed based on requirements for DEMO remote maintenance. • The banana shape segment transport using all vertical maintenance ports would be more probable DEMO reactor maintenance scheme. • The key engineering issues are in-vessel transferring mechanism of segment, pipe connection and conducting shell design for plasma vertical stability. - Abstract: Maintenance schemes are one of the critical issues in DEMO design, significantly affecting the configuration of in-vessel components, the size of toroidal field (TF) coil, the arrangement of poloidal field (PF) coils, reactor building, hot cell and so forth. Therefore, the maintenance schemes should satisfy many design requirements and criteria to assure reliable and safe plant operation and to attain reasonable plant availability. The plant availability depends on reliability of remote maintenance scheme, inspection of pipe connection and plasma operation. In this paper, various remote maintenance schemes for DEMO were comparatively assessed based on requirements for DEMO remote maintenance. From the view points of the reliability of inspection on hot cell, TF coil size, stored energy of PF coil and portability of segment, the banana shape segment transport using all vertical maintenance ports would be more probable DEMO reactor maintenance scheme, and it has key engineering issues such as in-vessel transferring mechanism of segment, pipe connection and conducting shell design for plasma vertical stability.

  13. DEMO Hot Cell and Ex-Vessel Remote Handling

    CERN Document Server

    Thomas, Justin; Bachmann, Christian; Harman, Jon

    2013-01-01

    In Europe the work on the specification and design of a Demonstration Power Plant (DEMO) is being carried out by EFDA in the Power Plant Physics and Technology (PPP&T) programme. DEMO will take fusion from experimental research into showing the potential for commercial power generation. This paper describes the first steps being taken towards the design of the DEMO Hot Cell. It will show a comparison of the current DEMO in-vessel maintenance concepts from a Hot Cell perspective, describe a proposed ex-vessel transport system, and summarize the facilities that have been identified as required within the Hot Cell, examine current RH technology and discuss the identified critical development issues.

  14. Advances in the physics basis for the European DEMO design

    Science.gov (United States)

    Wenninger, R.; Arbeiter, F.; Aubert, J.; Aho-Mantila, L.; Albanese, R.; Ambrosino, R.; Angioni, C.; Artaud, J.-F.; Bernert, M.; Fable, E.; Fasoli, A.; Federici, G.; Garcia, J.; Giruzzi, G.; Jenko, F.; Maget, P.; Mattei, M.; Maviglia, F.; Poli, E.; Ramogida, G.; Reux, C.; Schneider, M.; Sieglin, B.; Villone, F.; Wischmeier, M.; Zohm, H.

    2015-06-01

    In the European fusion roadmap, ITER is followed by a demonstration fusion power reactor (DEMO), for which a conceptual design is under development. This paper reports the first results of a coherent effort to develop the relevant physics knowledge for that (DEMO Physics Basis), carried out by European experts. The program currently includes investigations in the areas of scenario modeling, transport, MHD, heating & current drive, fast particles, plasma wall interaction and disruptions.

  15. Limitations of transient power loads on DEMO and analysis of mitigation techniques

    Energy Technology Data Exchange (ETDEWEB)

    Maviglia, F., E-mail: francesco.maviglia@euro-fusion.org [EUROfusion Consortium, PPPT Department, Boltzmannstr. 2, Garching (Germany); Consorzio CREATE, University Napoli Federico II – DIETI, 80125 Napoli (Italy); Federici, G. [EUROfusion Consortium, PPPT Department, Boltzmannstr. 2, Garching (Germany); Strohmayer, G. [Max-Planck-Institut fur Plasmaphysik, Boltzmannstr. 2, Garching (Germany); Wenninger, R. [EUROfusion Consortium, PPPT Department, Boltzmannstr. 2, Garching (Germany); Max-Planck-Institut fur Plasmaphysik, Boltzmannstr. 2, Garching (Germany); Bachmann, C. [EUROfusion Consortium, PPPT Department, Boltzmannstr. 2, Garching (Germany); Albanese, R. [Consorzio CREATE, University Napoli Federico II – DIETI, 80125 Napoli (Italy); Ambrosino, R. [Consorzio CREATE University Napoli Parthenope, Naples (Italy); Li, M. [Max-Planck-Institut fur Plasmaphysik, Boltzmannstr. 2, Garching (Germany); Loschiavo, V.P. [Consorzio CREATE, University Napoli Federico II – DIETI, 80125 Napoli (Italy); You, J.H. [Max-Planck-Institut fur Plasmaphysik, Boltzmannstr. 2, Garching (Germany); Zani, L. [CEA, IRFM, F-13108 St Paul-Lez-Durance (France)

    2016-11-01

    Highlights: • A parametric thermo-hydraulic analysis of the candidate DEMO divertor is presented. • The operational space assessment is presented under static and transient heat loads. • Strike points sweeping is analyzed as a divertor power exhaust mitigation technique. • Results are presented on sweeping installed power required, AC losses and thermal fatigue. - Abstract: The present European standard DEMO divertor target technology is based on a water-cooled tungsten mono-block with a copper alloy heat sink. This paper presents the assessment of the operational space of this technology under static and transient heat loads. A transient thermo-hydraulic analysis was performed using the code RACLETTE, which allowed a broad parametric scan of the target geometry and coolant conditions. The limiting factors considered were the coolant critical heat flux (CHF), and the temperature limits of the materials. The second part of the work is devoted to the study of the plasma strike point sweeping as a mitigation technique for the divertor power exhaust. The RACLETTE code was used to evaluate the impact of a large range of sweeping frequencies and amplitudes. A reduced subset of cases, which complied with the constraints, was benchmarked with a 3D FEM model. A reduction of the heat flux to the coolant, up to a factor ∼4, and lower material temperatures were found for an incident heat flux in the range (15–30) MW/m{sup 2}. Finally, preliminary assessments were performed on the installed power required for the sweeping, the AC losses in the superconductors and thermal fatigue analysis. No evident show stoppers were found.

  16. Numerical analysis of divertor plasma for demo-CREST

    Energy Technology Data Exchange (ETDEWEB)

    Ishida, M.; Maeki, K.; Hatayama, A. [Graduate School of Fundamental Science and Technology, Keio University, Yokohama (Japan); Hiwatari, R. [Central Research Institute of Electric Power Industry (CRIEPI), Tokyo (Japan); Bonnin, X. [LIMHP-CNRS, Universite Paris 13, Villetaneuse (France); Zhu, S. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Schneider, R. [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Greifswald (Germany); Coster, D. [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Garching (Germany)

    2010-05-15

    The numerical analysis of the demonstration fusion reactor Demo-CREST has been carried out; this analysis focuses on impurity seeding. Several design activities for DEMO have been carried out; however, its detailed divertor plasma analysis remains to be carried out. Therefore, in this study, we discuss the possibility of neon puffing in demo-CREST to decrease the power load to the divertor plate by using the B2-EIRENE code. It has been shown that the radiation power loss by neon increases with upstream plasma density and that the peak power load to the divertor plate comes close to the allowable level by using the preliminary divertor configuration (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  17. A preliminary systems assessment of the Starlite Demo candidates

    Energy Technology Data Exchange (ETDEWEB)

    Bathke, C.G.

    1995-12-01

    The Starlite project has evaluated the following five tokamaks as candidates for the US Demo Power Plant: (1) steady state, first stability regime; (2) pulsed, first stability regime; (3) steady state, second stability regime; (4) steady state, reversed shear; and (5) steady state, low aspect ratio. Systems analysis of these candidates has played an important role in the selection of a reversed-shear tokamak for further conceptual design as a US Demo Power Plant. The cost-based systems analysis that led to the selection of a reversed-shear tokamak is described herein.

  18. A preliminary systems assessment of the Starlite Demo candidates

    Energy Technology Data Exchange (ETDEWEB)

    Bathke, C.G. [Los Alamos National Lab., NM (United States)

    1995-12-31

    The Starlite project has evaluated the following five tokamaks as candidates for the US Demo Power Plant: (1) steady state, first stability regime; (2) pulsed, first stability regime; (3) steady state, second stability regime; (4) steady state, reversed shear; and (5) steady state, low aspect ratio. Systems analysis of these candidates has played an important role in the selection of a reversed-shear tokamak for further conceptual design as a US Demo Power Plant. The cost-based systems analysis that led to the selection of a reversed-shear tokamak is described.

  19. A preliminary systems assessment of the Starlite Demo candidates

    Energy Technology Data Exchange (ETDEWEB)

    Bathke, C.G.

    1995-12-01

    The Starlite project has evaluated the following five tokamaks as candidates for the US Demo Power Plant: (1) steady state, first stability regime; (2) pulsed, first stability regime; (3) steady state, second stability regime; (4) steady state, reversed shear; and (5) steady state, low aspect ratio. Systems analysis of these candidates has played an important role in the selection of a reversed-shear tokamak for further conceptual design as a US Demo Power Plant. The cost-based systems analysis that led to the selection of a reversed-shear tokamak is described herein.

  20. Global shutdown dose rate maps for a DEMO conceptual design

    Energy Technology Data Exchange (ETDEWEB)

    Leichtle, D., E-mail: dieter.leichtle@f4e.europa.eu [Karlsruhe Institute of Technology KIT, Institute for Neutron Physics and Reactor Technology, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Pereslavtsev, P. [Karlsruhe Institute of Technology KIT, Institute for Neutron Physics and Reactor Technology, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Sanz, J.; Catalan, J.P.; Juarez, R. [Universidad Nacional de Educación a Distancia(UNED), E.T.S. Ingenieros Industriales, C/ Juan del Rosal 12, 28040 Madrid (Spain)

    2015-10-15

    Highlights: • Application of R2S-method on high-resolution full torus sector mesh for DEMO. • Absorbed dose rates after shutdown for a variely of RH equipment at typical locations. • Idenification of radiation levels at several port based locations. - Abstract: For the calculations of highly reliable shutdown dose rate (SDR) maps in fusion devices like a DEMO plant, the Rigorous-2-step (R2S) method is nowadays routinely applied using high-resolution decay gamma sources from initial high-resolution neutron flux meshes activating all materials in the system. This approach has been utilized in the present paper with the objective to provide SDR results relevant for RH systems of a conceptual DEMO design developed in the EU. The primary objective was to assess specific locations of interest for RH equipment inside the vessel and along the extension of maintenance ports. To this end, a provisional DEMO MCNP model has been used, featuring HCLL-type blankets, tungsten/copper divertor, manifolds, vacuum vessel with ports and toroidal field coils. The operational scenario assumed 2.1 GW fusion power and a life-time of 20 years with plant availability of 30%, where removable parts will be extracted after 5.2 years. Results of absorbed dose rate distributions for several relevant materials are presented and discussed in terms of the different contributions from the various activated components.

  1. Configuration management of the EU DEMO conceptual design data

    Energy Technology Data Exchange (ETDEWEB)

    Meszaros, Botond; Shannon, Mark [EUROfusion Consortium, PPPT Department, Garching, Boltzmannstr. 2 (Germany); Marzullo, Domenico [CREATE, University of Naples Federico II, P.le Tecchio 80, 80125 Napoli (Italy); Woodley, Colin; Rowe, Steve [CCFE, Culham Science Centre, Oxfordshire OX14 3DB, Abingdon (United Kingdom); Di Gironimo, Giuseppe [CREATE, University of Naples Federico II, P.le Tecchio 80, 80125 Napoli (Italy)

    2016-11-01

    Highlights: • Description of the selection of the DEMO Product Data Management tool. • Introduction of the DEMO configuration management philosophy for the CAD design data. • Description of the enabling tools and systems of the configuration management. - Abstract: The EUROfusion Consortium is setting up – as part of the EU Fusion Roadmap – the framework for the implementation of the (pre)conceptual design phase of the DEMO reactor. Configuration management needs have been identified as one of the key elements of this framework and is the topic of this paper, in particular the configuration of the CAD design data. The desire is to keep the definition and layout of the corresponding systems “light weight” and relatively easy to manage, whilst simultaneously providing a level of detail in the definition of the design configuration that is fit for the purpose of a conceptual design. This paper aims to describe the steps followed during the definition of the configuration management system of the DEMO design data in terms of (i) the identification of the appropriate product data management system, (ii) the description of the philosophy of the configuration management of the design data, and (iii) the introduction of the most important enabling processes.

  2. Demo: Using RapidMiner for Text Mining

    OpenAIRE

    2013-01-01

    In this demo the basic text mining technologies by using RapidMining have been reviewed. RapidMining basic characteristics and operators of text mining have been described. Text mining example by using Navie Bayes algorithm and process modeling have been revealed.

  3. Scoping studies for NBI launch geometries on DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Jenkins, I., E-mail: ian.jenkins@ukaea.uk; Challis, C.D.; Keeling, D.L.; Surrey, E.

    2016-05-15

    Highlights: • NBCD scans are done for beam energies of 1.5 MeV and 1.0 MeV in two DEMO scenarios. • NBCD scan profiles are fed into genetic algorithm to fit a target current profile. • The result gives location and power of sources to give best fit to target profile. • This method can help provide requirements for DEMO beamline geometry. - Abstract: Engineering and technical constraints on Neutral Beam Injection (NBI) in DEMO may determine the available beam energy and may also strongly impact the Neutral Beam Current Drive (NBCD) efficiency by restricting available beam tangential radii. These latter are determined by factors such as the inter-TF coil spacing, as well as the degree of required shielding. In order to illustrate how these factors may affect the contribution of NBCD on DEMO operating scenarios, scans of NBI tangency radii and elevation on two possible DEMO scenarios have been performed with two beam energies, 1.5 MeV and 1.0 MeV, in order to determine the most favourable options for NBCD efficiency. In addition, a method using a genetic algorithm has been used to seek optimised solutions of NBI source locations and powers to attempt to synthesize a target total plasma driven-current profile. It is found that certain beam trajectories may be proscribed by limitations on shinethrough onto the vessel wall. This may affect the ability of NBCD to extend the duration of a pulse in a scenario where it must complement the induced plasma current. Operating at the lower beam energy reduces the restrictions due to shinethrough and is attractive for technical reasons as it will required less development, but in the scenarios examined here this results in a spatial broadening of the NBCD profile, which may make it more challenging to achieve desired total driven-current profiles.

  4. DEMO hot cell and ex-vessel remote handling

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Justin, E-mail: justin.thomas@ccfe.ac.uk [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Loving, Antony [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Bachmann, Christian; Harman, Jon [EFDA, PPP and T, Boltzmannstraße 2, 85748 Garching (Germany)

    2013-10-15

    Highlights: ► Overview of current DEMO maintenance concepts. ► Comparison of current dextrous remote handling technologies and their rebalance to DEMO. ► Presentation of some ideas to improve the productivity and reliability of the DEMO ex-vessel transport system. ► A description of the size and type facilities that might be required in the DEMO hot cell. ► Identification of some areas that need to be developed further to meet the requirements of DEMO. -- Abstract: In Europe the work on the specification and design of a demonstration power plant (DEMO) is being carried out by EFDA in the power plant physics and technology (PPP and T) programme. DEMO will take fusion from experimental research into showing the potential for commercial power generation. During the fusion reaction, components in the tokamak become highly activated. The estimated dose rate levels after shutdown (zero decay time) due to 60 dpa accumulation in steel (blanket) and 30 dpa (divertor) are 13.1–17.4 kGy/h (blanket); 8.8–11.6 kGy/h (divertor) [1], much higher than those to be encountered at ITER. Upon removal from the tokamak, components would be transported to the hot cell facility with attention to minimizing the spread of activated dust and tritium contamination. It is proposed to use a sealed cask of ∼20 tonnes, running on air castors with 50% lifting capability redundancy. Due to the number and complexity of the routes taken by this transporter it would have to be an un-tethered semi-autonomous system. This poses some technical challenges, including providing sufficient battery capacity, reliable guidance and a fail safe un-tethered control system. The mass of the components being moved is assumed here to range from a few tonnes to in excess of one hundred tonnes. Before the removed in-vessel components can be processed in the hot cell, they would require a period of cooling, approximately 2.5 years, to allow dose rate and decay heating to reduce. This reduces the decay

  5. Metal-insulator transition in AC{sub 60}:RbC{sub 60} and KC{sub 60}

    Energy Technology Data Exchange (ETDEWEB)

    Khazeni, K.; Crespi, V.H.; Hone, J.; Zettl, A.; Cohen, M.L. [Department of Physics, University of California at Berkeley, Berkeley, California 94720 (United States)]|[Materials Sciences Division, Lawrence Berkeley Laboratory, Berkeley, California 94720 (United States)

    1997-09-01

    At zero pressure polymerized RbC{sub 60} is an insulator, whereas polymerized KC{sub 60} is a metal with a slight low-temperature resistive upturn. We report measurements of the resistivity of RbC{sub 60} under pressure, finding a hysteretic resistive transition in RbC{sub 60} near 200 K at 5 kbar, at which point the material transforms from insulator to metal. Correcting the resistivity to constant volume, both materials are metallic below the transition with a common low-temperature resistive upturn which is suppressed under compression. {copyright} {ital 1997} {ital The American Physical Society}

  6. Reel success creating demo reels and animation portfolios

    CERN Document Server

    Cabrera, Cheryl

    2013-01-01

    Are you an animator looking to get your foot in the door to the top studios?It's tough if you don't have a demo reel and portfolio that reflects your unique style and incredible talents.  The reception of that reel will make or break you; so it's no wonder that creating a demo reel can be such a daunting task.  Reel Success by Cheryl Cabrera can help.  This book guides you into putting the right content into your portfolio, how to cater to the right audience, and how to harness the power of social media and network effectively.  Accompanied by case studies of actual students

  7. Compact DEMO, SlimCS: design progress and issues

    Science.gov (United States)

    Tobita, K.; Nishio, S.; Enoeda, M.; Kawashima, H.; Kurita, G.; Tanigawa, H.; Nakamura, H.; Honda, M.; Saito, A.; Sato, S.; Hayashi, T.; Asakura, N.; Sakurai, S.; Nishitani, T.; Ozeki, T.; Ando, M.; Ezato, K.; Hamamatsu, K.; Hirose, T.; Hoshino, T.; Ide, S.; Inoue, T.; Isono, T.; Liu, C.; Kakudate, S.; Kawamura, Y.; Mori, S.; Nakamichi, M.; Nishi, H.; Nozawa, T.; Ochiai, K.; Ogiwara, H.; Oyama, N.; Sakamoto, K.; Sakamoto, Y.; Seki, Y.; Shibama, Y.; Shimizu, K.; Suzuki, S.; Takahashi, K.; Tanigawa, H.; Tsuru, D.; Yamanishi, T.; Yoshida, T.

    2009-07-01

    The design progress in a compact low aspect ratio (low A) DEMO reactor, 'SlimCS', and its design issues are reported. The design study focused mainly on the torus configuration including the blanket, divertor, materials and maintenance scheme. For continuity with the Japanese ITER-TBM, the blanket is based on a water-cooled solid breeder blanket. For vertical stability of the elongated plasma and high beta access, the blanket is segmented into replaceable and permanent blankets and a sector-wide conducting shell is arranged inbetween these blankets. A numerical calculation indicates that fuel self-sufficiency can be satisfied when the blanket interior is ideally fabricated. An allowable heat load to the divertor plate should be 8 MW m-2 or lower, which can be a critical constraint for determining a handling power of DEMO.

  8. Design activities on helical DEMO reactor FFHR-d1

    Energy Technology Data Exchange (ETDEWEB)

    Sagara, A., E-mail: sagara.akio@LHD.nifs.ac.jp [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Goto, T.; Miyazawa, J.; Yanagi, N.; Tanaka, T.; Tamura, H.; Sakamoto, R.; Tanaka, M.; Tsumori, K. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Mitarai, O. [Tokai University, 9-1-1 Toroku, Kumamoto 862-8652 (Japan); Imagawa, S.; Muroga, T. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan)

    2012-08-15

    Highlights: Black-Right-Pointing-Pointer Conceptual design studies of the helical DEMO reactor FFHR-d1 have been conducted. Black-Right-Pointing-Pointer Design window analyses with core plasma and engineering designs have been carried out. Black-Right-Pointing-Pointer R and Ds on blanket, magnet, tritium control, fuelling and heating systems are discussed. - Abstract: Based on high-density and high-temperature plasma experiments in the large helical device (LHD), conceptual design studies of the LHD-type helical DEMO reactor FFHR-d1 have been conducted by integrating wide-ranged R and D activities on core plasmas and reactor technologies through cooperative researches under the fusion engineering research project, which has been launched newly in NIFS. Current activities for the FFHR-d1 in this project are presented on design window analyses with designs on core plasma, neutronics for liquid blankets, continuous helical magnets, pellet fueling, tritium systems and plasma heating devices.

  9. Conceptual design study of the K-DEMO magnet system

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Keeman, E-mail: kkeeman@nfri.re.kr [National Fusion Research Institute, 169-148 Gwahak-ro, Daejeon 305-806 (Korea, Republic of); Oh, Sangjun; Park, Jong Sung; Lee, Chulhee; Im, Kihak; Kim, Hyung Chan; Lee, Gyung-Su [National Fusion Research Institute, 169-148 Gwahak-ro, Daejeon 305-806 (Korea, Republic of); Neilson, George; Brown, Thomas; Kessel, Charles; Titus, Peter; Zhai, Yuhu [Princeton Plasma Physics Laboratory, Princeton, NJ 08543 (United States)

    2015-10-15

    Highlights: • Perform a preliminary conceptual study for a steady-state Korean DEMO reactor. • Present a preliminary design of TF (toroidal field) magnet. • Present a preliminary design of CS (central solenoid) magnet. • Present a preliminary design of PF (toroidal field) magnet. - Abstract: As the ITER is being constructed, there is a growing anticipation for an earlier realization of fusion energy. A major design philosophy for the initiated conceptual design study for a steady-state Korean fusion demonstration reactor (K-DEMO) is engineering feasibility. A two-staged development plan is envisaged. K-DEMO is designed not only to demonstrate a net electricity generation and a self-sustained tritium cycle, but also to be used, in its initial stage, as a component test facility. Then, in its second stage, a major upgrade is carried out by replacing in-vessel components in order to show a net electricity generation on the order of 500 MWe. After a thorough 0-D system analysis, the major radius and minor radius are chosen to be 6.8 m and 2.1 m, respectively. In order to minimize wave deflection, a top-launch high frequency (>200 GHz) electron cyclotron current drive (ECCD) system will be the key system for the current profile control. For matching the high frequency ECCD, a high toroidal field (TF) is required and can be achieved by using high current density Nb{sub 3}Sn superconducting conductor. The peak magnetic field reaches to 16 T with the magnetic field at the plasma center above 7 T. Key features of the K-DEMO magnet system include the use of two TF coil winding packs, each of a different conductor design, to reduce the construction cost and save the space for the magnet structure material.

  10. RAMI analysis for DEMO HCPB blanket concept cooling system

    Energy Technology Data Exchange (ETDEWEB)

    Dongiovanni, Danilo N., E-mail: danilo.dongiovanni@enea.it [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati (Italy); Pinna, Tonio [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati (Italy); Carloni, Dario [KIT, Institute of Neutron Physics and Reactor Technology (INR) – KIT (Germany)

    2015-10-15

    Highlights: • RAMI (reliability, availability, maintainability and inspectability) preliminary assessment for HCPB blanket concept cooling system. • Reliability block diagram (RBD) modeling and analysis for HCPB primary heat transfer system (PHTS), coolant purification system (CPS), pressure control system (PCS), and secondary cooling system. • Sensitivity analysis on system availability performance. • Failure models and repair models estimated on the base of data from the ENEA fusion component failure rate database (FCFRDB). - Abstract: A preliminary RAMI (reliability, availability, maintainability and inspectability) assessment for the HCPB (helium cooled pebble bed) blanket cooling system based on currently available design for DEMO fusion power plant is presented. The following sub-systems were considered in the analysis: blanket modules, primary cooling loop including pipework and steam generators lines, pressure control system (PCS), coolant purification system (CPS) and secondary cooling system. For PCS and CPS systems an extrapolation from ITER Test Blanket Module corresponding systems was used as reference design in the analysis. Helium cooled pebble bed (HCPB) system reliability block diagrams (RBD) models were implemented taking into account: system reliability-wise configuration, operating schedule currently foreseen for DEMO, maintenance schedule and plant evolution schedule as well as failure and corrective maintenance models. A simulation of plant activity was then performed on implemented RBDs to estimate plant availability performance on a mission time of 30 calendar years. The resulting availability performance was finally compared to availability goals previously proposed for DEMO plant by a panel of experts. The study suggests that inherent availability goals proposed for DEMO PHTS system and Tokamak auxiliaries are potentially achievable for the primary loop of the HCPB concept cooling system, but not for the secondary loop. A

  11. Progress in conceptual design of EU DEMO EC system

    Science.gov (United States)

    Garavaglia, Saul; Bruschi, Alex; Franke, Thomas; Granucci, Gustavo; Grossetti, Giovanni; Jelonnek, John; Moro, Alessandro; Poli, Emanuele; Rispoli, Natale; Strauss, Dirk; Tran, Quang Minh

    2017-07-01

    Since 2014 under the umbrella of EUROfusion Consortium the Work Package Heating and Current Drive (WPHCD) is performing the engineering design and R&D for the electron cyclotron (EC), ion cyclotron and neutral beam systems of the future fusion power plant DEMO. This presentation covers the activities performed in the last two years on the EC system conceptual design, as part of the WPHCD, focusing on launchers, transmission lines, system reliability and architecture.

  12. Development of the Helium Cooled Lithium Lead blanket for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Aiello, G., E-mail: giacomo.aiello@cea.fr [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Aubert, J.; Jonquères, N. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Li Puma, A. [CEA-Saclay, DEN/DANS/DM2S/SERMA/LPEC, 91191 Gif Sur Yvette Cedex (France); Morin, A.; Rampal, G. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France)

    2014-10-15

    Highlights: • The HCLL blanket design has been modified to adapt it to the 2012 EFDA DEMO specifications. • The new design has been developed with the aim to capitalize on TBM experience in ITER. • A new attachment system for the modules has been proposed. - Abstract: The Helium Cooled Lithium Lead (HCLL) blanket is one of the candidate European blanket concepts selected for the DEMOnstration fusion power plant that should follow ITER. In a fusion power plant, the blanket is one of the key components because of its impact on the plant performance, availability, safety and economics. In 2012, the European Fusion Development Agreement (EFDA) agency issued new specifications for DEMO: this paper describes the work performed to adapt the previous 2007 HCLL-DEMO blanket design to those specifications. A new segmentation has been defined assuming straight surfaces for all blanket modules. Following the Multi Module Segment (MMS) option, all modules are attached to a common back supporting structure which also serves as manifold for Helium and PbLi distribution. A detailed CAD design of the central outboard module has been defined. Thermo-hydraulic and thermo-mechanical analyses on of the First Wall and Breeder Zone have been carried out. For the attachment of the modules to the common backplate, a new solution based on the use of Tie Rods, derived from the design of the corresponding HCLL Test Blanket Module for ITER, has been proposed. This paper also identifies the priorities for further development of the HCLL blanket design.

  13. Objectives and status of EUROfusion DEMO blanket studies

    Energy Technology Data Exchange (ETDEWEB)

    Boccaccini, L.V., E-mail: lorenzo.boccaccini@kit.edu [Karlsruhe Institute of Technology (KIT) (Germany); Aiello, G.; Aubert, J. [CEA-Saclay, DEN, DM2S, SEMT, F-91191 Gif-sur-Yvette (France); Bachmann, C. [EUROfusion, PPPT, Garching (Germany); Barrett, T. [CCFE, Abingdon OX14 3DB (United Kingdom); Del Nevo, A. [ENEA CR Brasimone, 40032 Camugnano, BO (Italy); Demange, D. [Karlsruhe Institute of Technology (KIT) (Germany); Forest, L. [CEA-Saclay, DEN, DM2S, SEMT, F-91191 Gif-sur-Yvette (France); Hernandez, F.; Norajitra, P. [Karlsruhe Institute of Technology (KIT) (Germany); Porempovic, G. [Fuziotech Engineering Ltd (Hungary); Rapisarda, D. [CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Sardain, P. [CEA/IRFM, 13115 Saint-Paul-lès-Durance (France); Utili, M. [ENEA CR Brasimone, 40032 Camugnano, BO (Italy); Vala, L. [Centrum výzkumu Řež, 250 68 Husinec-Řež (Czech Republic)

    2016-11-01

    Highlights: • Short description of the new Breeding Blanket Project in the EUROfusion consortium for the design of the EU PPPT DEMO: objectives. • Presentation of the design approach used in the development of the Breeding Blanket design: requirements. • Breeding Blanket design; in particular the four blanket concepts included in the study are presented, recent results highlighted and the status discussed. • Auxiliary systems and related R&D programme: in particular the work areas addressed in the Project (Tritium Technology, Pb-Li and Solid Breeders Technology, First Wall Design and R&D, Manufacturing) are presented, recent results highlighted and the status discussed. - Abstract: The design of a DEMO reactor requires the design of a blanket system suitable of reliable T production and heat extraction for electricity production. In the frame of the EUROfusion Consortium activities, the Breeding Blanket Project has been constituted in 2014 with the goal to develop concepts of Breeding Blankets for the EU PPPT DEMO; this includes an integrated design and R&D programme with the goal to select after 2020 concepts on fusion plants for the engineering phase. The design activities are presently focalized around a pool of solid and liquid breeder blanket with helium, water and PbLi cooling. Development of tritium extraction and control technology, as well manufacturing and development of solid and PbLi breeders are part of the programme.

  14. Model improvements for tritium transport in DEMO fuel cycle

    Energy Technology Data Exchange (ETDEWEB)

    Santucci, Alessia, E-mail: alessia.santucci@enea.it [Unità Tecnica Fusione – ENEA C. R. Frascati, Via E. Fermi 45, 00044 Frascati (Roma) (Italy); Tosti, Silvano [Unità Tecnica Fusione – ENEA C. R. Frascati, Via E. Fermi 45, 00044 Frascati (Roma) (Italy); Franza, Fabrizio [Karlsruhe Institute of Technology (KIT), Hermann-von-Helmholtz-Platz 1, D-76344 Eggenstein-Leopoldshafen (Germany)

    2015-10-15

    Highlights: • T inventory and permeation of DEMO blankets have been assessed under pulsed operation. • 1-D model for T transport has been developed for the HCLL DEMO blanket. • The 1-D model evaluated T partial pressure and T permeation rate radial profiles. - Abstract: DEMO operation requires a large amount of tritium, which is directly produced inside the reactor by means of Li-based breeders. During its production, recovering and purification, tritium comes in contact with large surfaces of hot metallic walls, therefore it can permeate through the blanket cooling structure, reach the steam generator and finally the environment. The development of dedicated simulation tools able to predict tritium losses and inventories is necessary to verify the accomplishment of the accepted tritium environmental releases as well as to guarantee a correct machine operation. In this work, the FUS-TPC code is improved by including the possibility to operate in pulsed regime: results in terms of tritium inventory and losses for three pulsed scenarios are shown. Moreover, the development of a 1-D model considering the radial profile of the tritium generation is described. By referring to the inboard segment on the equatorial axis of the helium-cooled lithium–lead (HCLL) blanket, preliminary results of the 1-D model are illustrated: tritium partial pressure in Li–Pb and tritium permeation in the cooling and stiffening plates by assuming several permeation reduction factor (PRF) values. Future improvements will consider the application of the model to all segments of different blanket concepts.

  15. Study of safety features and accident scenarios in a fusion DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, M., E-mail: nakamura.makoto@jaea.go.jp [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Tobita, K. [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Gulden, W. [Fusion for Energy, c/o EFDA Garching and Max-Plank-Institut fuer Plasmaphysik, Garching D-85748 (Germany); Watanabe, K. [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Toshiba Corporation, Yokohama, Kanagawa 235-8523 (Japan); Someya, Y. [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Tanigawa, H. [Japan Atomic Energy Agency, Naka, Ibaraki 311-0193 (Japan); Sakamoto, Y. [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Araki, T.; Matsumiya, H.; Ishii, K. [Toshiba Corporation, Yokohama, Kanagawa 235-8523 (Japan); Utoh, H. [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Takase, H. [IFERC Project Team, Rokkasho, Aomori 039-3212 (Japan); Hayashi, T. [Japan Atomic Energy Agency, Naka, Ibaraki 311-0193 (Japan); Satou, A.; Yonomoto, T. [Japan Atomic Energy Agency, Tokai, Ibaraki 319-1195 (Japan); Federici, G. [Fusion for Energy, c/o EFDA Garching and Max-Plank-Institut fuer Plasmaphysik, Garching D-85748 (Germany); Okano, K. [IFERC Project Team, Rokkasho, Aomori 039-3212 (Japan)

    2014-10-15

    Highlights: This paper reports progress in the fusion DEMO safety research conducted under the Broader Approach DEMO Design Activities; Hazards of a reference DEMO concept have been assessed; Reference accident event sequences in the reference DEMO in this study have been analyzed based on the master logic diagram (MLD) and the functional failure mode and effect analysis (FFMEA) techniques; Accident events of particular concern in the DEMO have been selected based on the MLD and FFMEA analysis. Abstract: After the Fukushima Dai-ichi nuclear accident, a need for assuring safety of fusion energy has grown in the Japanese (JA) fusion research community. DEMO safety research has been launched as a part of Broader Approach DEMO Design Activities (BA-DDA). This paper reports progress in the fusion DEMO safety research conducted under BA-DDA. Safety requirements and evaluation guidelines have been, first of all, established based on those established in the Japanese ITER site invitation activities. The radioactive source terms and energies that can mobilize such source terms have been assessed for a reference DEMO concept. This concept employs in-vessel components that are cooled by pressurized water and built of a low activation ferritic steel (F82H), contains solid pebble beds made of lithium-titanate (Li{sub 2}TiO{sub 3}) and beryllium–titanium (Be{sub 12}Ti) for tritium breeding and neutron multiplication, respectively. It is shown that unlike the energies expected in ITER, the enthalpy in the first wall/blanket cooling loops is large compared to the other energies expected in the reference DEMO concept. Reference accident event sequences in the reference DEMO in this study have been analyzed based on the Master Logic Diagram and Functional Failure Mode and Effect Analysis techniques. Accident events of particular concern in the DEMO have been selected based on the event sequence analysis and the hazard assessment.

  16. Deformation of giant vesicles in AC electric fields —Dependence of the prolate-to-oblate transition frequency on vesicle radius

    Science.gov (United States)

    Antonova, K.; Vitkova, V.; Mitov, M. D.

    2010-02-01

    The electrodeformation of giant vesicles is studied as a function of their radii and the frequency of the applied AC field. At low frequency the shape is prolate, at sufficiently high frequency it is oblate and at some frequency, fc, the shape changes from prolate to oblate. A linear dependence of the prolate-to-oblate transition inverse frequency, 1/fc, on the vesicle radius is found. The nature of this phenomenon does not change with the variation of both the solution conductivity, σ, and the type of the fluid enclosed by the lipid membrane (water, sucrose or glucose aqueous solution). When σ increases, the value of fc increases while the slope of the line 1/fc(r) decreases. For vesicles in symmetrical conditions (the same conductivity of the inner and the outer solution) a linear dependence between σ and the critical frequency, fc, is obtained for conductivities up to σ=114 μS/cm. For vesicles with sizes below a certain minimum radius, depending on the solution conductivity, no shape transition could be observed.

  17. Development of the water cooled lithium lead blanket for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, J., E-mail: julien.aubert@cea.fr [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Aiello, G.; Jonquères, N. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Li Puma, A. [CEA-Saclay, DEN/DANS/DM2S/SERMA/LPEC, 91191 Gif Sur Yvette Cedex (France); Morin, A.; Rampal, G. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France)

    2014-10-15

    Highlights: • The WCLL blanket design has been modified to adapt it to the 2012 EFDA DEMO specifications. • Preliminary CAD design of the equatorial outboard module of the WCLL blanket has been developed for DEMO. • Finite elements analyses have been carried out in order to assess the module thermal behavior in the straight part of the module. - Abstract: The water cooled lithium lead (WCLL) blanket, based on near-future technology requiring small extrapolation from present-day knowledge both on physical and technological aspect, is one of the breeding blanket concepts considered as possible candidates for the EU DEMOnstration power plant. In 2012, the EFDA agency issued new specifications for DEMO: this paper describes the work performed to adapt the WCLL blanket design to those specifications. Relatively small modules with straight surfaces are attached to a common Back Supporting Structure housing feeding pipes. Each module features reduced activation ferritic-martensitic steel as structural material, liquid Lithium-Lead as breeder, neutron multiplier and carrier. Water at typical Pressurized Water Reactors (PWR) conditions is chosen as coolant. A preliminary design of the equatorial outboard module has been achieved. Finite elements analyses have been carried out in order to assess the module thermal behavior. Two First Wall (FW) concepts have been proposed, one favoring the thermal efficiency, the other favoring the manufacturability. The Breeding Zone has been designed with C-shaped Double-Walled Tubes in order to minimize the Water/Pb-15.7Li interaction likelihood. The priorities for further development of the WCLL blanket concept are identified in the paper.

  18. Design study of ITER-like divertor target for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Crescenzi, Fabio, E-mail: fabio.crescenzi@enea.it [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); Bachmann, C. [EFDA, Power Plant Physics and Technology, Boltzmannstraße 2, 85748 Garching (Germany); Richou, M. [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Roccella, S.; Visca, E. [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); You, J.-H. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany)

    2015-10-15

    Highlights: • ‘DEMO’ is a near-term Power Plant Conceptual Study (PPCS). • The ITER-like design concept represents a promising solution also for DEMO plasma facing units. • The optimization of PFUs aims to enhance the thermo-mechanical behaviour of the component. • The optimized geometry was evaluated by ITER SDC-IC criteria and in terms of low cycle fatigue (LCF). - Abstract: A near-term water-cooled target solution has to be evaluated together with the required technologies and its power exhaust limit under ‘DEMO’ conditions. The ITER-like design concept based on the mono-block technology using W as armour material and the CuCrZr-IG as structural material with an interlayer of pure copper represents a promising solution also for DEMO. This work reports the design study of an “optimized” ITER-like Water Cooled Divertor able to withstand a heat flux of 10 MW m{sup −2}, as requested for DEMO operating conditions. The optimization of plasma facing unit (PFU) aims to enhance the thermo-mechanical behaviour of the component by varying some geometrical parameters (monoblock size, interlayer thickness and, tube diameter and thickness). The optimization was performed by means of the multi-variable optimization algorithms using the FEM code ANSYS. The coolant hydraulic conditions (inlet pressure, temperature and velocity) were fixed for simplicity. This study is based on elastic analysis and 3 dimensional modelling. The resulting optimized geometry was evaluated on the basis of the ITER SDC-IC criteria and in terms of low cycle fatigue (LCF). The margin to the critical heat flux (CHF) was also estimated. Further design study (taking into account the effect of neutron radiation on the material properties) together with mock-up fabrication and high-heat-flux (HHF) tests are foreseen in next work programmes.

  19. Plasma system requirements and performance data base for the Starlite/Demo fusion power plant

    Energy Technology Data Exchange (ETDEWEB)

    Mau, T.K.; Lee, B.J. [Univ. of California, San Diego, La Jolla, CA (United States). Fusion Energy Research Program; Ehst, D.A. [Argonne National Lab., IL (United States); Jardin, S.C.; Kessel, C.E. [Princeton Plasma Physics Lab., NJ (United States)

    1995-12-31

    General plasma system requirements for the US Demo fusion power plant have been identified, taking into account factors of economics, operability and reliability. Required extrapolations from the present plasma performance database have been assessed for the Demo options in five areas of tokamak operation, namely, stability, current drive, energy confinement, heat exhaust, and ash removal, for which figures of merit have been identified.

  20. Demos as an Explanatory Lens in Teacher Educators' Elusive Search for Social Justice

    Science.gov (United States)

    Oikonomidoy, Eleni M.; Brock, Cynthia H.; Obenchain, Kathryn M.; Pennington, Julie L.

    2013-01-01

    Borrowing insights from the Ancient Greek ideal conceptions of a democratic civic space (demos), this article examines the applicability of this framework to four teacher educators' journey to implement social justice in their programs. It is proposed that the three constitutive dimensions of demos (freedom of speech, equality to vote and…

  1. The Role of Community Colleges in Advancing Upward Mobility: A Demos Perspective

    Science.gov (United States)

    Huelsman, Mark

    2015-01-01

    This article provides a short background on Demos, a public policy organization that works on issues of political and economic inequality. Demos views community colleges as a linchpin in the American higher education system, and it has worked over several years to research ways to increase state support for higher education and direct support…

  2. Demos – Brandenburgisches Institut für Gemeinwesenberatung

    OpenAIRE

    2010-01-01

    Mit Einblicke III setzt Demos – Mobiles Beratungsteam Tolerantes Brandenburg (MBT) seine Reihe von Selbstreflexionen und Fallberichten aus dem Land Brandenburg fort. „Demokratie heißt Einmischung in die eigenen Angelegenheiten“. Das MBT nimmt den Impuls von Max Frisch auf und unterstützt alle, die Werte und Verfahren der Demokratie ernst nehmen; das MBT versucht jene zu gewinnen, die der Demokratie indifferent und skpetisch gegenüberstehen; und schließlich fördert es die kritische Auseinander...

  3. The development of ferritic steels for DEMO blanket

    Energy Technology Data Exchange (ETDEWEB)

    Kohyama, A. [Kyoto Univ. (Japan). Inst. of Advanced Energy; Hishinuma, A.; Shiba, K. [Tokai Establishment, JAERI, Tokai, Ibaraki (Japan); Kohno, Y. [Department of Materials Science, University of Tokyo, Hongo, Tokyo 113 (Japan); Sagara, A. [National Institute for Fusion Science, Toki, Gifu (Japan)

    1998-09-01

    The development of low-activation ferritic/martensitic steels is a key to the achievement of nuclear fusion as a safe, environmentally attractive and economically competitive energy source. The Japanese and the European Fusion Materials programs have put low-activation ferritic and martensitic steels R and D at the highest priority for a demonstration reactor (DEMO) and the beyond. An international collaborative test program on low-activation ferritic/martensitic steels for fusion is in progress as an activity of the International Energy Agency (IEA) fusion materials working group to verify the feasibility of using ferritic/martensitic steels for fusion by an extensive test program covering the most relevant technical issues for the qualification of a material for a nuclear application. The development of a comprehensive data base on the representative industrially processed reduced-activation steels of type 8-9Cr-2WVTa is underway for providing designers a preliminary set of material data for the mechanical design of components, e.g. for DEMO relevant blanket modules. The current design status of FFHR and SSTR utilizing low-activation ferritic steels is reviewed and future prospects are defined. (orig.) 12 refs.

  4. Enhancing the DEMO divertor target by interlayer engineering

    Energy Technology Data Exchange (ETDEWEB)

    Barrett, T.R., E-mail: tom.barrett@ccfe.ac.uk [CCFE, Culham Science Centre, Oxfordshire OX14 3DB (United Kingdom); McIntosh, S.C.; Fursdon, M.; Hancock, D.; Timmis, W.; Coleman, M. [CCFE, Culham Science Centre, Oxfordshire OX14 3DB (United Kingdom); Rieth, M.; Reiser, J. [Karlsruhe Institute for Technology, IMF-I, D-7602 Karlsruhe (Germany)

    2015-10-15

    Highlights: • The European ‘near-term’ DEMO forsees a water-cooled divertor. • Divertor targets typically use an interlayer between the armour and structure. • Engineering the properties of the interlayer can yield large gains in performance. • A response surface based design search and optimisation method is used. • A new design passes linear-elastic code rules up to applied heat flux of 18 MW/m{sup 2}. - Abstract: A robust water-cooled divertor target plate solution for DEMO has to date remained elusive. Common to all contemporary concepts is an interlayer at the boundary between the tungsten armour and the cooling structure. In this paper we show by design optimisation that an effectively designed interlayer can produce dramatic gains in power handling. By engineering the interlayer as part of the design study, it is found that divertor performance is enhanced by either a low conductivity ‘Thermal Break’ interlayer or an ‘Ultra-Compliant’ interlayer. For a 10 MW/m{sup 2} surface heat flux we find that a thermal conductivity of 15 W/mK and elastic modulus of 1 GPa are effective. A design is proposed which passes linear-elastic code rules up to an applied heat flux of 18 MW/m{sup 2}.

  5. An FPGA computing demo core for space charge simulation

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Jinyuan; Huang, Yifei; /Fermilab

    2009-01-01

    In accelerator physics, space charge simulation requires large amount of computing power. In a particle system, each calculation requires time/resource consuming operations such as multiplications, divisions, and square roots. Because of the flexibility of field programmable gate arrays (FPGAs), we implemented this task with efficient use of the available computing resources and completely eliminated non-calculating operations that are indispensable in regular micro-processors (e.g. instruction fetch, instruction decoding, etc.). We designed and tested a 16-bit demo core for computing Coulomb's force in an Altera Cyclone II FPGA device. To save resources, the inverse square-root cube operation in our design is computed using a memory look-up table addressed with nine to ten most significant non-zero bits. At 200 MHz internal clock, our demo core reaches a throughput of 200 M pairs/s/core, faster than a typical 2 GHz micro-processor by about a factor of 10. Temperature and power consumption of FPGAs were also lower than those of micro-processors. Fast and convenient, FPGAs can serve as alternatives to time-consuming micro-processors for space charge simulation.

  6. Neutronic analyses and tools development efforts in the European DEMO programme

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, U., E-mail: ulrich.fischer@kit.edu [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Bachmann, C. [European Fusion Development Agreement (EFDA), Garching (Germany); Bienkowska, B. [Association IPPLM-Euratom, IPPLM Warsaw/INP Krakow (Poland); Catalan, J.P. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Drozdowicz, K.; Dworak, D. [Association IPPLM-Euratom, IPPLM Warsaw/INP Krakow (Poland); Leichtle, D. [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Fusion for Energy (F4E), Barcelona (Spain); Lengar, I. [MESCS-JSI, Ljubljana (Slovenia); Jaboulay, J.-C. [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Lu, L. [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Moro, F. [Associazione ENEA-Euratom, ENEA Fusion Division, Frascati (Italy); Mota, F. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (CIEMAT), Madrid (Spain); Sanz, J. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Szieberth, M. [Budapest University of Technology and Economics (BME), Budapest (Hungary); Palermo, I. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (CIEMAT), Madrid (Spain); Pampin, R. [Fusion for Energy (F4E), Barcelona (Spain); Porton, M. [Euratom/CCFE Fusion Association, Culham Science Centre for Fusion Energy (CCFE), Culham (United Kingdom); Pereslavtsev, P. [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Ogando, F. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Rovni, I. [Budapest University of Technology and Economics (BME), Budapest (Hungary); and others

    2014-10-15

    Highlights: •Evaluation of neutronic tools for application to DEMO nuclear analyses. •Generation of a DEMO model for nuclear analyses based on MC calculations. •Nuclear analyses of the DEMO reactor equipped with a HCLL-type blanket. -- Abstract: The European Fusion Development Agreement (EFDA) recently launched a programme on Power Plant Physics and Technology (PPPT) with the aim to develop a conceptual design of a fusion demonstration reactor (DEMO) addressing key technology and physics issues. A dedicated part of the PPPT programme is devoted to the neutronics which, among others, has to define and verify requirements and boundary conditions for the DEMO systems. The quality of the provided data depends on the capabilities and the reliability of the computational tools. Accordingly, the PPPT activities in the area of neutronics include both DEMO nuclear analyses and development efforts on neutronic tools including their verification and validation. This paper reports on first neutronics studies performed for DEMO, and on the evaluation and further development of neutronic tools.

  7. Thermal Hydraulic Analysis of K-DEMO Single Blanket Module for Preliminary Accident Analysis using MELCOR

    Energy Technology Data Exchange (ETDEWEB)

    Moon, Sung Bo; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)

    2016-05-15

    To develop the Korean fusion commercial reactor, preliminary design concept for K-DEMO (Korean fusion demonstration reactor) has been announced by NFRI (National Fusion Research Institute). This pre-conceptual study of K-DEMO has been introduced to identify technical details of a fusion power plant for the future commercialization of fusion reactor in Korea. Before this consideration, to build the K-DEMO, accident analysis is essential. Since the Fukushima accident, which is severe accident from unexpected disaster, safety analysis of nuclear power plant has become important. The safety analysis of both fission and fusion reactors is deemed crucial in demonstrating the low radiological effect of these reactors on the environment, during severe accidents. A risk analysis of K-DEMO should be performed, as a prerequisite for the construction of a fusion reactor. In this research, thermal-hydraulic analysis of single blanket module of K-DEMO is conducted for preliminary accident analysis for K-DEMO. Further study about effect of flow distributer is conducted. The normal K-DEMO operation condition is applied to the boundary condition and simulated to verify the material temperature limit using MELCOR. MELCOR is fully integrated, relatively fast-running code developed by Sandia National Laboratories. MELCOR had been used for Light Water Reactors and fusion reactor version of MELCOR was developed for ITER accident analysis. This study shows the result of thermal-hydraulic simulation of single blanket module with MELCOR which is severe accident code for nuclear fusion safety analysis. The difference of mass flow rate for each coolant channel with or without flow distributer is presented. With flow distributer, advantage of broadening temperature gradient in the K-DEMO blanket module and increase mass flow toward first wall is obtained. This can enhance the safety of K-DEMO blanket module. Most 13 .deg. C temperature difference in blanket module is obtained.

  8. Safety studies on Korean fusion DEMO plant using Integrated Safety Assessment Methodology: Part 2

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Kyemin; Kang, Myoung-suk [Kyung Hee University, Yongin-si, Gyeonggi-do 446-701 (Korea, Republic of); Heo, Gyunyoung, E-mail: gheo@khu.ac.kr [Kyung Hee University, Yongin-si, Gyeonggi-do 446-701 (Korea, Republic of); Kim, Hyoung-chan [National Fusion Research Institute, Daejeon-si 305-333 (Korea, Republic of)

    2015-10-15

    Highlights: • The purpose of this paper is to suggest methodology that can investigate safety issues and provides a case study for Korean fusion DEMO plant. • The concepts of Integrated Safety Assessment Methodology (ISAM) that can be applied in addressing regulatory requirements and recognizing safety issues for K-DEMO were emphasized. • Phenomena Identification Ranking Table (PIRT) and Objective Provision Tree (OPT) were performed and updated. • This work is expected to contribute on the conceptual design of safety features for K-DEMO to design engineers and the guidance for regulatory requirements to licensers. - Abstract: The purpose of this paper is to investigate safety issues using Integrated Safety Assessment Methodology (ISAM) proposed by Generation IV Forum Risk and Safety Working Group (RSWG) for Korean fusion DEMO plant (K-DEMO). In ongoing nuclear energy research such as Generation IV fission power plant (GEN-IV), new methodology based on Technology-Neutral Framework (TNF) has been applied for safety assessment. In this methodology, design and regulatory requirements for safety of nuclear power plants are considered simultaneously. The design based on regulatory requirements can save resource, time, and manpower while maintaining high level safety. ISAM is one of the options to apply TNF in K-DEMO. We have performed safety studies for K-DEMO using Phenomena Identification and Ranking Table (PIRT) and Objective Provision Tree (OPT) which are constitutive part of ISAM. Considering the design phase of K-DEMO, the current study focused on PIRT and OPT for K-DEMO. Results have been reviewed and updated by Korean fusion advisory group after considering the views of specialists from domestic universities, industries, and national institutes in South Korea.

  9. Beyond ITER: neutral beams for a demonstration fusion reactor (DEMO) (invited).

    Science.gov (United States)

    McAdams, R

    2014-02-01

    In the development of magnetically confined fusion as an economically sustainable power source, International Tokamak Experimental Reactor (ITER) is currently under construction. Beyond ITER is the demonstration fusion reactor (DEMO) programme in which the physics and engineering aspects of a future fusion power plant will be demonstrated. DEMO will produce net electrical power. The DEMO programme will be outlined and the role of neutral beams for heating and current drive will be described. In particular, the importance of the efficiency of neutral beam systems in terms of injected neutral beam power compared to wallplug power will be discussed. Options for improving this efficiency including advanced neutralisers and energy recovery are discussed.

  10. Beyond ITER: Neutral beams for a demonstration fusion reactor (DEMO) (invited)

    Energy Technology Data Exchange (ETDEWEB)

    McAdams, R., E-mail: roy.mcadams@ccfe.ac.uk [EURATOM/CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom)

    2014-02-15

    In the development of magnetically confined fusion as an economically sustainable power source, International Tokamak Experimental Reactor (ITER) is currently under construction. Beyond ITER is the demonstration fusion reactor (DEMO) programme in which the physics and engineering aspects of a future fusion power plant will be demonstrated. DEMO will produce net electrical power. The DEMO programme will be outlined and the role of neutral beams for heating and current drive will be described. In particular, the importance of the efficiency of neutral beam systems in terms of injected neutral beam power compared to wallplug power will be discussed. Options for improving this efficiency including advanced neutralisers and energy recovery are discussed.

  11. Pre-conceptual Design Assessment of DEMO Remote Maintenance

    CERN Document Server

    Loving, A; Sykes, N; Iglesias, D; Coleman, M; Thomas, J; Harman, J; Fischer, U; Sanz, J; Siuko, M; Mittwollen, M; others,

    2013-01-01

    EDFA, as part of the Power Plant Physics and Technology programme, has been working on the pre-conceptual design of a Demonstration Power Plant (DEMO). As part of this programme, a review of the remote maintenance strategy considered maintenance solutions compatible with expected environmental conditions, whilst showing potential for meeting the plant availability targets. A key finding was that, for practical purposes, the expected radiation levels prohibit the use of complex remote handling operations to replace the first wall. In 2012/13, these remote maintenance activities were further extended, providing an insight into the requirements, constraints and challenges. In particular, the assessment of blanket and divertor maintenance, in light of the expected radiation conditions and availability, has elaborated the need for a very different approach from that of ITER. This activity has produced some very informative virtual reality simulations of the blanket segments and pipe removal that are exceptionally ...

  12. TECXY study of a liquid lithium divertor for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Pelka, G.; Chmielewski, P.; Zagorski, R. [Institute of Plasma Physics and Laser Microfusion, Warsaw (Poland); Pericoli-Ridolfini, V.; Viola, B. [ENEA C.R. Frascati, Roma (Italy)

    2016-08-15

    Divertor targets made out of a capillary porous system (CPS) filled with liquid lithium, have been proposed as an alternative to standard, solid state plates. In the current work we simulate the DEMO edge plasma in either a standard single-null or snowflake divertor configuration. Our tool is the 2D code TECXY. Lithium ablated from the target plate surface and released into the plasma is shown here to partially screen the incoming heat flux. Lithium's moderate SOL radiation levels suggest additional seeding to be beneficial. Very high heat fluxes to the divertor need to be avoided, as intensive lithium evaporation might unacceptably pollute the plasma. (copyright 2016 The Authors. Contributions to Plasma Physics published by Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  13. Demo III: Department of Defense testbed for unmanned ground mobility

    Science.gov (United States)

    Shoemaker, Chuck M.; Bornstein, Jonathan A.; Myers, Scott D.; Brendle, Bruce E., Jr.

    1999-07-01

    Robotics has been identified by numerous recent Department of Defense (DOD) studies as a key enabling technology for future military operational concepts. The Demo III Program is a multiyear effort encompassing technology development and demonstration on testbed platforms, together with modeling simulation and experimentation directed toward optimization of operational concepts to employ this technology. Primary program focus is the advancement of capabilities for autonomous mobility through unstructured environments, concentrating on both perception and intelligent control technology. The scout mission will provide the military operational context for demonstration of this technology, although a significant emphasis is being placed upon both hardware and software modularity to permit rapid extension to other military missions. The Experimental Unmanned Vehicle (XUV) is a small (approximately 1150 kg, V-22 transportable) technology testbed vehicle designed for experimentation with multiple military operational concepts. Currently under development, the XUV is scheduled for roll-out in Summer 1999, with an initial troop experimentation to be conducted in September 1999. Though small, and relatively lightweight, modeling has shown the chassis capable of automotive mobility comparable to the current Army lightweight high-mobility, multipurpose, wheeled vehicle (HMMWV). The XUV design couples multisensor perception with intelligent control to permit autonomous cross-country navigation at speeds of up to 32 kph during daylight and 16 kph during hours of darkness. A small, lightweight, highly capable user interface will permit intuitive control of the XUV by troops from current-generation tactical vehicles. When it concludes in 2002, Demo III will provide the military with both the technology and the initial experience required to develop and field the first generation of semi-autonomous tactical ground vehicles for combat, combat support, and logistics applications.

  14. European DEMO design strategy and consequences for materials

    Science.gov (United States)

    Federici, G.; Biel, W.; Gilbert, M. R.; Kemp, R.; Taylor, N.; Wenninger, R.

    2017-09-01

    Demonstrating the production of net electricity and operating with a closed fuel-cycle remain unarguably the crucial steps towards the exploitation of fusion power. These are the aims of a demonstration fusion reactor (DEMO) proposed to be built after ITER. This paper briefly describes the DEMO design options that are being considered in Europe for the current conceptual design studies as part of the Roadmap to Fusion Electricity Horizon 2020. These are not intended to represent fixed and exclusive design choices but rather ‘proxies’ of possible plant design options to be used to identify generic design/material issues that need to be resolved in future fusion reactor systems. The materials nuclear design requirements and the effects of radiation damage are briefly analysed with emphasis on a pulsed ‘low extrapolation’ system, which is being used for the initial design integration studies, based as far as possible on mature technologies and reliable regimes of operation (to be extrapolated from the ITER experience), and on the use of materials suitable for the expected level of neutron fluence. The main technical issues arising from the plasma and nuclear loads and the effects of radiation damage particularly on the structural and heat sink materials of the vessel and in-vessel components are critically discussed. The need to establish realistic target performance and a development schedule for near-term electricity production tends to favour more conservative technology choices. The readiness of the technical (physics and technology) assumptions that are being made is expected to be an important factor for the selection of the technical features of the device.

  15. DEMO design activities in the broader approach under Japan/EU collaboration

    Energy Technology Data Exchange (ETDEWEB)

    Okano, Kunihiko, E-mail: okano-k@z2.keio.jp [International Fusion Energy Research Centre (IFERC) for Broader Approach, Rokkasho (Japan); Federici, Gianfranco [Power Plant Physics and Technology, European Fusion Development Agreement (EFDA), Garching (Germany); Tobita, Kenji [Fusion Research and Development Directorate, Japan Atomic Energy Agency (JAEA), Rokkasho (Japan)

    2014-10-15

    The DEMO design studies in the BA (broader approach in the field of fusion energy) are being conducted by the DEMO Design Activity unit of International Fusion Energy Research Centre for the broader approach (BA) and the Home Teams in EU and Japan since 2011. The activity covers most of the critical issues on the DEMO design. Emphasis during the last two years was on studies to develop the best embodiment of a tokamak as a power reactor consistent with credible operating scenarios and feasible engineering solutions to critical design issues. The technical activities have focused on, for example, plasma physics for DEMO plants, divertor physics and technology, in-vessel components, maintenance schemes and safety research.

  16. Selected transport studies of a tokamak-based DEMO fusion reactor

    Science.gov (United States)

    Fable, E.; Wenninger, R.; Kemp, R.

    2017-02-01

    As a next-step in the tokamak-based fusion programme, the DEMO fusion reactor is foreseen to produce relevant output electricity, in the order of  ∼500 MW delivered to the network. The scenarios that are being presently investigated consist of a pulsed device, called DEMO1, and a steady-state device, called DEMO2. In this work, which is focused on the pulsed device DEMO1, scenarios are studied from the point of view of core transport, to assess plasma performance and limitations due to core microinstabilities. The role of radiated power, aspect ratio, and height of temperature pedestal are assessed as they impact both core energy and particle transport. Open issues in this framework are also discussed.

  17. A new meshless approach to map electromagnetic loads for FEM analysis on DEMO TF coil system

    Energy Technology Data Exchange (ETDEWEB)

    Biancolini, Marco Evangelos, E-mail: biancolini@ing.uniroma2.it [Università di Roma Tor Vergata, Dip. Ingegneria dell’Impresa “Mario Lucertini”, Via del Politecnico 1, 00133 Roma (Italy); Brutti, Carlo, E-mail: brutti@uniroma2.it [Università di Roma Tor Vergata, Dip. Ingegneria dell’Impresa “Mario Lucertini”, Via del Politecnico 1, 00133 Roma (Italy); Giorgetti, Francesco, E-mail: francesco.giorgetti@uniroma2.it [Università di Roma Tor Vergata, Dip. Ingegneria dell’Impresa “Mario Lucertini”, Via del Politecnico 1, 00133 Roma (Italy); Muzzi, Luigi, E-mail: luigi.muzzi@enea.it [ENEA, Laboratorio Superconduttività, Unità Tecnica Fusione, Via E. Fermi 45, 00044 Frascati (RM) (Italy); Turtù, Simonetta, E-mail: simonetta.turtu@enea.it [ENEA, Laboratorio Superconduttività, Unità Tecnica Fusione, Via E. Fermi 45, 00044 Frascati (RM) (Italy); Anemona, Alessandro, E-mail: alessandro.anemona@enea.it [ENEA, Laboratorio Superconduttività, Unità Tecnica Fusione, Via E. Fermi 45, 00044 Frascati (RM) (Italy)

    2015-11-15

    Graphical abstract: - Highlights: • Generation and mapping of magnetic load on DEMO using radial basis function. • Good agreement between RBF interpolation and EM TOSCA computations. • Resultant forces are stable with respect to the target mesh used. • Stress results are robust and accurate even if a coarse cloud is used for RBF interpolation. - Abstract: Demonstration fusion reactors (DEMO) are being envisaged to be able to produce commercial electrical power. The design of the DEMO magnets and of the constituting conductors is a crucial issue in the overall engineering design of such a large fusion machine. In the frame of the EU roadmap of the so-called fast track approach, mechanical studies of preliminary DEMO toroidal field (TF) coil system conceptual designs are being enforced. The magnetic field load acting on the DEMO TF coil conductor has to be evaluated as input in the FEM model mesh, in order to evaluate the stresses on the mechanical structure. To gain flexibility, a novel approach based on the meshless method of radial basis functions (RBF) has been implemented. The present paper describes this original and flexible approach for the generation and mapping of magnetic load on DEMO TF coil system.

  18. Recent ASDEX Upgrade research in support of ITER and DEMO

    Science.gov (United States)

    H. Zohmthe ASDEX Upgrade Team; the EUROfusion MST1 Team

    2015-10-01

    Recent experiments on the ASDEX Upgrade tokamak aim at improving the physics base for ITER and DEMO to aid the machine design and prepare efficient operation. Type I edge localized mode (ELM) mitigation using resonant magnetic perturbations (RMPs) has been shown at low pedestal collisionality (νped\\ast PLH occurs indicates that ITER could take advantage of it to initiate H-mode at lower density than that of the final Q = 10 operational point. Core density fluctuation measurements resolved in radius and wave number show that an increase of R/LTe introduced by off-axis electron cyclotron resonance heating (ECRH) mainly increases the large scale fluctuations. The radial variation of the fluctuation level is in agreement with simulations using the GENE code. Fast particles are shown to undergo classical slowing down in the absence of large scale magnetohydrodynamic (MHD) events and for low heating power, but show signs of anomalous radial redistribution at large heating power, consistent with a broadened off-axis neutral beam current drive current profile under these conditions. Neoclassical tearing mode (NTM) suppression experiments using electron cyclotron current drive (ECCD) with feedback controlled deposition have allowed to test several control strategies for ITER, including automated control of (3,2) and (2,1) NTMs during a single discharge. Disruption mitigation studies using massive gas injection (MGI) can show an increased fuelling efficiency with high field side injection, but a saturation of the fuelling efficiency is observed at high injected mass as needed for runaway electron suppression. Large locked modes can significantly decrease the fuelling efficiency and increase the asymmetry of radiated power during MGI mitigation. Concerning power exhaust, the partially detached ITER divertor scenario has been demonstrated at Psep/R = 10 MW m-1 in ASDEX Upgrade, with a peak time averaged target load around 5 MW m-2, well consistent with the component limits

  19. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  20. Engineering options for the U.S. Fusion Demo

    Energy Technology Data Exchange (ETDEWEB)

    Tillack, M.S. [Univ. of California, San Diego, CA (United States). Fusion Energy Research Program; Billone, M.; Sze, D.K. [Argonne National Lab., IL (United States); El-Guebaly, L. [Univ. of Wisconsin, Madison, WI (United States). Fusion Technology Inst.; Waganer, L.M. [McDonnell Douglas Aerospace, St. Louis, MO (United States); Wong, C. [General Atomics, San Diego, CA (United States)

    1996-10-01

    Through its successful operation, the US Fusion Demo must be sufficiently convincing that a utility or independent power producer will choose to purchase one as its next electric generating plant. A fusion power plant which is limited to the use of currently-proven technologies is unlikely to be sufficient attractive to a utility unless fuel shortages and regulatory restrictions are far more crippling to competing energy sources than currently anticipated. In that case, the task of choosing an appropriate set of engineering technologies today involves trade-offs between attractiveness and technical risk. The design space for an attractive tokamak fusion power core is not unlimited; previous studies have shown that advanced low-activation ferritic steel, vanadium alloy, or SiC/SiC composites are the only candidates they have for the primary in-vessel structural material. An assessment of engineering design options has been performed using these three materials and the associated in-vessel component designs which are compatible with them.

  1. UAS-NAS Project Demo - Mini HITL Week 2 Stats

    Science.gov (United States)

    Murphy, James R.; Fern, Lisa C.; Rorie, Robert C.; Shively, Robert; Jovic, Srboljub

    2016-01-01

    The UAS-NAS Project demo will showcase recent research efforts to ensure the interoperability between proposed UAS detect and avoid (DAA) human machine interface requirements (developed within RTCA SC-228) and existing collision avoidance displays. Attendees will be able to view the current state of the art of the DAA pilot traffic, alerting and guidance displays integrated with Traffic advisory and Collision Avoidance (TCAS) II in the UAS-NAS Project's research UAS ground control station (developed in partnership with the Air Force Research Laboratory). In addition, attendees will have the opportunity to interact with the research UAS ground control station and "fly" encounters, using the DAA and TCAS II displays to avoid simulated aircraft. The display of the advisories will be hosted on a laptop with an external 30" monitor, running the Vigilant Spirit system. DAA advisories will be generated by the JADEM software tool, connected to the system via the LVC Gateway. A repeater of the primary flight display will be shown on a 55" monitor mounted on a stand at the back of the booth to show the pilot interaction to the passersby.

  2. Pre-conceptual design assessment of DEMO remote maintenance

    Energy Technology Data Exchange (ETDEWEB)

    Loving, A., E-mail: antony.loving@ccfe.ac.uk [EURATOM/Culham Center Fusion Energy, Culham Science Centre, OX14 3DB, Abingdon (United Kingdom); Crofts, O.; Sykes, N.; Iglesias, D.; Coleman, M.; Thomas, J. [EURATOM/Culham Center Fusion Energy, Culham Science Centre, OX14 3DB, Abingdon (United Kingdom); Harman, J. [EFDA Close Support Unit Garching, Boltzmannstaße 2, D-85748 Garching Bei München (Germany); Fischer, U. [Karlsruhe Institute of Technology, Institute for Neutron Physics and Reactor Technology, Hermann-von-Helmholtz-Platz 1, D-76344 Eggenstein-Leopoldshafen (Germany); Sanz, J. [Instituto de Fusión Nuclear/UPM, Madrid (Spain); Siuko, M. [VTT Technical Research Centre of Finland, P.O. Box 1000, FI-02044 VTT (Finland); Mittwollen, M. [Karlsruhe Institute of Technology, Institut für Fördertechnik und Logistiksysteme, Gotthard-Franz-Straße 8, Geb.50.38, 76131 Karlsruhe (Germany)

    2014-10-15

    EDFA, as part of the Power Plant Physics and Technology programme, has been working on the pre-conceptual design of a Demonstration Power Plant (DEMO). As part of this programme, a review of the remote maintenance strategy considered maintenance solutions compatible with expected environmental conditions, whilst showing potential for meeting the plant availability targets. A key finding was that, for practical purposes, the expected radiation levels prohibit the use of complex remote handling operations to replace the first wall. In 2012/2013, these remote maintenance activities were further extended, providing an insight into the requirements, constraints and challenges. In particular, the assessment of blanket and divertor maintenance, in light of the expected radiation conditions and availability, has elaborated the need for a very different approach from that of ITER. This activity has produced some very informative virtual reality simulations of the blanket segments and pipe removal that are exceptionally valuable in communicating the complexity and scale of the required operations. Through these simulations, estimates of the maintenance task durations have been possible demonstrating that a full replacement of the blankets within 6 months could be achieved. The design of the first wall, including the need to use sacrificial limiters must still be investigated. In support of the maintenance operations, a first indication of the requirements of an Active Maintenance Facility (AMF) has been elaborated.

  3. Tritium production assessment for the DCLL EUROfusion DEMO

    Science.gov (United States)

    Palermo, Iole; Rapisarda, David; Fernández-Berceruelo, Iván; Ibarra, Angel

    2016-10-01

    The viability of a fusion reactor is preeminently conditioned by the tritium self-sufficiency. An assessment of different parameters representing the tritium production, as the tritium breeding ratio (TBR), the tritium production rate (TPR) density and their poloidal and radial variations along the PbLi breeder zones has been performed for the last DCLL DEMO designs developed in the frame of the EUROfusion Programme. The final overall value of 1.104 obtained allows accomplishing the fuel self-sufficiency requirement. This TBR value includes not only the contribution of the breeding blanket (BB) modules but also of the back supporting structure (BSS). The BSS design resulted fundamental to reach the 1.1 criterion. Lastly, the influence of the integration in the reactor of the heating and current drive (H&CD) systems that will penetrate the breeder volume has been evaluated. Assuming different configurations for them, the TBR loss has been determined. All the calculations have entailed the use of the particle transport Monte Carlo code MCNP5.

  4. Scoping Studies for NBI Launch Geometries on DEMO

    CERN Document Server

    Jenkins, I; Keeling, D L; Surrey, E

    2014-01-01

    Scans of Neutral Beam Injection (NBI) tangency radii and elevation on two possible DEMO scenarios have been performed with two beam energies, 1.5MeV and 1.0MeV, in order to determine the most favourable options for Neutral Beam Current Drive (NBCD) efficiency. In addition, a method using a genetic algorithm has been used to seek optimised solutions of NBI source locations and powers to synthesize a target total plasma driven-current profile. It is found that certain beam trajectories may be proscribed by limitations on shinethrough onto the vessel wall. This may affect the ability of NBCD to extend the duration of a pulse in a scenario where it must complement the induced plasma current. Operating at the lower beam energy reduces the restrictions due to shinethrough and is attractive for technical reasons, but in the scenarios examined here this results in a spatial broadening of the NBCD profile, which may make it more challenging to achieve desired total driven-current profiles.

  5. Conceptual design of the beam source for the DEMO Neutral Beam Injectors

    Science.gov (United States)

    Sonato, P.; Agostinetti, P.; Fantz, U.; Franke, T.; Furno, I.; Simonin, A.; Tran, M. Q.

    2016-12-01

    DEMO (DEMOnstration Fusion Power Plant) is a proposed nuclear fusion power plant that is intended to follow the ITER experimental reactor. The main goal of DEMO will be to demonstrate the possibility to produce electric energy from the fusion reaction. The injection of high energy neutral beams is one of the main tools to heat the plasma up to fusion conditions. A conceptual design of the Neutral Beam Injector (NBI) for the DEMO fusion reactor, is currently being developed by Consorzio RFX in collaboration with other European research institutes. High efficiency and low recirculating power, which are fundamental requirements for the success of DEMO, have been taken into special consideration for the DEMO NBI. Moreover, particular attention has been paid to the issues related to reliability, availability, maintainability and inspectability. A conceptual design of the beam source for the DEMO NBI is here presented featuring 20 sub-sources (two adjacent columns of 10 sub-sources each), following a modular design concept, with each sub-source featuring its radio frequency driver, capable of increasing the reliability and availability of the DEMO NBI. Copper grids with increasing size of the apertures have been adopted in the accelerator, with three main layouts of the apertures (circular apertures, slotted apertures and frame-like apertures for each sub-source). This design, permitting to significantly decrease the stripping losses in the accelerator without spoiling the beam optics, has been investigated with a self-consistent model able to study at the same time the magnetic field, the electrostatic field and the trajectory of the negative ions. Moreover, the status on the R&D carried out in Europe on the ion sources is presented.

  6. Safety studies on Korean fusion DEMO plant using integrated safety assessment methodology

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Kyemin; Kang, Myoung-suk [Kyung Hee University, Youngin-si, Gyeonggi-do 446-701 (Korea, Republic of); Heo, Gyunyoung, E-mail: gheo@khu.ac.kr [Kyung Hee University, Youngin-si, Gyeonggi-do 446-701 (Korea, Republic of); Kim, Hyoung-chan [National Fusion Research Institute, Daejeon-si 305-333 (Korea, Republic of)

    2014-10-15

    Highlights: •The purpose of this paper is to suggest methodology that can investigate safety issues and provides a case study for Korean fusion DEMO plant. •The concepts of integrated safety assessment methodology (ISAM) that can be applied in addressing regulatory requirements and recognizing safety issues for K-DEMO were emphasized. •Phenomena identification and ranking table (PIRT) was proposed. It can recognize vulnerabilities of systems and identify the gaps in technical areas requiring additional researches. •This work is expected to contribute on the conceptual design of safety features for K-DEMO to design engineers and the guidance for regulatory requirements to licensers. -- Abstract: The purpose of this paper is to suggest methodology that can investigate safety issues and provides a case study for Korean fusion DEMO plant (K-DEMO) as a part of R and D program through the National Fusion Research Institute of Korea. Even though nuclear regulation and licensing framework is well setup due to the operating and design experience of Pressurized Water Reactors (PWRs) since 1970s, the regulatory authority of South Korea has concerns on the challenge of facing new nuclear facilities including K-DEMO due to the differences in systems, materials, and inherent safety feature from conventional PWRs. Even though the follow-up of the ITER license process facilitates to deal with significant safety issues of fusion facilities, a licensee as well as a licenser should identify the gaps between ITER and DEMO in terms of safety issues. First we reviewed the methods of conducting safety analysis for unprecedented nuclear facilities such as Generation IV reactors, particularly very high temperature reactor (VHTR), which is called as integrated safety assessment methodology (ISAM). Second, the analysis for the conceptual design of K-DEMO on the basis of ISAM was conducted. The ISAM consists of five analytical tools to develop the safety requirements from licensee

  7. Definition of the basic DEMO tokamak geometry based on systems code studies

    Energy Technology Data Exchange (ETDEWEB)

    Meszaros, Botond, E-mail: botond.meszaros@efda.org [EFDA Power Plant Physics and Technology, Garching (Germany); Bachmann, Christian [EFDA Power Plant Physics and Technology, Garching (Germany); Kemp, Richard [CCFE, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Federici, Gianfranco [EFDA Power Plant Physics and Technology, Garching (Germany)

    2015-10-15

    Highlights: • The definition of the DEMO 2D geometry has been introduced. • A methodology to derive the DEMO radial and vertical builds from the PROCESS systems code results has been defined. • Other 2D and 3D geometrical assumptions required to create a sensible 3D configuration model of DEMO have been defined. - Abstract: This paper describes the methodology that has been developed and applied to derive the principal geometry of the main DEMO tokamak systems, in particular the radial and vertical cross section based on the systems code output parameters, while exact parameters are described elsewhere [1]. This procedure reviews the analysis of the radial and vertical build provided by the system code to verify critical integration interfaces, e.g. missing or too large gaps and/or insufficient thickness of components, and updates these dimensions based on results of more detailed analyses (e.g. neutronics, plasma scenario modelling, etc.) that were carried out outside of the system code in the past years. As well as providing a 3D configuration model of the DEMO tokamak for integrated engineering analysis, the results can also be used to refine the systems code model. This method, subject to continuous refinement, controls the derivation of the main machine parameters and ensures their coherence vis-à-vis a number of agreed controlled physics and engineering assumptions.

  8. Neutronic analyses of design issues affecting the tritium breeding performance in different DEMO blanket concepts

    Energy Technology Data Exchange (ETDEWEB)

    Pereslavtsev, Pavel, E-mail: pavel.pereslavtsev@kit.edu [Karlsruhe Institute for Technology, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Bachmann, Christian [EUROfusion – Programme Management Unit, Boltzmannstrasse 2, 85748 Garching (Germany); Fischer, Ulrich [Karlsruhe Institute for Technology, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany)

    2016-11-01

    Highlights: • Realistic 3D MCNP model based on the CAD engineering model of DEMO. • Automated procedure for the generation and arrangement of the blanket modules for different DEMO concepts: HCPB, HCLL, WCLL, DCLL. • Several parameters affecting tritium breeding ratio (TBR) were investigated. • A set of practical guidelines was prepared for the designers developing the individual breeding blanket concepts. - Abstract: Neutronic analyses were performed to assess systematically the tritium breeding ratio (TBR) variations in the DEMO for the different blanket concepts HCPB, HCLL, WCLL and DCLL DEMOs due to modifications of the blanket configurations. A dedicated automated procedure was developed to fill the breeding modules in the common generic model in correspondence to the different concepts. The TBR calculations were carried out using the MCNP5 Monte Carlo code. The following parameters affecting the global TBR were investigated: TBR poloidal distribution, radial breeder zone depth, {sup 6}Li enrichment, steel content in the breeder modules, poloidal segmentation of the breeder blanket volume, size of gaps between blankets, thickness of the first wall and of the tungsten armour. Based on the results a set of practical guidelines was prepared for the designers developing the individual breeding blanket concepts with the goal to achieve the required tritium breeding performance in DEMO.

  9. Design concept of K-DEMO for near-term implementation

    Science.gov (United States)

    Kim, K.; Im, K.; Kim, H. C.; Oh, S.; Park, J. S.; Kwon, S.; Lee, Y. S.; Yeom, J. H.; Lee, C.; Lee, G.-S.; Neilson, G.; Kessel, C.; Brown, T.; Titus, P.; Mikkelsen, D.; Zhai, Y.

    2015-05-01

    A Korean fusion energy development promotion law (FEDPL) was enacted in 2007. As a following step, a conceptual design study for a steady-state Korean fusion demonstration reactor (K-DEMO) was initiated in 2012. After the thorough 0D system analysis, the parameters of the main machine characterized by the major and minor radii of 6.8 and 2.1 m, respectively, were chosen for further study. The analyses of heating and current drives were performed for the development of the plasma operation scenarios. Preliminary results on lower hybrid and neutral beam current drive are included herein. A high performance Nb3Sn-based superconducting conductor is adopted, providing a peak magnetic field approaching 16 T with the magnetic field at the plasma centre above 7 T. Pressurized water is the prominent choice for the main coolant of K-DEMO when the balance of plant development details is considered. The blanket system adopts a ceramic pebble type breeder. Considering plasma performance, a double-null divertor is the reference configuration choice of K-DEMO. For a high availability operation, K-DEMO incorporates a design with vertical maintenance. A design concept for K-DEMO is presented together with the preliminary design parameters.

  10. Proposal of the confinement strategy of radioactive and hazardous materials for the European DEMO

    Science.gov (United States)

    Jin, X. Z.; Carloni, D.; Stieglitz, R.; Ciattaglia, S.; Johnston, J.; Taylor, N.

    2017-04-01

    Confinement of radioactive and hazardous materials is one of the fundamental safety functions in a nuclear fusion facility, which has to limit the mobilisation and dispersion of sources and hazards during normal, abnormal and accidental situations. In a first step energy sources and radioactive source have been assessed for a conceptual DEMO configuration. The confinement study for the European DEMO has been investigated for the main systems at the plant breakdown structure (PBS) level 1 taking a bottom-up approach. Based on the identification of the systems possessing a confinement function, a confinement strategy has been proposed, in which DEMO confinement systems and barriers have been defined. In addition, confinement for the maintenance has been issued as well. The assignment of confinement barriers to the identified sources under abnormal and accidental conditions has been performed, and the DEMO main safety systems have been proposed as well. Finally, confinement related open issues have been pointed out, which need to be resolved in parallel with DEMO development.

  11. Tritium Cycle Design for He-cooled Blankets for Demo

    Energy Technology Data Exchange (ETDEWEB)

    Sedano, L. A.

    2007-09-27

    Final goal of COMPU task is to develop a reliable tritium Process Flow Diagram (PFD) modelling tool for DEMO tritium cycle. With this aim, the COMPU task is devoted to: (1) Review of existing available documentation related on configuration layouts, and systems and tritium control process key technologies. (2) To select those validated and considered relevant as basis for code development. (3) Implement results from (1), and (2) in the PFD TRICICLO. This fi rst deliverable focuses on item (1) and is conceived as a managerial tool to: (1) establish and discuss the correct inputs, (2) to identify existing lack of basic information and (3) to establish the general demands and characteristics for the development of an advanced PFD model. Thus, in order to discuss and determine the basic information required for future new developments of the task, this report presents a review of the documentation of: (1) The outline of total cycle and system configuration with the main tritium system design specifications. (2) The ultimate processing technologies with the associated design of their implementing units. (3) Key parameters needed to describe processes and modes of operation of the system units. (4) An overview of the existing models for cycle and units with a general analysis of their performances and limitations. Thus, this report is a direct review of the base information generated previously in the context of tasks of the EU FT Programmers (reported in EFDA Green Books) and available results in open fields literature provided by parallel Programmes abroad (JP, US, RF). (Author) 102 refs.

  12. Remote handling assessment of attachment concepts for DEMO blanket segments

    Energy Technology Data Exchange (ETDEWEB)

    Iglesias, Daniel, E-mail: daniel.iglesias@ccfe.ac.uk [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Bastow, Roger; Cooper, Dave; Crowe, Robert; Middleton-Gear, Dave [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Sibois, Romain [VTT, Technical Research Centre of Finland, Industrial Systems, ROViR, Tampere (Finland); Carloni, Dario [Institute of Neutron Physics and Reactor Technology, Karlsruhe Institute of Technology (KIT) (Germany); Vizvary, Zsolt; Crofts, Oliver [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Harman, Jon [EFDA Close Support Unit Garching, Boltzmannstaße 2, D-85748 Garching bei München (Germany); Loving, Antony [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom)

    2015-10-15

    Highlights: • Challenges are identified for the remote handling of blanket segments’ attachments. • Two attachment design approaches are assessed for remote handling (RH) feasibility. • An alternative is proposed, which potentially simplifies and speeds-up RH operations. • Up to three different assemblies are proposed for the remote handling of the attachments. • Proposed integrated design of upper port is compatible with the attachment systems. - Abstract: The replacement strategy of the massive Multi-Module Blanket Segments (MMS) is a key driver in the design of several DEMO systems. These include the blankets themselves, the vacuum vessel (VV) and its ports and the Remote Maintenance System (RMS). Common challenges to any blanket attachment system have been identified, such as the need for applying a preload to the MMS manifold, the effects of the decay heat and several uncertainties related to permanent deformations when removing the blanket segments after service. The WP12 kinematics of the MMS in-vessel transportation was adapted to the requirements of each of the supports during 2013 and 2014 design activities. The RM equipment envisaged for handling attachments and earth connections may be composed of up to three different assemblies. An In-Vessel Mover at the divertor level handles the lower support and earth bonding, and could stabilize the MMS during transportation. A Shield Plug crane with a 6 DoF manipulator operates the upper attachment and earth straps. And a Vertical Maintenance Crane is responsible for the in-vessel MMS transportation and can handle the removable upper support pins. A final proposal is presented which can potentially reduce the number of required systems, at the same time that speeds-up the RMS global operations.

  13. Research at ITER towards DEMO: Specific reactor diagnostic studies to be carried out on ITER

    Energy Technology Data Exchange (ETDEWEB)

    Krasilnikov, A. V.; Kaschuck, Y. A.; Vershkov, V. A.; Petrov, A. A.; Petrov, V. G.; Tugarinov, S. N. [Institution Project center ITER, Moscow (Russian Federation)

    2014-08-21

    In ITER diagnostics will operate in the very hard radiation environment of fusion reactor. Extensive technology studies are carried out during development of the ITER diagnostics and procedures of their calibration and remote handling. Results of these studies and practical application of the developed diagnostics on ITER will provide the direct input to DEMO diagnostic development. The list of DEMO measurement requirements and diagnostics will be determined during ITER experiments on the bases of ITER plasma physics results and success of particular diagnostic application in reactor-like ITER plasma. Majority of ITER diagnostic already passed the conceptual design phase and represent the state of the art in fusion plasma diagnostic development. The number of related to DEMO results of ITER diagnostic studies such as design and prototype manufacture of: neutron and γ–ray diagnostics, neutral particle analyzers, optical spectroscopy including first mirror protection and cleaning technics, reflectometry, refractometry, tritium retention measurements etc. are discussed.

  14. Monte Carlo tools evaluation for nuclear analyses of the European DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Jaboulay, Jean-Charles, E-mail: jean-charles.jaboulay@cea.fr [CEA-Saclay, DEN, DM2S, SERMA, LPEC, F-91191 Gif-sur-Yvette (France); Damian, Frédéric [CEA-Saclay, DEN, DM2S, SERMA, LPEC, F-91191 Gif-sur-Yvette (France); Aiello, Giacomo [CEA-Saclay, DEN, DM2S, SEMT, LISN, F-91191 Gif-sur-Yvette (France); Taylor, David; Zheng, Shanliang [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Bienkowska, Barbara; Drozdowicz, Krzysztof; Tracz, Grzegorz [IPPLM, Warsaw/IFJ Krakow (Poland); Fischer, Ulrich [KIT – Karlsruhe Institute of Technology, Karlsruhe (Germany); Bachmann, Christian [EFDA – European Fusion Development Agreement, Garching (Germany)

    2015-10-15

    This paper presents the status of different Monte Carlo (MC) particle transport codes regarding their capabilities to model the European fusion power demonstration reactor (DEMO). This work was carried out, via a collaboration between CEA, CCFE, IPPLM and KIT to evaluate MC codes which could replace MCNP for nuclear analysis on DEMO. Each association has participated using a different MC code: CEA with TRIPOLI-4, CCFE with Serpent, and IPPLM with FLUKA. The common DEMO model studied has been developed by KIT with MCNP. Considerable effort was required to translate the MCNP input deck into the syntax of Serpent and FLUKA codes; so no real nuclear analysis has been performed in the frame of this work. Regarding TRIPOLI-4, a benchmark has been successfully conducted; the results obtained are statistically similar to those of MCNP with comparable computation times.

  15. Research at ITER towards DEMO: Specific reactor diagnostic studies to be carried out on ITER

    Science.gov (United States)

    Krasilnikov, A. V.; Kaschuck, Y. A.; Vershkov, V. A.; Petrov, A. A.; Petrov, V. G.; Tugarinov, S. N.

    2014-08-01

    In ITER diagnostics will operate in the very hard radiation environment of fusion reactor. Extensive technology studies are carried out during development of the ITER diagnostics and procedures of their calibration and remote handling. Results of these studies and practical application of the developed diagnostics on ITER will provide the direct input to DEMO diagnostic development. The list of DEMO measurement requirements and diagnostics will be determined during ITER experiments on the bases of ITER plasma physics results and success of particular diagnostic application in reactor-like ITER plasma. Majority of ITER diagnostic already passed the conceptual design phase and represent the state of the art in fusion plasma diagnostic development. The number of related to DEMO results of ITER diagnostic studies such as design and prototype manufacture of: neutron and γ-ray diagnostics, neutral particle analyzers, optical spectroscopy including first mirror protection and cleaning technics, reflectometry, refractometry, tritium retention measurements etc. are discussed.

  16. Conceptual design of the DEMO neutral beam injectors: main developments and R&D achievements

    Science.gov (United States)

    Sonato, P.; Agostinetti, P.; Bolzonella, T.; Cismondi, F.; Fantz, U.; Fassina, A.; Franke, T.; Furno, I.; Hopf, C.; Jenkins, I.; Sartori, E.; Tran, M. Q.; Varje, J.; Vincenzi, P.; Zanotto, L.

    2017-05-01

    The objectives of the nuclear fusion power plant DEMO, to be built after the ITER experimental reactor, are usually understood to lie somewhere between those of ITER and a ‘first of a kind’ commercial plant. Hence, in DEMO the issues related to efficiency and RAMI (reliability, availability, maintainability and inspectability) are among the most important drivers for the design, as the cost of the electricity produced by this power plant will strongly depend on these aspects. In the framework of the EUROfusion Work Package Heating and Current Drive within the Power Plant Physics and Development activities, a conceptual design of the neutral beam injector (NBI) for the DEMO fusion reactor has been developed by Consorzio RFX in collaboration with other European research institutes. In order to improve efficiency and RAMI aspects, several innovative solutions have been introduced in comparison to the ITER NBI, mainly regarding the beam source, neutralizer and vacuum pumping systems.

  17. Progress in the RAMI analysis of a conceptual LHCD system for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Mirizzi, F. [Associazione EURATOM-ENEA sulla Fusione, Consorzio CREATE, Università degli Studi di Napoli Federico II, Via Claudio 21, 80125, Napoli (Italy)

    2014-02-12

    Reliability, Availability, Maintainability and Inspectability (RAMI) concepts and techniques, that acquired great importance during the first manned space missions, have been progressively extended to industrial, scientific and consumer equipments to assure them satisfactory performances and lifetimes. In the design of experimental facilities, like tokamaks, mainly aimed at demonstrating validity and feasibility of scientific theories, RAMI analysis has been often left aside. DEMO, the future prototype fusion reactors, will be instead designed for steadily delivering electrical energy to commercial grids, so that the RAMI aspects will assume an absolute relevance since their initial design phases. A preliminary RAMI analysis of the LHCD system for the conceptual EU DEMO reactor is given in the paper.

  18. Progress in the RAMI analysis of a conceptual LHCD system for DEMO

    Science.gov (United States)

    Mirizzi, F.

    2014-02-01

    Reliability, Availability, Maintainability and Inspectability (RAMI) concepts and techniques, that acquired great importance during the first manned space missions, have been progressively extended to industrial, scientific and consumer equipments to assure them satisfactory performances and lifetimes. In the design of experimental facilities, like tokamaks, mainly aimed at demonstrating validity and feasibility of scientific theories, RAMI analysis has been often left aside. DEMO, the future prototype fusion reactors, will be instead designed for steadily delivering electrical energy to commercial grids, so that the RAMI aspects will assume an absolute relevance since their initial design phases. A preliminary RAMI analysis of the LHCD system for the conceptual EU DEMO reactor is given in the paper.

  19. Breeding blanket design for ITER and prototype (DEMO) fusion reactors and breeding materials issues

    Energy Technology Data Exchange (ETDEWEB)

    Takatsu, H.; Enoeda, M. [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1998-03-01

    Current status of the designs of the ITER breeding blanket and DEMO blankets is introduced placing emphasis on the breeding materials selection and related issues. The former design is based on the up-to-date design activities, as of October 1997, being performed jointly by Joint Central Team (JCT) and Home Teams (HT`s), while the latter is based on the DEMO blanket test module designs being proposed by each Party at the TBWG (Test Blanket Working Group) meetings. (J.P.N.)

  20. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  1. Overview of progress on the European DEMO remote maintenance strategy

    Energy Technology Data Exchange (ETDEWEB)

    Crofts, Oliver, E-mail: oliver.crofts@ccfe.ac.uk [RACE/UKAEA, Culham Science Centre, Abingdon OX14 3DB, Oxon (United Kingdom); Loving, Antony; Iglesias, Daniel [RACE/UKAEA, Culham Science Centre, Abingdon OX14 3DB, Oxon (United Kingdom); Coleman, Matti [EUROfusion Consortium, PPP& T Department, Boltzmannstraße 2, 85748 Garching (Germany); Siuko, Mikko [VTT Technical Research Centre of Finland, PO Box 1000, FI-02044 VTT, Espoo (Finland); Mittwollen, Martin [KIT Institut für Fördertechnik und Logistiksysteme, Gotthard-Franz-Straße 8, Geb.50.38, 76131 Karlsruhe (Germany); Queral, Vicente [CIEMAT Laboratorio Nacional de Fusión, Edif. 66, Avenida Complutense 40, 28040 Madrid (Spain); Vale, Alberto [IST, Instituto Superior Técnico, Av. Rovisco Pais 1, 1049-001 Lisboa (Portugal); Villedieu, Eric [CEA, IRFM, 13108 St Paul lez Durance (France)

    2016-11-01

    Highlights: • The remote maintenance strategy is applicable to the range of tokamak and component options currently under consideration in Europe • The remote maintenance development work is concentrating on the application and limits of the immature technologies that pose the greatest risk to the feasibility of the maintenance strategy • Position control during the handling of the in-vessel components is one of the areas of high risk and a system is being developed and will be tested prior to concept design to demonstrate the feasibility and capability of a system capable of real time incorporation of changing kinematic data provided by a structural simulator running in parallel • In-vessel recovery and rescue and the pipe joining technology form two more of the high risk areas where developments are being concentrated - Abstract: The EU-DEMO remote maintenance strategy must be relevant for a range of in-vessel component design options. The remote maintenance project must provide an understanding of the limits of the strategy and technologies so as to inform the developing plant design of the maintenance constraints. A comprehensive set of maintenance requirements has been produced, in conjunction with the plant designers, against which design options can be assessed. The proposed maintenance solutions are based around a strategy that deploys casks above each of the vertical ports to exchange the blanket segments and at each of the divertor ports to exchange the divertor cassettes. The casks deploy remote handling equipment to open and close the vacuum vessel, remove and re-install pipework, and replace the in-vessel components. A technical design risk assessment has shown that the largest risks are common to all of the proposed solutions and that they are associated with two key issues, first; the ability to handle the large blanket and divertor components to the required positional accuracy with limited viewing and position feedback, and second; to

  2. Assessment of ex-vessel transportation in remote maintenance systems of DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Vale, Alberto, E-mail: avale@ipfn.tecnico.ulisboa.pt

    2015-10-15

    Highlights: • Design of the ex-vessel transport in DEMO inspired on the model of ITER, with the upgrades: –A single typology of trolley with a lift system. –The trolley is a squared and symmetric vehicle that moves in any direction. –The trolley moves beneath the palette in the front/rear or sideways. –Reduced space for moving the trolley, improving the safety, rescue and recovery. • Design of the trolley, which is the part of the ex-vessel transport that provides the motion capabilities. The main features of the trolley are: rhombic kinematic configuration (moving in any direction with any orientation), squared and symmetric shape, four lift systems (to lift off the pallet), integrated sensor system, batteries and docking recharge system. - Abstract: DEMO is a proposed nuclear fusion power plant intended to demonstrate the generation of electrical power and to build upon the expected success of the ITER experimental nuclear fusion reactor. The remote maintenance system is provided to perform the remote maintenance of DEMO components. The ex-vessel transportation is one of the top level maintenance functions. This paper describes a proposal for the ex-vessel transfer cask in DEMO, taking into account the best outcomes achieved with the design used in ITER, but with upgrades in some features. In particular with the inclusion of a trolley, which provides the motion capabilities. The design of the trolley is also presented in the paper. The main conclusions are reported including the open issues.

  3. Overview of physics results from MAST towards ITER/DEMO and the MAST Upgrade

    DEFF Research Database (Denmark)

    Meyer, H.; Abel, I.G.; Akers, R.J.

    2013-01-01

    New diagnostic, modelling and plant capability on the Mega Ampère Spherical Tokamak (MAST) have delivered important results in key areas for ITER/DEMO and the upcoming MAST Upgrade, a step towards future ST devices on the path to fusion currently under procurement. Micro-stability analysis of the...

  4. Comparison over the nuclear analysis of the HCLL blanket for the European DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Jaboulay, Jean-Charles, E-mail: jean-charles.jaboulay@cea.fr [CEA-Saclay, DEN, DM2S, F-91191 Gif-sur-Yvette (France); Aiello, Giacomo; Aubert, Julien [CEA-Saclay, DEN, DM2S, F-91191 Gif-sur-Yvette (France); Villari, Rosaria [ENEA, UTFUS-TECN, Via E. Fermi 4, 00044 Frascati, Rome (Italy); Fischer, Ulrich [Karlsruhe Institute of Technology, 76344 Eggenstein-Leopoldshafen, Karlsruhe (Germany)

    2016-11-01

    Highlights: • A complete nuclear analysis of the DEMO HCLL has been carried out at CEA with the TRIPOLI-4{sup ®} Monte Carlo code. • The DEMO tokamak model was generated by the CAD import tool McCad. • The HCLL blankets were implemented using a previous MCNP model developed at ENEA. • A good agreement is observed between the results obtained at CEA with TRIPOLI-4 and JEFF-3.1.1 and whose obtained at ENEA with MCNP and FENDL-2.1. - Abstract: This paper presents the comparison over the nuclear analysis of the European DEMO with HCLL blanket carried out with the TRIPOLI-4{sup ®} Monte Carlo code and the JEFF-3.1.1 nuclear data library and with the MCNP5 Monte Carlo code and the FENDL-2.1 nuclear data library. The MCNP5 analysis was conducted firstly by ENEA with a detailed 3D model describing all the HCLL blanket internal structures. This MCNP5 model was converted into TRIPOLI-4{sup ®} representation for performing the nuclear analysis at CEA with the objective to demonstrate consistency between both analyses. A very good agreement was obtained for all of the relevant nuclear responses (neutron wall loading, tritium breeding ratio, nuclear heating, neutron flux distribution, etc.), validating CEA’s nuclear analysis approach, based on TRIPOLI-4{sup ®} Monte Carlo code and JEFF-3.1.1 nuclear data library, for the European DEMO.

  5. An analysis of AMTEC, multi-cell ground-demo for the Pluto/Express mission

    Energy Technology Data Exchange (ETDEWEB)

    Tournier, J.M.; El-Genk, M.S.

    1998-07-01

    Results of recent tests of an 8-cell, AMTEC ground-demo are analyzed and the performance of individual cells compared. The ground-demo produced a peak electric power of 27 W{sub e} at an output voltage of 16 V, when tested at hot and cold side temperatures of 1123 K and 553 K. The electric power output and terminal voltage of the individual cells, however, differed by as much as 25%, from 2.94 to 3.76 W{sub e}, and 1.73 to 2.21 V, respectively. These variations were attributed to differences in: (a) contact resistance between electrode / BASE / current collector; (b) current (or electrons) leakage between anode and cathode electrodes through the metal-ceramic braze joint between BASE tubes and support plate; and (c) the charge-exchange polarization losses. Model's predictions compared very well with measured voltage and electric power output of individual cells and of the ground-demo. At the operating conditions for the Pluto/Express spacecraft (T{sub hot} {approximately} 1200 K, T{sub cd} {approximately} 573 K), the best performing ground-demo cell would have delivered 5 W{sub e} at an output voltage of 3 V. These values, however, are still significantly lower than those needed to meet the Pluto/Express mission power requirements (8.2 W{sub e} at 3.5 V, per cell).

  6. Divertor remote handling for DEMO: Concept design and preliminary FMECA studies

    Energy Technology Data Exchange (ETDEWEB)

    Carfora, D., E-mail: dario.carfora@gmail.com [VTT Technical Research Centre of Finland, P.O. Box 1300, FI-33101 Tampere (Finland); Tampere University of Technology, Korkeakoulunkatu 6, 33720 Tampere (Finland); ENEA/CREATE/Università degli studi Napoli Federico II, 80125 Napoli (Italy); Di Gironimo, G. [ENEA/CREATE/Università degli studi Napoli Federico II, 80125 Napoli (Italy); Järvenpää, J. [VTT Technical Research Centre of Finland, P.O. Box 1300, FI-33101 Tampere (Finland); Huhtala, K. [Tampere University of Technology, Korkeakoulunkatu 6, 33720 Tampere (Finland); Määttä, T.; Siuko, M. [VTT Technical Research Centre of Finland, P.O. Box 1300, FI-33101 Tampere (Finland)

    2015-10-15

    Highlights: • Concept design of the RH system for the DEMO fusion power plant. • Divertor mover: hydraulic telescopic boom concept design. • An alternative solution to ITER rack and pinion divertor mover (CMM). • Divertor cassettes end effector studies. • FMECA studies started on the DEMO divertor mover. - Abstract: The paper describes a concept design of a remote handling (RH) system for replacing divertor cassettes and cooling pipes in future DEMO fusion power plant. In DEMO reactor design important considerations are the reactor availability and reliable maintenance operations. The proposed divertor mover is a hydraulic telescopic boom driven from the transportation cask through the maintenance tunnel of the reactor. The boom is divided in three sections and it is driving an end-effector in order to perform the scheduled operations of maintenance inside the vacuum vessel. Two alternative designs of the end effector to grip and manipulate the divertor cassette are presented in this work. Both concepts are hydraulically actuated, based on ITER previous studies. The divertor cassette end-effector consists of a lifting arm linked to the divertor mover, a tilting plate, a cantilever arm and a hook-plate. Taking advantage of the ITER RH background and experience, the proposed hydraulic RH system is compared with the rack and pinion system currently designed for ITER and is an object of simulations at Divertor Test Platform (DTP2) in VTT's Labs of Tampere, Finland. Pros and cons will be put in evidence.

  7. Overview of physics results from MAST towards ITER/DEMO and the MAST Upgrade

    NARCIS (Netherlands)

    Meyer, H.; Abel, I. G.; Akers, R. J.; Allan, A.; Allan, S. Y.; Appel, L. C.; Asunta, O.; Barnes, M.; Barratt, N. C.; N. Ben Ayed,; Bradley, J. W.; Canik, J.; Cahyna, P.; Cecconello, M.; Challis, C. D.; Chapman, I.T.; Ciric, D.; Colyer, G.; Conway, N. J.; Cox, M.; Crowley, B. J.; Cowley, S. C.; Cunningham, G.; Danilov, A.; Darke, A.; de Bock, M. F. M.; De Temmerman, G.; Dendy, R. O.; Denner, P.; Dickinson, D.; Dnestrovskij, A. Y.; Dnestrovsky, Y.; Driscoll, M. D.; Dudson, B.; Dunai, D.; Dunstan, M.; Dura, P.; Elmore, S.; Field, A. R.; Fishpool, G.; Freethy, S.; Fundamenski, W.; Garzotti, L.; Ghim, Y. C.; Gibson, K. J.; Gryaznevich, M. P.; Harrison, J.; E. Havlíčková,; Hawkes, N. C.; Heidbrink, W. W.; Hender, T. C.; Highcock, E.; Higgins, D.; Hill, P.; Hnat, B.; Hole, M. J.; J. Horáček,; Howell, D. F.; Imada, K.; Jones, O.; Kaveeva, E.; Keeling, D.; Kirk, A.; M. Kočan,; Lake, R. J.; Lehnen, M.; Leggate, H. J.; Liang, Y.; Lilley, M. K.; Lisgo, S. W.; Liu, Y. Q.; Lloyd, B.; Maddison, G. P.; Mailloux, J.; Martin, R.; McArdle, G. J.; McClements, K. G.; McMillan, B.; Michael, C.; Militello, F.; Molchanov, P.; Mordijck, S.; Morgan, T.; Morris, A. W.; Muir, D. G.; Nardon, E.; Naulin, V.; Naylor, G.; Nielsen, A. H.; O' Brien, M. R.; O' Gorman, T.; Pamela, S.; Parra, F. I.; Patel, A.; Pinches, S. D.; Price, M. N.; Roach, C. M.; Robinson, J. R.; Romanelli, M.; Rozhansky, V.; Saarelma, S.; Sangaroon, S.; Saveliev, A.; Scannell, R.; Seidl, J.; Sharapov, S. E.; Schekochihin, A. A.; Shevchenko, V.; Shibaev, S.; Stork, D.; Storrs, J.; Sykes, A.; Tallents, G. J.; Tamain, P.; Taylor, D.; Temple, D.; Thomas-Davies, N.; Thornton, A.; Turnyanskiy, M. R.; M. Valovič,; Vann, R. G. L.; Verwichte, E.; Voskoboynikov, P.; Voss, G.; Warder, S. E. V.; Wilson, H. R.; Wodniak, I.; Zoletnik, S.; Zagorski, R.; MAST Team,; NBI Team,

    2013-01-01

    New diagnostic, modelling and plant capability on the Mega Ampère Spherical Tokamak (MAST) have delivered important results in key areas for ITER/DEMO and the upcoming MAST Upgrade, a step towards future ST devices on the path to fusion currently under procurement. Micro-stability analysis of the pe

  8. Overview of Progress on the EU DEMO Reactor Magnet System Design

    NARCIS (Netherlands)

    Zani, L.; Bayer, C.; biancolini, M.E.; Bonifetto, R.; Nijhuis, Arend; Yagotintsev, K.

    2016-01-01

    The DEMO reactor is expected to be the first application of fusion for electricity generation in the near future. To this aim, conceptual design activities are progressing in Europe (EU) under the lead of the EUROfusion Consortium in order to drive on the development of the major tokamak systems. In

  9. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  10. Updated conceptual design of helium cooling ceramic blanket for HCCB-DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Suhao [University of Science and Technology of China, Hefei, Anhui (China); Southwestern Institute of Physics, Chengdu, Sichuan (China); Cao, Qixiang; Wu, Xinghua; Wang, Xiaoyu; Zhang, Guoshu [Southwestern Institute of Physics, Chengdu, Sichuan (China); Feng, Kaiming, E-mail: fengkm@swip.ac.cn [Southwestern Institute of Physics, Chengdu, Sichuan (China)

    2016-11-15

    Highlights: • An updated design of Helium Cooled Ceramic breeder Blanket (HCCB) for HCCB-DEMO is proposed in this paper. • The Breeder Unit is transformed to TBM-like sub-modules, with double “banana” shape tritium breeder. Each sub-module is inserted in space formed by Stiffen Grids (SGs). • The performance analysis is performed based on the R&D development of material, fabrication technology and safety assessment in CN ITER TBM program. • Hot spots will be located at the FW bend side. - Abstract: The basic definition of the HCCB-DEMO plant and preliminary blanket designed by Southwestern Institution of Physics was proposed in 2009. The DEMO fusion power is 2550 MW and electric power is 800 MW. Based on development of R&D in breeding blanket, a conceptual design of helium cooled blanket with ceramic breeder in HCCB-DEMO was presented. The main design features of the HCCB-DEMO blanket were: (1) CLF-1 structure materials, Be multiplier and Li{sub 4}SiO{sub 4} breeder; (2) neutronic wall load is 2.3 MW/m{sup 2} and surface heat flux is 0.43 MW/m{sup 2} (2) TBR ≈ 1.15; (3) geometry of breeding units is ITER TBM-like segmentation; (4)Pressure of helium is 8 MPa and inlet/outlet temperature is 300/500 °C. On the basis of these design, some important analytical results are presented in aspects of (i) neutronic behavior of the blanket; (ii) design of 3D structure and thermal-hydraulic lay-out for breeding blanket module; (iii) structural-mechanical behavior of the blanket under pressurization. All of these assessments proved current stucture fulfill the design requirements.

  11. The three-dimensional easy morphological (3-DEMO classification of scoliosis, part II: repeatability

    Directory of Open Access Journals (Sweden)

    Negrini Stefano

    2006-12-01

    Full Text Available Abstract Background In the first part of this study we proposed a new classification approach for spinal deformities (3-DEMO. To be valid, a classification needs to overcome the repeatability issue which is inherent both in the used classificatory system and in the measured object. Aim The aim of this study is to present procedures and results obtained within the repeatability of 3-DEMO classification for scoliosis analysis. Method We acquired the data of 100 pathological and 20 normal spines with an optoelectronic system (AUSCAN and of two dummies with simulated spine deformity. On the obtained 3D reconstruction of the spine, we considered the coronal view with a spinal reference system (Top View and its three related parameters, defined in part I, constituting the 3-DEMO classification. We calculated the repeatability coefficient for the subjects (two acquisitions for each subject with a time interval of 26 ± 12 sec, whereas we evaluated the system measurement error calculating the standard deviation of 50 consecutive acquisitions for each dummy. Results Comparing the results of the two types of acquisition, it emerged that the main part of parameters variability was due to postural adjustments The proportion of agreement for the 3-DEMO parameters gives a k value above 0.8; almost 10% of patients changed classification because of postural adjustments, but none had a "mirror-like" variation nor a change in more of one parameter at a time Repeatability coefficient is lower than the previously calculated normative limits. Discussion The 3-DEMO classification has a high repeatability when evaluated with an optoelectronic system such as the AUSCAN System, whose systematic error is very low. This means that the implied physiological phenomenon is consistent and overcomes the postural variability inherent in the measured object (normal or pathological subject.

  12. Design of the helium cooled lithium lead breeding blanket in CEA: from TBM to DEMO

    Science.gov (United States)

    Aiello, G.; Aubert, J.; Forest, L.; Jaboulay, J.-C.; Li Puma, A.; Boccaccini, L. V.

    2017-04-01

    The helium cooled lithium lead (HCLL) blanket concept was originally developed in CEA at the beginning of 2000: it is one of the two European blanket concepts to be tested in ITER in the form of a test blanket module (TBM) and one of the four blanket concepts currently being considered for the DEMOnstration reactor that will follow ITER. The TBM is a highly optimized component for the ITER environment that will provide crucial information for the development of the DEMO blanket, but its design needs to be adapted to the DEMO reactor. With respect to the TBM design, reduction of the steel content in the breeding zone (BZ) is sought in order to maximize tritium breeding reactions. Different options are being studied, with the potential of reaching tritium breeding ratio (TBR) values up to 1.21. At the same time, the design of the back supporting structure (BSS), which is a DEMO specific component that has to support the blanket modules inside the vacuum vessel (VV), is ongoing with the aim of maximizing the shielding power and minimizing pumping power. This implies a re-engineering of the modules’ attachment system. Design changes however, will have an impact on the manufacturing and assembly sequences that are being developed for the HCLL-TBM. Due to the differences in joint configurations, thicknesses to be welded, heat dissipation and the various technical constraints related to the accessibility of the welding tools and implementation of non-destructive examination (NDE), the manufacturing procedure should be adapted and optimized for DEMO design. Laser welding instead of TIG could be an option to reduce distortions. The time-of-flight diffraction (TOFD) technique is being investigated for NDE. Finally, essential information expected from the HCLL-TBM program that will be needed to finalize the DEMO design is discussed.

  13. Use of the Research Vessel Savannah in Support of 2015 ONR S and T Demo, Project ID: 104458

    Science.gov (United States)

    2016-07-26

    2015 ONR S& T Demo. Project ID: 104458 Sb. GRANT NUMBER N00014-15-1-2116 Sc. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Sd. PROJECT NUMBER Sanders...Std Z39. 18 Use of the resea rch vessel Savannah in support of 2015 ONR S& T Demo, Project ID: 104458 James G. Sanders and John B. B ichy The...following project: 1. 2015 ONR S & T Demo- Demonstrating mine warfare and airborne projects at Naval Air Station Patuxent River, Md., Dr. Robert Gibson

  14. Diseño acústico y electroacústico de Waipahu Transit Center en Honolulú, Hawái

    OpenAIRE

    Sierra Carballo, Christian

    2014-01-01

    El objetivo de este Proyecto Fin de Grado es el diseño de megafonía y PAGA (Public Address /General Alarm) de la estación de tren Waipahu Transit Center en la ciudad de Honolulú, Hawái. Esta estación forma parte de una nueva línea de tren que está en proceso de construcción actualmente llamada Honolulu Rail Transit. Inicialmente la línea de tren constará de 21 estaciones, en las que prácticamente todas están diseñadas como pasos elevados usando como referencia las autopistas que cruzan la isl...

  15. The RAFMS RUSFER-EK-181 as structural material for the test module DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Leonteva-Smirnova, M.V.; Chernov, V.M.; Ioltukhovsky, A.G.; Mozhanov, E.M. [Bochvar Institute of Inorganic Materials, Moscow (Russian Federation); Potapenko, M.M. [Tomsk State Univ., Institute of Strength Physics and Materials Science, SB, RAS (Russian Federation); Bulanova, T.M.; Golovanov, N. [Research Institute for Atomic Reactors, Dimitrovgrad (Russian Federation); Strebkov, Y.S. [Research and Development Institute of Power Engineering (RDIPE), Moscow (Russian Federation); Kalashnikov, A.N. [Rosatom, Moscow (Russian Federation); Kuteev, B.V. [Russian Science Center, Moscow (Russian Federation)

    2007-07-01

    Full text of publication follows: In the framework of the RF R and D activity for fusion power energy mastering and manufacturing of the test ceramic module DEMO, reduced activation ferritic-martensitic steel (RAFMS) based on Fe-12Cr-2W-V-Ta-B system (RUSFER-EK-181) is obtained. Industrial ingots of RUSFER-EK-181 steel and its modifications, articles of which (plates, rods, tube stocks, others) posses the necessary complex of physical, mechanical (short-term and long-term) and technological (welding) characteristics in a wide temperature range, have been manufactured. The factor determining high heat resistance of the steel is its structural-phase state and precipitation hardening regulated by the chemical composition and the developed regimes of thermo-mechanical treatments of the steel. Structural-phase state of the steel provides the required level of the operating characteristic of goods under the established regimes of radiation and temperature loads. Good results of heat resistance tests of the steel under the stress 80 MPa at 650 deg. C during 25000 hours have been obtained. The technologies of welding of the articles have been developed, examples of argon-arc welding joints and their structural states are given. The results on the effect of different regimes of heat treatment on the radiation properties of RUSFER-EK-181 at low irradiation temperature (fast reactor BOR-60) have been obtained. The gradient structural-phase state changing along the length of the steel article has been suggested. High level of heat resistance in the high temperature application zone of the articles is developed with use of the traditional heat treatment for ferritic-martensitic steels (normalization and tempering). New combined heat treatment including additional heat cycling of the steel near its critical point is applied for the low temperature part of the article. The structure obtained by the combined heat treatment of the steel provides higher level of its resistance to

  16. Status on DEMO Helium Cooled Lithium Lead breeding blanket thermo-mechanical analyses

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, J., E-mail: julien.aubert@cea.fr [CEA-Saclay, DEN, DM2S, F-91191 Gif-sur-Yvette (France); Aiello, G.; Jaboulay, J.-C. [CEA-Saclay, DEN, DM2S, F-91191 Gif-sur-Yvette (France); Kiss, B. [Institute of Nuclear Techniques, Budapest University of Technology and Economics, Budapest (Hungary); Morin, A. [CEA-Saclay, DEN, DM2S, F-91191 Gif-sur-Yvette (France)

    2016-11-01

    Highlights: • CEA with the support of Wigner-RCP and IPP-CR, is in charge of the design of the HCLL blanket for DEMO. The DEMO HCLL breeding blanket design capitalizes on the experience acquired on the HCLL Test Blanket Module designed for ITER. Design improvements are being implemented to adapt the design to DEMO specifications and performance objectives. • Thermal and mechanical analyses have been carried out in order to justify the design of the HCLL breeding blanket showing promising results for tie rods modules’ attachments system and relatively good behavior of the box in case of LOCA when comparing to RCC-MRx criteria. • CFD thermal analyses on generic breeding unit have enabled the consolidation of the results obtained with previous FEM design analyses. - Abstract: The EUROfusion Consortium develops a design of a fusion power demonstrator (DEMO) in the framework of the European “Horizon 2020” innovation and research program. One of the key components in the fusion reactor is the breeding blanket surrounding the plasma, ensuring tritium self-sufficiency, heat removal for conversion into electricity, and neutron shielding. The Helium Cooled Lithium Lead (HCLL) blanket is one of the concepts which is investigated for DEMO. It is made of a Eurofer structure and uses the eutectic liquid lithium–lead as tritium breeder and neutron multiplier, and helium gas as coolant. Within the EUROfusion organization, CEA with the support of Wigner-RCP and IPP-CR, is in charge of the design of the HCLL blanket for DEMO. This paper presents the status of the thermal and mechanical analyses carried out on the HCLL breeding blanket in order to justify the design. CFD thermal analyses on generic breeding unit including stiffening plates and cooling plates have been performed with ANSYS in order to consolidate results obtained with previous FEM design analyses. Moreover in order to expand the justification of the HCLL Breeding blanket design, the most loaded area of

  17. DEVELOPMENT AND ASSESSMENT OF A SCORE™ DEMO2.1 THERMO-ACOUSTIC ENGINE

    Directory of Open Access Journals (Sweden)

    BAIMAN CHEN

    2013-04-01

    Full Text Available The early low-cost, wood burning Thermo-Acoustic Engine (TAE known as Demo2.0-build-1 was developed by SCORE™ at the UK Centre and was capable of achieving 22.7 Watts of electricity. This prototype was limited to an operating temperature of about 300oC and due to excessive leaks could not operate continuously above ambient pressure. To absorb a thermal heat input of 4.4 kW from the burning wood so as to fulfil the required acoustic power, the Hot Heat Exchanger (HHX requires heating to the highest possible temperature. Therefore, a corrugated stainless steel plate HHX design that maximises heating surface area was adopted to the current Demo2 TAE design. In addition, the system is often pressurised to achieve higher acoustic intensity. Rigorous sealing of the system at high temperature is also required. A Demo2.1 TAE design based on the Demo2 TAE design and its prototype which is developed recently by the SCORE™ Centre in Malaysia was successfully constructed and well integrated with the stove. During the early construction and assembly process, fabrication difficulties and serious leak problems around the HHX’s edges were found when the apparatus operated at high temperatures. This is because the uneven geometrical HHX (convolution profile makes it difficult and relatively costly to be sealed. The Demo2.1 TAE is focused on the sealing efficiency and effective manufacturing cost by meantime to allow further modification variation. The design was made to adopt the local manufacturing technologies and materials available or easy to access in Malaysia. It also aims to minimise the parasitic heat losses to lower the system onset temperature. By removing the Linear Alternator and Tuning Volume from the system, preliminary measurements shown that the apparatus was oscillating at the frequency of 70 Hz. A much lower onset temperature was observed at around 144oC for the new configuration when the apparatus was oscillating at approximately 200 Pa

  18. Sea Ice Detection Based on Differential Delay-Doppler Maps from UK TechDemoSat-1

    Directory of Open Access Journals (Sweden)

    Yongchao Zhu

    2017-07-01

    Full Text Available Global Navigation Satellite System (GNSS signals can be exploited to remotely sense atmosphere and land and ocean surface to retrieve a range of geophysical parameters. This paper proposes two new methods, termed as power-summation of differential Delay-Doppler Maps (PS-D and pixel-number of differential Delay-Doppler Maps (PN-D, to distinguish between sea ice and sea water using differential Delay-Doppler Maps (dDDMs. PS-D and PN-D make use of power-summation and pixel-number of dDDMs, respectively, to measure the degree of difference between two DDMs so as to determine the transition state (water-water, water-ice, ice-ice and ice-water and hence ice and water are detected. Moreover, an adaptive incoherent averaging of DDMs is employed to improve the computational efficiency. A large number of DDMs recorded by UK TechDemoSat-1 (TDS-1 over the Arctic region are used to test the proposed sea ice detection methods. Through evaluating against ground-truth measurements from the Ocean Sea Ice SAF, the proposed PS-D and PN-D methods achieve a probability of detection of 99.72% and 99.69% respectively, while the probability of false detection is 0.28% and 0.31% respectively.

  19. Sea Ice Detection Based on Differential Delay-Doppler Maps from UK TechDemoSat-1.

    Science.gov (United States)

    Zhu, Yongchao; Yu, Kegen; Zou, Jingui; Wickert, Jens

    2017-07-12

    Global Navigation Satellite System (GNSS) signals can be exploited to remotely sense atmosphere and land and ocean surface to retrieve a range of geophysical parameters. This paper proposes two new methods, termed as power-summation of differential Delay-Doppler Maps (PS-D) and pixel-number of differential Delay-Doppler Maps (PN-D), to distinguish between sea ice and sea water using differential Delay-Doppler Maps (dDDMs). PS-D and PN-D make use of power-summation and pixel-number of dDDMs, respectively, to measure the degree of difference between two DDMs so as to determine the transition state (water-water, water-ice, ice-ice and ice-water) and hence ice and water are detected. Moreover, an adaptive incoherent averaging of DDMs is employed to improve the computational efficiency. A large number of DDMs recorded by UK TechDemoSat-1 (TDS-1) over the Arctic region are used to test the proposed sea ice detection methods. Through evaluating against ground-truth measurements from the Ocean Sea Ice SAF, the proposed PS-D and PN-D methods achieve a probability of detection of 99.72% and 99.69% respectively, while the probability of false detection is 0.28% and 0.31% respectively.

  20. Sea Ice Detection Based on Differential Delay-Doppler Maps from UK TechDemoSat-1

    Science.gov (United States)

    Zhu, Yongchao; Yu, Kegen; Zou, Jingui; Wickert, Jens

    2017-01-01

    Global Navigation Satellite System (GNSS) signals can be exploited to remotely sense atmosphere and land and ocean surface to retrieve a range of geophysical parameters. This paper proposes two new methods, termed as power-summation of differential Delay-Doppler Maps (PS-D) and pixel-number of differential Delay-Doppler Maps (PN-D), to distinguish between sea ice and sea water using differential Delay-Doppler Maps (dDDMs). PS-D and PN-D make use of power-summation and pixel-number of dDDMs, respectively, to measure the degree of difference between two DDMs so as to determine the transition state (water-water, water-ice, ice-ice and ice-water) and hence ice and water are detected. Moreover, an adaptive incoherent averaging of DDMs is employed to improve the computational efficiency. A large number of DDMs recorded by UK TechDemoSat-1 (TDS-1) over the Arctic region are used to test the proposed sea ice detection methods. Through evaluating against ground-truth measurements from the Ocean Sea Ice SAF, the proposed PS-D and PN-D methods achieve a probability of detection of 99.72% and 99.69% respectively, while the probability of false detection is 0.28% and 0.31% respectively. PMID:28704948

  1. DemoEnvironment国际合作项目的实践经验与思考%Practice and thinking of DemoEnvironment international cooperation project

    Institute of Scientific and Technical Information of China (English)

    李兵; 李超; 程言君

    2013-01-01

    @@%通过对Biogas Optimizer in China项目管理模式、运行方式和执行经验进行分析,系统总结了瑞典国际开发署(Sida)发起的DemoEnvironment计划的项目管理特点,以期对我国技术示范项目的管理和国际合作项目的申请和执行有所帮助.

  2. Overview on ITER and DEMO blanket fabrication activities of the KIT INR and related frameworks

    Energy Technology Data Exchange (ETDEWEB)

    Neuberger, Heiko, E-mail: heiko.neuberger@kit.edu [Karlsruhe Institute of Technology (KIT), Institute for Neutron Physics and Reactor Technology, Karlsruhe (Germany); Rey, Joerg; Weth, Axel von der; Hernandez, Francisco [Karlsruhe Institute of Technology (KIT), Institute for Neutron Physics and Reactor Technology, Karlsruhe (Germany); Martin, Tatiana [Karlsruhe Institute of Technology (KIT), Institute for Applied materials, Karlsruhe (Germany); Zmitko, Milan [Fusion for energy, ITER Department, Test Blanket Modules and Materials Development Project Team, Barcelona (Spain); Felde, Alexander [Institut für Umformtechnik (IFU), Universität Stuttgart (Germany); Niewöhner, Reinhard [Forschungsgesellschaft Umformtechnik (FGU), Stuttgart (Germany); Krüger, Friedhelm [Krüger Erodiertechnik, Biedenkopf (Germany)

    2015-10-15

    Highlights: • Recent achievements in fabricaition within different frameworks. • First Wall mockup with erosion technology. • Manufacturing of a HCPB TBM Cooling Plate Mockup (F4E) - Abstract: Fabrication experiments have been carried out in the KIT with the goal to qualify manufacturing technologies for the realization of fusion reactor components. The main focus of the activities managed by the fabrication team in the Institute of Neutron Physics and reactor technologies (INR) has been on the Test Blanket Module for ITER. Sets of fabrication and welding procedure specifications have been demonstrated and qualified in relevant scale for TBM structural and functional components. This paper presents interactions in between the different frameworks on domestic and European level to underline backgrounds of developments. It also summarizes results of development and their relevancy for DEMO and gives an outlook on the future development strategy for the DEMO blanket fabrication.

  3. Effect on the tritium breeding ratio for a distributed ICRF antenna in a DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, A., E-mail: albert.garcia.hp@gmail.com [Max-Planck-Institut für Plasmaphysik (IPP), Garching (Germany); Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Polytechnic University of Catalonia (UPC), Barcelona (Spain); Department of Applied Physics, Ghent University, Ghent (Belgium); Noterdaeme, J.-M. [Max-Planck-Institut für Plasmaphysik (IPP), Garching (Germany); Department of Applied Physics, Ghent University, Ghent (Belgium); Fischer, U. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Dies, J. [Polytechnic University of Catalonia (UPC), Barcelona (Spain)

    2015-12-10

    The paper reports results of MCNP-5 calculations to assess the effect on the Tritium Breeding Ratio (TBR) when integrating a distributed Ion Cyclotron Range of Frequencies (ICRF) antenna in the blanket of DEMO fusion power reactor. The calculations consider different parameters such as the ICRF covering ratio and the type of breeding blanket including the Helium Cooled Pebble Bed (HCPB) and the Helium Cooled Lithium Lead (HCLL) concepts. For an antenna with a full toroidal circumference of 360°, located poloidally at 40° with a poloidal extension of 1 m, the reduction of the TBR is −0.349% for the HCPB blanket and −0.532% for the HCLL blanket. The distributed ICRF antenna is thus shown to have only a marginal effect on the TBR of the DEMO reactor.

  4. Effect on the tritium breeding ratio for a distributed ICRF antenna in a DEMO reactor

    Science.gov (United States)

    Garcia, A.; Noterdaeme, J.-M.; Fischer, U.; Dies, J.

    2015-12-01

    The paper reports results of MCNP-5 calculations to assess the effect on the Tritium Breeding Ratio (TBR) when integrating a distributed Ion Cyclotron Range of Frequencies (ICRF) antenna in the blanket of DEMO fusion power reactor. The calculations consider different parameters such as the ICRF covering ratio and the type of breeding blanket including the Helium Cooled Pebble Bed (HCPB) and the Helium Cooled Lithium Lead (HCLL) concepts. For an antenna with a full toroidal circumference of 360°, located poloidally at 40° with a poloidal extension of 1 m, the reduction of the TBR is -0.349% for the HCPB blanket and -0.532% for the HCLL blanket. The distributed ICRF antenna is thus shown to have only a marginal effect on the TBR of the DEMO reactor.

  5. A high frequency, high power CARM proposal for the DEMO ECRH system

    Energy Technology Data Exchange (ETDEWEB)

    Mirizzi, Francesco, E-mail: francesco.mirizzi@enea.it [Consorzio CREATE, Via Claudio 21, I-80125 Napoli (Italy); Spassovsky, Ivan [Unità Tecnica Applicazioni delle Radiazioni – ENEA, C.R. Frascati, via E. Fermi 45, I-00044 Frascati (Italy); Ceccuzzi, Silvio [Unità Tecnica Fusione – ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati, Roma (Italy); Dattoli, Giuseppe; Di Palma, Emanuele; Doria, Andrea; Gallerano, Gianpiero [Unità Tecnica Applicazioni delle Radiazioni – ENEA, C.R. Frascati, via E. Fermi 45, I-00044 Frascati (Italy); Lampasi, Alessandro; Maffia, Giuseppe; Ravera, GianLuca [Unità Tecnica Fusione – ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati, Roma (Italy); Sabia, Elio [Unità Tecnica Applicazioni delle Radiazioni – ENEA, C.R. Frascati, via E. Fermi 45, I-00044 Frascati (Italy); Tuccillo, Angelo Antonio; Zito, Pietro [Unità Tecnica Fusione – ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati, Roma (Italy)

    2015-10-15

    Highlights: • ECRH system for DEMO. • Cyclotron Auto-Resonance Maser (CARM) devices. • Relativistic electron beams. • Bragg reflectors. • High voltage pulse modulators. - Abstract: ECRH&CD systems are extensively used on tokamak plasmas due to their capability of highly tailored power deposition, allowing very localised heating and non-inductive current drive, useful for MHD and profiles control. The high electron temperatures expected in DEMO will require ECRH systems with operating frequency in the 200–300 GHz range, equipped with a reasonable number of high power (P ≥ 1 MW) CW RF sources, for allowing central RF power deposition. In this frame the ENEA Fusion Department (Frascati) is coordinating a task force aimed at the study and realisation of a suitable high power, high frequency reliable source.

  6. Applicability of tungsten/EUROFER blanket module for the DEMO first wall

    Energy Technology Data Exchange (ETDEWEB)

    Igitkhanov, Yu., E-mail: juri.igitkhanov@lhm.fzk.de [Karlsruhe Institute of Technology, IHM, Karlsruhe (Germany); Bazylev, B.; Landman, I. [Karlsruhe Institute of Technology, IHM, Karlsruhe (Germany); Boccaccini, L. [Karlsruhe Institute of Technology, INR, Karlsruhe (Germany)

    2013-07-15

    In this paper we analyse a sandwich-type blanket configuration of W/EUROFER for DEMO first wall under steady-state normal operation and off-normal conditions, such as vertical displacements and runaway electrons. The heat deposition and consequent erosion of the tungsten armour is modelled under condition of helium cooling of the first wall blanket module and by taking into account the conversion of the magnetic energy stored in the runaway electron current into heat through the ohmic dissipation of the return current induced in the metallic armour structure. It is shown that under steady-state DEMO operation the first wall sandwich type module will tolerate heat loads up to ∼14 MW/m{sup 2}. It will also sustain the off-normal events, apart from the hot vertical displacement events, which will melt the tungsten armour surface.

  7. Applicability of tungsten/EUROFER blanket module for the DEMO first wall

    Science.gov (United States)

    Igitkhanov, Yu.; Bazylev, B.; Landman, I.; Boccaccini, L.

    2013-07-01

    In this paper we analyse a sandwich-type blanket configuration of W/EUROFER for DEMO first wall under steady-state normal operation and off-normal conditions, such as vertical displacements and runaway electrons. The heat deposition and consequent erosion of the tungsten armour is modelled under condition of helium cooling of the first wall blanket module and by taking into account the conversion of the magnetic energy stored in the runaway electron current into heat through the ohmic dissipation of the return current induced in the metallic armour structure. It is shown that under steady-state DEMO operation the first wall sandwich type module will tolerate heat loads up to ˜14 MW/m2. It will also sustain the off-normal events, apart from the hot vertical displacement events, which will melt the tungsten armour surface.

  8. Thermal-hydraulic analysis of LTS cables for the DEMO TF coil using simplified models

    Directory of Open Access Journals (Sweden)

    Lewandowska Monika

    2017-03-01

    Full Text Available The conceptual design activities for the DEMOnstration reactor (DEMO – the prototype fusion power plant – are conducted in Europe by the EUROfusion Consortium. In 2015, three design concepts of the DEMO toroidal field (TF coil were proposed by Swiss Plasma Center (EPFL-SPC, PSI Villigen, Italian National Agency for New Technologies (ENEA Frascati, and Atomic Energy and Alternative Energies Commission (CEA Cadarache. The proposed conductor designs were subjected to complete mechanical, electromagnetic, and thermal-hydraulic analyses. The present study is focused on the thermal-hydraulic analysis of the candidate conductor designs using simplified models. It includes (a hydraulic analysis, (b heat removal analysis, and (c assessment of the maximum temperature and the maximum pressure in each conductor during quench. The performed analysis, aimed at verification whether the proposed design concepts fulfil the established acceptance criteria, provides the information for further improvements of the coil and conductors design.

  9. Potential of ion cyclotron resonance frequency current drive via fast waves in DEMO

    Science.gov (United States)

    Kazakov, Ye O.; Van Eester, D.; Wauters, T.; Lerche, E.; Ongena, J.

    2015-02-01

    For the continuous operation of future tokamak-reactors like DEMO, non-inductively driven toroidal plasma current is needed. Bootstrap current, due to the pressure gradient, and current driven by auxiliary heating systems are currently considered as the two main options. This paper addresses the current drive (CD) potential of the ion cyclotron resonance frequency (ICRF) heating system in DEMO-like plasmas. Fast wave CD scenarios are evaluated for both the standard midplane launch and an alternative case of exciting the waves from the top of the machine. Optimal ICRF frequencies and parallel wave numbers are identified to maximize the CD efficiency. Limitations of the high frequency ICRF CD operation are discussed. A simplified analytical method to estimate the fast wave CD efficiency is presented, complemented with the discussion of its dependencies on plasma parameters. The calculated CD efficiency for the ICRF system is shown to be similar to those for the negative neutral beam injection and electron cyclotron resonance heating.

  10. A drop jumps to weightlessness: a lecture demo

    Science.gov (United States)

    Mayer, V. V.; Varaksina, E. I.; Saranin, V. A.

    2017-04-01

    The paper discusses the lecture demonstration of the phenomenon in which a drop lying on a solid unwettable substrate jumps when making the transition to weightlessness. An elementary theory of the phenomenon is given. A jump speed estimate is obtained for small and large drops. The natural vibrational frequency of a flying drop is determined. A full-scale model of Einstein’s elevator is described. Experimental and theoretical results are found to agree satisfactorily.

  11. Initial results of NEXT-DEMO, a large-scale prototype of the NEXT-100 experiment

    CERN Document Server

    Álvarez, V; Cárcel, S; Castel, J; Cebrián, S; Cervera, A; Conde, C A N; Dafni, T; Dias, T H V T; Díaz, J; Egorov, M; Esteve, R; Evtoukhovitch, P; Fernandes, L M P; Ferrario, P; Ferreira, A L; Freitas, E D C; Gehman, V M; Gil, A; Goldschmidt, A; Gómez, H; Gómez-Cadenas, J J; González-Díaz, D; Gutiérrez, R M; Hauptman, J; Morata, J A Hernando; Herrera, D C; Iguaz, F J; Irastorza, I G; Jinete, M A; Labarga, L; Laing, A; Liubarsky, I; Lopes, J A M; Lorca, D; Losada, M; Luzón, G; Marí, A; Martín-Albo, J; Martínez, A; Miller, T; Moiseenko, A; Monrabal, F; Monteiro, C M B; Mora, F J; Moutinho, L M; Vidal, J Muñoz; da Luz, H Natal; Navarro, G; Nebot, M; Nygren, D; Oliveira, C A B; Palma, R; Pérez, J; Aparicio, J L Pérez; Renner, J; Ripoll, L; Rodríguez, A; Rodríguez, J; Santos, F P; Santos, J M F dos; Segui, L; Serra, L; Shuman, D; Simón, A; Sofka, C; Sorel, M; Toledo, J F; Tomás, A; Torrent, J; Tsamalaidze, Z; Vázquez, D; Veloso, J F C A; Villar, J A; Webb, R; White, J T; Yahlali, N

    2012-01-01

    NEXT-DEMO is a large scale prototype and demonstrator of the NEXT-100 High Pressure Xenon Gas TPC, which will search for the neutrinoless double beta decay of Xe-136 using 100-150 kg of enriched xenon gas. The apparatus was built to prove the expected performance of NEXT-100, namely, energy resolution better than 1% FWHM at 2.5 MeV and event topological reconstruction. In this paper we describe the operation and initial results of the detector.

  12. Assessment of the LH wave for demo in pulsed and steady state scenario

    Energy Technology Data Exchange (ETDEWEB)

    Cardinali, A.; Barbato, E.; Castaldo, C.; Cesario, R.; Marinucci, M.; Ravera, G. L.; Tuccillo, A. A. [Associazione Euratom-ENEA sulla Fusione, C.R. Frascati, Via Enrico Fermi, 45 00044, Frascati, Roma (Italy); Ceccuzzi, S. [Associazione Euratom-ENEA sulla Fusione, C.R. Frascati, Via Enrico Fermi, 45 00044, Frascati, Roma, Italy and Department of Engineering, Roma Tre University, Via Vito Volterra, 62, 00146, Roma (Italy); Mirizzi, F.; Panaccione, L. [Consorzio CREATE, Universita degli Studi di Napoli Federico II, Via Claudio 21, 80125, Napoli (Italy); Santini, F.; Schettini, G. [Department of Engineering, Roma Tre University, Via Vito Volterra, 62, 00146, Roma (Italy)

    2014-02-12

    The Lower Hybrid Current Drive (LHCD) has been analysed in DEMO tokamak plasma in the 'pulsed and steady state regime' considering two plasma scenarios characterized, respectively, by flat density profile and peaked density profiles. We have obtained LH deposition profiles in cases of neglecting the effect of spectral broadening produced by PI at the edge. By comparing the Power Deposition Profiles for both DEMO scenarios ('flat' and 'peaked'), the SOL of DEMO does not play any role in the absorption of the LH wave. In all cases the deposition is localized inside the separatrix layer r/a≤1. By lowering the parallel wave-number peak of the power spectrum from 1.8 to 1.5, the accessibility condition in both case prevents the power from reaching the deposition layer apart from a small fraction which pertains to the higher n∥ of the power spectrum. The spectrum centred at 1.8 is suggested to be useful in DEMO. More realistically, as supported by available data of LHCD in a wide range of operating densities, the effect of parametric decay instability (PDI) can produce a spectral broadening which should be included in the simulations. Further studies would be necessary for assessing the temperature profiles in the SOL at reactor-graded conditions. This is because, if the SOL temperature is at least of the order of 50 to 100 eV, the effect of PDI broads the spectrum up to n∥≤10, and the deposition profile is slightly wider but not much shifted outwards.

  13. Technological and physics assessments on heating and current drive systems for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Franke, Thomas, E-mail: thomas.franke@efda.org [EFDA Close Support Unit, Boltzmannstr. 2, D-85748 Garching (Germany); Max Planck Institute for Plasma Physics, Boltzmannstr. 2, D-85748 Garching (Germany); Barbato, E. [Unità Tecnica Fusione ENEA, C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); Bosia, G. [Department of Physics, University of Turin, Via P. Giuria 1, 10125 Turin (Italy); Cardinali, A.; Ceccuzzi, S.; Cesario, R. [Unità Tecnica Fusione ENEA, C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); Van Eester, D. [Laboratory for Plasma Physics, LPP-ERM/KMS, TEC & Belgian EUROfusion Consortium Partner, Brussels (Belgium); Federici, G. [EFDA Close Support Unit, Boltzmannstr. 2, D-85748 Garching (Germany); Gantenbein, G. [Karlsruhe Institute of Technology (KIT), Association EURATOM-KIT, Kaiserstrasse 12, 76131 Karlsruhe (Germany); Helou, W.; Hillairet, J. [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Jenkins, I. [CCFE, Culham Science Centre, Abingdon OX143DB (United Kingdom); Kazakov, Ye.O. [Laboratory for Plasma Physics, LPP-ERM/KMS, TEC & Belgian EUROfusion Consortium Partner, Brussels (Belgium); Kemp, R. [CCFE, Culham Science Centre, Abingdon OX143DB (United Kingdom); Lerche, E. [Laboratory for Plasma Physics, LPP-ERM/KMS, TEC & Belgian EUROfusion Consortium Partner, Brussels (Belgium); Mirizzi, F. [Unità Tecnica Fusione ENEA, C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); Noterdaeme, J.-M.; Poli, E. [Max Planck Institute for Plasma Physics, Boltzmannstr. 2, D-85748 Garching (Germany); Porte, L. [Centre de Recherches en Physique des Plasmas, Ecole Polytechnique Fédérale de Lausanne (EPFL), Station 13, CH-1015 Lausanne (Switzerland); Ravera, G.L. [Unità Tecnica Fusione ENEA, C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); and others

    2015-10-15

    Highlights: • Basic physics requirements of H&CD systems in DEMO have been captured. • The four H&CD systems NBI, EC, IC and LH were analysed to optimize performance. • Novel solutions were studied to overcome the limitations of the present H&CD systems. • RAMI as well as efficiency and optimized design of H&CD systems have been assessed. • Further constraints by remote maintenance or breeding blanket interactions were considered. - Abstract: The physics requirements of the heating and current (H&CD) systems in a Demonstration Fusion Power Plant (DEMO) are often beyond the actual level of design maturity and technology readiness required. The recent EU fusion roadmap advocates a pragmatic approach and favours, for the initial design integration studies, systems to be as much as possible, extrapolated from the ITER experience. To reach the goal of demonstrating the production of electricity in DEMO with a closed fuel cycle by 2050, one must ensure reliability, availability, maintainability, inspectability (RAMI) as well as performance, efficiency and optimized design for the H&CD systems. In the recent Power Plant Physics & Technology (PPP&T) Work Programme, a number of H&CD studies were performed. The four H&CD systems Neutral Beam (NB) Injection, Electron Cyclotron (EC), Ion Cyclotron (IC) and Lower Hybrid (LH) were considered. First, a physics optimization study was made assuming all technologies are available and identifying which parameters are needed to optimize the performance for given plasma parameters. Separately, the (i) technological maturity was considered (e.g. 240 GHz gyrotrons for EC) and (ii) technologies were adapted (e.g. multi-stage depressed collector for EC) or (iii) novel solutions (e.g. photo-neutralization for NB or new antennae concepts for IC) were studied to overcome the limitations of the present H&CD systems with respect to DEMO requirements. Further constraints imposed by remote maintenance or breeding blanket interactions

  14. Physics and Engineering Assessmetns of the K-DEMO Magnet Configuration

    Energy Technology Data Exchange (ETDEWEB)

    Neilson, George H. [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States); Brown, Thomas [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States)

    2014-09-01

    Increased attention is being given now to studies of next-step fusion facilities with nuclear missions. Among these, South Korea's K DEMO is unique in its focus on a high toroidal magnetic field, large major radius, steady-state tokamak design for the core of a facility to test fusion nuclear components in Phase I and, after upgrades, produce 500 MW of electricity in a Phase II. Innovative features of the K DEMO magnet set include the use of two toroidal field (TF) coil winding packs with conductor grading and a machine configuration designed for vertical maintenance. The magnet arrangement features large TF coils and widely spaced poloidal field (PF) coils to accommodate removal of in-vessel components as large modules. Physics and engineering assessments of the pre-conceptual K-DEMO magnet configuration are reported, including: 1) design point and operating space assessment, 2) conductor assessment, and 3) structural assessment. It is found that a reference design point at 6.8 m major radius and 7.4 T toroidal field provides sufficient operating margins for the 500 MWe Phase II mission. Analyses of candidate cable-in-conduit conductors provide predictions of critical current degradation, both in the initial load cycle and an additionally with cyclic loading. A first-pass global analysis of the magnet system found minimal out-of-plane deformations of the TF coil, but an overstress condition in the inner leg of the TF coil. However an analysis taking into account elastic-plastic behavior, frictional sliding, and displacement shows that the structure can safely carry the load. Although the design evolution is still at an early stage, these assessments support the design point choices to date and the expectation that a feasible solution for the high-field K DEMO magnet system can be found.

  15. The physics and technology basis entering European system code studies for DEMO

    Science.gov (United States)

    Wenninger, R.; Kembleton, R.; Bachmann, C.; Biel, W.; Bolzonella, T.; Ciattaglia, S.; Cismondi, F.; Coleman, M.; Donné, A. J. H.; Eich, T.; Fable, E.; Federici, G.; Franke, T.; Lux, H.; Maviglia, F.; Meszaros, B.; Pütterich, T.; Saarelma, S.; Snickers, A.; Villone, F.; Vincenzi, P.; Wolff, D.; Zohm, H.

    2017-01-01

    A large scale program to develop a conceptual design for a demonstration fusion power plant (DEMO) has been initiated in Europe. Central elements are the baseline design points, which are developed by system codes. The assessment of the credibility of these design points is often hampered by missing information. The main physics and technology content of the central European system codes have been published (Kovari et al 2014 Fusion Eng. Des. 89 3054-69, 2016 Fusion Eng. Des. 104 9-20, Reux et al 2015 Nucl. Fusion 55 073011). In addition, this publication discusses key input parameters for the pulsed and conservative design option \\tt{EU DEMO1 2015} and provides justifications for the parameter choices. In this context several DEMO physics gaps are identified, which need to be addressed in the future to reduce the uncertainty in predicting the performance of the device. Also the sensitivities of net electric power and pulse duration to variations of the input parameters are investigated. The most extreme sensitivity is found for the elongation ( Δ {κ95}=10 % corresponds to Δ {{P}\\text{el,\\text{net}}}=125 % ).

  16. Pre-conceptual design study on K-DEMO ceramic breeder blanket

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong Sung, E-mail: jspark@nfri.re.kr [National Fusion Research Institute, Daejeon 305-333 (Korea, Republic of); Kwon, Sungjin; Im, Kihak; Kim, Keeman [National Fusion Research Institute, Daejeon 305-333 (Korea, Republic of); Brown, Thomas; Neilson, George [Princeton Plasma Physics Laboratory, Princeton, NJ 08543 (United States)

    2015-11-15

    A pre-conceptual design study has been carried out for the Korean fusion demonstration reactor (K-DEMO) tokamak featured by high magnetic field (B{sub T0} = 7.4 T), R = 6.8 m, a = 2.1 m, and a steady-state operation. The design concepts of the K-DEMO blanket system considering the cooling in-vessel components with pressurized water and a solid pebble breeder are described herein. The structure of the K-DEMO blanket is toroidally subdivided into 16 inboard and 32 outboard sectors, in order to allow the vertical maintenance. Each blanket module is composed of plasma-facing first wall, layers of breeding parts, shielding and manifolds. A ceramic breeder using Li{sub 4}SiO{sub 4} pebbles with Be{sub 12}Ti as neuron multiplier is employed for study. MCNP neutronic simulations and thermo-hydraulic analyses are interactively performed in order to satisfy two key aspects: achieving a global Tritium Breeding Ratio (TBR) >1.05 and operating within the maximum allowable temperature ranges of materials.

  17. On the EU approach for DEMO architecture exploration and dealing with uncertainties

    Energy Technology Data Exchange (ETDEWEB)

    Coleman, M., E-mail: matti.coleman@euro-fusion.org [EUROfusion Consortium, Boltzmannstraße 2, 85748 Garching (Germany); CCFE Fusion Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Maviglia, F.; Bachmann, C. [EUROfusion Consortium, Boltzmannstraße 2, 85748 Garching (Germany); Anthony, J. [CCFE Fusion Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Federici, G. [EUROfusion Consortium, Boltzmannstraße 2, 85748 Garching (Germany); Shannon, M. [EUROfusion Consortium, Boltzmannstraße 2, 85748 Garching (Germany); CCFE Fusion Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Wenninger, R. [EUROfusion Consortium, Boltzmannstraße 2, 85748 Garching (Germany); Max-Planck-Institut für Plasmaphysik, 85748 Garching (Germany)

    2016-11-01

    Highlights: • The issue of epistemic uncertainties in the DEMO design basis is described. • An approach to tackle uncertainty by investigating plant architectures is proposed. • The first wall heat load uncertainty is addressed following the proposed approach. - Abstract: One of the difficulties inherent in designing a future fusion reactor is dealing with uncertainty. As the major step between ITER and the commercial exploitation of nuclear fusion energy, DEMO will have to address many challenges – the natures of which are still not fully known. Unlike fission reactors, fusion reactors suffer from the intrinsic complexity of the tokamak (numerous interdependent system parameters) and from the dependence of plasma physics on scale – prohibiting design exploration founded on incremental progression and small-scale experimentation. For DEMO, this means that significant technical uncertainties will exist for some time to come, and a systems engineering design exploration approach must be developed to explore the reactor architecture when faced with these uncertainties. Important uncertainties in the context of fusion reactor design are discussed and a strategy for dealing with these is presented, treating the uncertainty in the first wall loads as an example.

  18. Overview of the design approach and prioritization of R&D activities towards an EU DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Federici, G., E-mail: gianfranco.federici@euro-fusion.org [EUROfusion Consortium, Boltzmannstr. 2, Garching 85748 (Germany); Bachmann, C. [EUROfusion Consortium, Boltzmannstr. 2, Garching 85748 (Germany); Biel, W. [Institute of Energy and Climate Research, Forschungszentrum Jülich GmbH, Jülich (Germany); Department of Applied Physics, Ghent University, Ghent (Belgium); Boccaccini, L. [Karlsruhe Institute of Technology (KIT), Campus Nord Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Cismondi, F.; Ciattaglia, S.; Coleman, M. [EUROfusion Consortium, Boltzmannstr. 2, Garching 85748 (Germany); Day, C. [Karlsruhe Institute of Technology (KIT), Campus Nord Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Diegele, E.; Franke, T. [EUROfusion Consortium, Boltzmannstr. 2, Garching 85748 (Germany); Grattarola, M. [Ansaldo Nucleare, Corso Perrone 25, 16152 Genova (Italy); Hurzlmeier, H. [EUROfusion Consortium, Boltzmannstr. 2, Garching 85748 (Germany); Ibarra, A. [CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Loving, A. [CCFE Culham Science Centre, Abingdon OX14-3DB, Oxon (United Kingdom); Maviglia, F.; Meszaros, B.; Morlock, C. [EUROfusion Consortium, Boltzmannstr. 2, Garching 85748 (Germany); Rieth, M. [Karlsruhe Institute of Technology (KIT), Campus Nord Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Shannon, M. [EUROfusion Consortium, Boltzmannstr. 2, Garching 85748 (Germany); Taylor, N. [CCFE Culham Science Centre, Abingdon OX14-3DB, Oxon (United Kingdom); and others

    2016-11-01

    Highlights: • An important objective of the EU fusion roadmap Horizon 2020 is to lay the foundation of a DEMO Fusion Power Reactor to follow ITER. • This paper describes the progress of the DEMO design and R&D activities in Europe in the EUROfusion Consortium. • Focus is on a systems engineering/design integration approach to identify technology & physics R&D requirements and address design challenges. • Preliminary design choices/sensitivity studies to explore the design space and identify/select attractive design points are described. • Initial results of work conducted by distributed project teams involving EU labs, universities, and industries in Europe are presented. - Abstract: This paper describes the progress of the DEMO design and R&D activities in Europe. The focus is on a systems engineering and design integration approach, which is recognized to be essential from an early stage to identify and address the engineering and operational challenges, and the requirements for technology and physics R&D. We present some of the preliminary design choices/sensitivity studies to explore and narrow down the design space and identify/select attractive design points. We also discuss some of the initial results of work being executed in the EUROfusion Consortium by a geographically distributed project team involving many EU laboratories, universities, and industries in Europe.

  19. Transient analyses on the cooling channels of the DEMO HCPB blanket concept under accidental conditions

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Yuming, E-mail: Yuming.chen@kit.edu; Ghidersa, Bradut-Eugen; Jin, Xue Zhou

    2016-11-01

    Highlights: • This paper presents transient CFD analyses on the cooling channels of the DEMO HCPB FW for accidental scenarios LOCA and LOFA. • In both LOCA & LOFA, the wall temperature increases quickly to an unacceptable level within seconds. • If the coolant flow rate is maintained at a half of nominal value in case of LOFA (partial LOFA), the wall temperature rises much slower, but will still leads to a damage of structure within minutes. • The simulated heat transfer coefficients were compared with empirical correlations. - Abstract: Helium Cooled Pebble Bed (HCPB) blanket concept is one of the DEMO (Demonstration Power Plant) blanket concepts running for the final DEMO design selection. In this paper, transient analyses on the cooling channels of the FW are carried out by means of CFD simulations for the selected accidental scenarios loss-of-coolant-accident (LOCA) and loss-of-flow-accident (LOFA). ANSYS-CFX is used for the simulations. The simulation results help to understand how fast the temperature of the FW can increase and what is the time window that is available until the temperature of the structural material reaches the design limit in order to be able to define a suitable protection strategy for the system. In view of later developments of the models, the heat transfer coefficients calculated with CFD are compared with the values predicted by two widely used correlations for turbulent pipe flows.

  20. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  1. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  2. Neutronics studies for the design of the European DEMO vacuum vessel

    Energy Technology Data Exchange (ETDEWEB)

    Flammini, Davide, E-mail: davide.flammini@enea.it [ENEA, Fusion Technical Unit, Nuclear Technologies Laboratory, Via Enrico Fermi 45, 00044 Frascati, Rome (Italy); Villari, Rosaria; Moro, Fabio; Pizzuto, Aldo [ENEA, Fusion Technical Unit, Nuclear Technologies Laboratory, Via Enrico Fermi 45, 00044 Frascati, Rome (Italy); Bachmann, Christian [EUROfusion Consortium, Boltzmannstr. 2, 85748 Garching (Germany)

    2016-11-01

    Highlights: • MCNP calculation of nuclear heating, damage, helium production and neutron flux in DEMO HCLL and HCPB vacuum vessel at the inboard equatorial plane. • Study of impact of the poloidal gap between blanket modules, for several gap width, on vacuum vessel nuclear quantities. • Effect of the gap on nuclear heating result to be moderate, however high values of nuclear heating are found, even far from the gap with HCLL blanket. • Radiation damage limit of 2.75 DPA is met with a 1 cm wide gap. Helium production results very sensitive to the gap width. • Comparison between HCLL and HCPB blankets is shown for nuclear heating and neutron flux in the vacuum vessel. - Abstract: The DEMO vacuum vessel, a massive water cooled double-walled steel vessel, is located behind breeding blankets and manifolds and it will be subjected to an intense neutron and photon irradiation. Therefore, a proper evaluation of the vessel nuclear heat loads is required to assure adequate cooling and, given the significant lifetime neutron fluence of DEMO, the radiation damage limit of the vessel needs to be carefully controlled. In the present work nuclear heating, radiation damage (DPA), helium production, neutron and photon fluxes have been calculated on the vacuum vessel at the inboard by means of MCNP5 using a 3D Helium Cooled Lithium Lead (HCLL) DEMO model with 1572 MW of fusion power. In particular, the effect of the poloidal gap between the breeding-blanket segments on vacuum vessel nuclear loads has been estimated varying the gap width from 0 to 5 cm. High values of the nuclear heating (≈1 W/cm{sup 3}), which might cause intense thermal stresses, were obtained in inboard equatorial zone. The effect of the poloidal gap on the nuclear heating resulted to be moderate (within 30%). The radiation damage limit of 2.75 DPA on the vessel is almost met with 1 cm of poloidal gap over DEMO lifetime. A comparison with Helium Cooled Pebble Bed blanket is also provided.

  3. A Fusion Nuclear Science Facility for a fast-track path to DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Garofalo, A.M., E-mail: garofalo@fusion.gat.com [General Atomics, San Diego, CA (United States); Abdou, M.A. [University of California, Los Angeles, Los Angeles, CA (United States); Canik, J.M. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Chan, V.S.; Hyatt, A.W. [General Atomics, San Diego, CA (United States); Hill, D.N. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Morley, N.B. [University of California, Los Angeles, Los Angeles, CA (United States); Navratil, G.A. [Columbia University, New York, NY (United States); Sawan, M.E. [University of Wisconsin Madison, Madison, WI (United States); Taylor, T.S.; Wong, C.P.C.; Wu, W. [General Atomics, San Diego, CA (United States); Ying, A. [University of California, Los Angeles, Los Angeles, CA (United States)

    2014-10-15

    Highlights: • A FNSF is needed to reduce the knowledge gaps to a fusion DEMO and accelerate progress toward fusion energy. • FNSF will test and qualify first-wall/blanket components and materials in a DEMO-relevant fusion environment. • The Advanced Tokamak approach enables reduced size and risks, and is on a direct path to an attractive target power plant. • Near term research focus on specific tasks can enable starting FNSF construction within the next ten years. - Abstract: An accelerated fusion energy development program, a “fast-track” approach, requires proceeding with a nuclear and materials testing program in parallel with research on burning plasmas, ITER. A Fusion Nuclear Science Facility (FNSF) would address many of the key issues that need to be addressed prior to DEMO, including breeding tritium and completing the fuel cycle, qualifying nuclear materials for high fluence, developing suitable materials for the plasma-boundary interface, and demonstrating power extraction. The Advanced Tokamak (AT) is a strong candidate for an FNSF as a consequence of its mature physics base, capability to address the key issues, and the direct relevance to an attractive target power plant. The standard aspect ratio provides space for a solenoid, assuring robust plasma current initiation, and for an inboard blanket, assuring robust tritium breeding ratio (TBR) >1 for FNSF tritium self-sufficiency and building of inventory needed to start up DEMO. An example design point gives a moderate sized Cu-coil device with R/a = 2.7 m/0.77 m, κ = 2.3, B{sub T} = 5.4 T, I{sub P} = 6.6 MA, β{sub N} = 2.75, P{sub fus} = 127 MW. The modest bootstrap fraction of ƒ{sub BS} = 0.55 provides an opportunity to develop steady state with sufficient current drive for adequate control. Proceeding with a FNSF in parallel with ITER provides a strong basis to begin construction of DEMO upon the achievement of Q ∼ 10 in ITER.

  4. Materials R and D for a timely DEMO: Key findings and recommendations of the EU Roadmap Materials Assessment Group

    Energy Technology Data Exchange (ETDEWEB)

    Stork, Derek, E-mail: derek.stork@ccfe.ac.uk [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching, 85748 Germany (Germany); Agostini, Pietro [ENEA, Brasimone Research Centre, 40032, Camugnano, Bologna (Italy); Boutard, Jean-Louis [CEA, cab HC, Saclay, F-91191, Gif-sur-Yvette (France); Buckthorpe, Derek [AMEC, Booths Park, Chelford Road, Knutsford, Cheshire, WA16 8QZ (United Kingdom); Diegele, Eberhard [Karlsruhe Institute for Technology, IMF-I, D-7602, Karlsruhe (Germany); Dudarev, Sergei L. [Euratom-CCFE Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); English, Colin [National Nuclear Laboratory, 5th Floor, Chadwick House, Warrington Road, Birchwood Park, WA3 6AE (United Kingdom); Federici, Gianfranco [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching, 85748 Germany (Germany); Gilbert, Mark R. [Euratom-CCFE Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Gonzalez, Sehila [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching, 85748 Germany (Germany); Ibarra, Angel [CIEMAT, Avda. Complutense 40, Madrid (Spain); Linsmeier, Christian [Forschungszentrum Jülich GmbH, Institut für Energie- und Klimaforschung–Plasmaphysik, EURATOM Association, 52425 Jülich (Germany); Puma, Antonella Li [CEA, DEN, Saclay, DM2S, SERMA, F-91191, Gif-sur-Yvette (France); Marbach, Gabriel [CEA, cab HC, Saclay, F-91191, Gif-sur-Yvette (France); Packer, Lee W. [Euratom-CCFE Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Raj, Baldev [Indian National Academy of Engineering, Shaheed Jeet Singh Marg, New Delhi 110016 (India); Rieth, Michael [Karlsruhe Institute for Technology, IMF-I, D-7602, Karlsruhe (Germany); Tran, Min Quang [Ecole Polytechnique Federale de Lausanne—CRPP, Association Euratom-Switzerland, 1015 Lausanne (Switzerland); and others

    2014-10-15

    The findings of the EU Fusion Programme's ‘Materials Assessment Group’ (MAG), assessing readiness of Structural, Plasma Facing (PF) and High Heat Flux (HHF) materials for DEMO, are discussed. These are incorporated into the EU Fusion Power Roadmap [1], with a decision to construct DEMO in the early 2030s. The methodology uses project-based and systems-engineering approaches, the concept of Technology Readiness Levels, and considers lessons learned from Fission reactor material development. ‘Baseline’ materials are identified for each DEMO role, and the DEMO mission risks analysed from the known limitations, or unknown properties, associated with each baseline material. R and D programmes to address these risks are developed. The DEMO assessed has a phase I with a ‘starter blanket’: the blanket must withstand ≥2 MW yr m{sup −2} fusion neutron flux (equivalent to ∼20 dpa front-wall steel damage). The baseline materials all have significant associated risks, so development of ‘Risk Mitigation Materials’ (RMM) is recommended. The R and D programme has parallel development of the baseline and RMM, up to ‘down-selection’ points to align with decisions on the DEMO blanket and divertor engineering definition. ITER licensing experience is used to refine the issues for materials nuclear testing, and arguments are developed to optimise scope of materials tests with fusion neutron (‘14 MeV’) spectra before DEMO design finalisation. Some 14 MeV testing is still essential, and the Roadmap requires deployment of a ≥30 dpa (steels) testing capability by 2026. Programme optimisation by the pre-testing with fission neutrons on isotopically- or chemically-doped steels and with ion-beams is discussed along with the minimum 14 MeV testing programme, and the key role which fundamental and mission-oriented modelling can play in orienting the research.

  5. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  6. DEMO_REP: A LABS TOOL FOR TEACHING DATA REPLICATION / DEMO_REP: HERRAMIENTA PARA LABORATORIOS EN LA ENSEÑANZA DE RÉPLICA DE DATOS

    Directory of Open Access Journals (Sweden)

    Ileane Martí Pérez

    2013-02-01

    Full Text Available The process of training professionals in information technologies is a key aspect in the development of the country. University Informatics Science is one of the main centers dedicated to this process, also has postgraduate training programs to further advanced topics not mentioned in the pregraduate. One such program is the "DIPLOMADO EN TECNOLOGÍAS DE BASES DE DATOS POSTGRESQL," which has a number of courses to obtain expertise in the subject of databases in PostgreSQL Manager. In this paper show how affects in the understanding of the process of data replication, the use of the software tool "Demo_rep" for laboratory exercises replication. It also describes the main features of software tool.RESUMENEl proceso de formación de los profesionales en tecnologías de la informática es un aspecto clave en el desarrollo del país. La Universidad de las Ciencias Informáticas es uno de los principales centros que se dedica a este proceso, la misma consta de programas de formación postgraduada para profundizar en temas que no aparecen incluidos en los programas analíticos de las asignaturas de pregrado. Uno de estos programas es el “DIPLOMADO EN TECNOLOGÍAS DE BASES DE DATOS POSTGRESQL”, el cual cuenta con una serie de cursos para lograr experticia en la temática de las bases de datos en el gestor PostgreSQL. En el presente trabajo se muestra cómo incide en la comprensión del proceso de la replicación de datos, la utilización de una herramienta informática “Demo_rep” para realizar los ejercicios de laboratorio de réplica. Se describe además las principales funcionalidades de la misma.

  7. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  8. Optimization of the first wall for the DEMO water cooled lithium lead blanket

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, Julien, E-mail: julien.aubert@cea.fr [CEA Saclay, F-91191 Gif-Sur-Yvette (France); Aiello, Giacomo [CEA Saclay, F-91191 Gif-Sur-Yvette (France); Bachmann, Christian [EFDA, Boltzmannstraße 2, 85748 Garching (Germany); Di Maio, Pietro Alessandro [Università di Palermo, Viale delle Scienze, 90128 Palermo (Italy); Giammusso, Rosario [ENEA C.R. Brasimone, 40032 Camugnano, Bologna (Italy); Li Puma, Antonella; Morin, Alexandre [CEA Saclay, F-91191 Gif-Sur-Yvette (France); Tincani, Amelia [ENEA C.R. Brasimone, 40032 Camugnano, Bologna (Italy)

    2015-10-15

    Highlights: • This paper presents the optimization of the first wall of the water cooled lithium lead DEMO blanket with pressurized water reactor condition and circular channels in order to find the best geometry that can allow the maximum heat flux considering design criteria since an estimate of the engineering limit of the first wall heat load capacity is an essential input for the decision to implement limiters in DEMO. • An optimization study was carried out for the flat first wall design of the DEMO Water-Cooled Lithium Lead considering thermal and mechanical constraint functions, assuming T{sub inlet}/T{sub outlet} equal to 285 °C/325 °C, based on geometric design parameters. • It became clear that through the optimization the advantages of a waved First Wall are diminished. • The analysis shows that the maximum heat load could achieve 2.53 MW m{sup −2}, but considering assumptions such as a coolant velocity ≤8 m/s, pipe diameter ≥5 mm and a total first wall thickness ≤22 mm, heat flux is limited to 1.57 MW m{sup −2}. - Abstract: The maximum heat load capacity of a DEMO First Wall (FW) of reasonable cost may impact the decision of the implementation of limiters in DEMO. An estimate of the engineering limit of the FW heat load capacity is an essential input for this decision. This paper describes the work performed to optimize the FW of the Water Cooled Lithium-Lead (WCLL) blanket concept for DEMO fusion reactor in order to increase its maximum heat load capacity. The optimization is based on the use of water at typical Pressurised Water Reactors conditions as coolant. The present WCLL FW with a waved plasma-faced surface and with circular channels was studied and the heat load limit has been predicted with FEM analysis equal to 1.0 MW m{sup −2} with respect to the Eurofer temperature limit. An optimization study was then carried out for a flat FW design considering thermal and mechanical constraints assuming inlet and outlet

  9. Conceptual design for the superconducting magnet system of a pulsed DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Duchateau, J.-L., E-mail: jean-luc.duchateau@cea.fr [CEA/IRFM, 13108 St. Paul lez Durance Cedex (France); Hertout, P.; Saoutic, B.; Magaud, P.; Artaud, J.-F.; Giruzzi, G.; Bucalossi, J.; Johner, J.; Sardain, P.; Imbeaux, F.; Ané, J.-M.; Li-Puma, A. [CEA/IRFM, 13108 St. Paul lez Durance Cedex (France)

    2013-10-15

    Highlights: ► A 1D design approach of a pulsed DEMO reactor is presented. ► The main CS and TF conductor design criteria are presented. ► A typical major radius for a 2 GW DEMO is 9 m. ► A typical plasma magnetic field is 4.9 T. ► The pulse duration is 1.85 h for an aspect ratio of 3. -- Abstract: A methodology has been developed to consistently investigate, taking into account main reactor components, possible magnet solutions for a pulsed fusion reactor aiming at a large solenoid flux swing duration within the 2–3 h range. In a conceptual approach, investigations are carried out in the equatorial plane, taking into account the radial extension of the blanket-shielding zone, of the toroidal field magnet system inner leg and of the central solenoid for estimation of the pulsed swing. Design criteria are presented for the radial extension of the superconducting magnets, which is mostly driven by the structures (casings and conductor jacket). Typical available cable current densities are presented as a function of the magnetic field and of the temperature margin. The magnet design criteria have been integrated into SYCOMORE, a code for reactor modeling presently in development at CEA/IRFM in Cadarache, using the tools of the EFDA Integrated Tokamak Modeling task force. Possible solutions are investigated for a 2 GW fusion power reactor with different aspect ratios. The final adjustment of the DEMO pulsed reactor parameters will have to be consistently done, considering all reactor components, when the final goals of the machine will be completely clarified.

  10. Considerations for the development of neutral beam injection for fusion reactors or DEMO

    Science.gov (United States)

    Hemsworth, R. S.; Boilson, D.

    2017-08-01

    Neutral beam injection (NBI) has been the most successful heating scheme applied to fusion devices, the majority of which have been based on the acceleration and neutralization in a gas target of accelerated positive ions. For large fusion devices such as ITER, DEMO and fusion reactors, beam energies of the order of 0.5 MeV per nucleon or higher are required to penetrate deeply into the fusing plasma, and thus to heat the plasma in the most important region, i.e. near the poloidal axis of the device, and to drive current in the plasma. Because the efficiency of neutralization of positive ions in a gas target becomes unacceptably low at energies above ≈100 keV/nucleon, future injectors will be based on the neutralization of negative ions, either in a gas target, by photons or in a plasma target. So far only two systems based on negative ions have been used on fusion devices, at JT-60U and at LHD, both based on neutralization in a gas target. The injectors for ITER will also use a gas target, but the energy and operating environment are reactor and DEMO relevant. Also the ITER injectors will have to operate for pulse lengths orders of magnitude higher than all previous NBI systems. In this paper the R&D required for an NBI system for a reactor, or DEMO, is considered against the background of the ITER NBI system development, and the main elements of the required R&D are identified.

  11. Helical reactor design FFHR-d1 and c1 for steady-state DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Sagara, A., E-mail: sagara.akio@LHD.nifs.ac.jp; Tamura, H.; Tanaka, T.; Yanagi, N.; Miyazawa, J.; Goto, T.; Sakamoto, R.; Yagi, J.; Watanabe, T.; Takayama, S.

    2014-10-15

    Highlights: •More than 10 years’ operation is feasible using the inboard WC shield, where the total TBR is 1.18 with 90% 6Li. •The divertor targets can be efficiently shielded, expanding the range of material choice (e.g., Cu alloys). •Flinabe blanket mixed with metal powder is proposed to increase hydrogen solubility and thermal efficiency. •Helical coils by connecting segments of 100 kA-class YBCO high-temperature superconductors is proposed. •A multi-path strategy on FFHR-d1 is introduced with sub-ignition options for “before demo, compact and component-test”. -- Abstract: NIFS launched the Fusion Engineering Research Project (FERP) in preparation for DEMO by starting the redesign of the LHD-type helical reactor FFHR-d1. In the first round, the main parameters were selected. The second round is preparing detailed three-dimensional (3D) design of the superconducting magnet support structures, and 3D neutronics analyses, where the diverter targets can be efficiently shielded from fast neutrons. A new Flinabe blanket mixed with metal powder was proposed. Fabrication of helical coils by connecting half-helical-pitch segments of 100 kA-class YBCO high-temperature superconductors is proposed as a promising method. Also in progress is improvement of the first round of the core plasma design, ignition start-up analyses, and fueling scenario. As a consequence, a multi-path strategy on FFHR-d1 has been introduced with versions of -d1A, -d1B, and -d1C, where design flexibility is expanded to include subignition with options FFHR-c1 for “before demo, compact, and component-test.”.

  12. Self-consistent modeling of DEMOs with 1.5D BALDUR integrated predictive modeling code

    Science.gov (United States)

    Wisitsorasak, A.; Somjinda, B.; Promping, J.; Onjun, T.

    2017-02-01

    Self-consistent simulations of four DEMO designs proposed by teams from China, Europe, India, and Korea are carried out using the BALDUR integrated predictive modeling code in which theory-based models are used, for both core transport and boundary conditions. In these simulations, a combination of the NCLASS neoclassical transport and multimode (MMM95) anomalous transport model is used to compute a core transport. The boundary is taken to be at the top of the pedestal, where the pedestal values are described using a pedestal temperature model based on a combination of magnetic and flow shear stabilization, pedestal width scaling and an infinite- n ballooning pressure gradient model and a pedestal density model based on a line average density. Even though an optimistic scenario is considered, the simulation results suggest that, with the exclusion of ELMs, the fusion gain Q obtained for these reactors is pessimistic compared to their original designs, i.e. 52% for the Chinese design, 63% for the European design, 22% for the Korean design, and 26% for the Indian design. In addition, the predicted bootstrap current fractions are also found to be lower than their original designs, as fractions of their original designs, i.e. 0.49 (China), 0.66 (Europe), and 0.58 (India). Furthermore, in relation to sensitivity, it is found that increasing values of the auxiliary heating power and the electron line average density from their design values yield an enhancement of fusion performance. In addition, inclusion of sawtooth oscillation effects demonstrate positive impacts on the plasma and fusion performance in European, Indian and Korean DEMOs, but degrade the performance in the Chinese DEMO.

  13. Conceptual design studies for the European DEMO divertor: Rationale and first results

    Energy Technology Data Exchange (ETDEWEB)

    You, J.H., E-mail: you@ipp.mpg.de [Max Planck Institute for Plasma Physics, Boltzmann Str. 2, 85748 Garching (Germany); Mazzone, G.; Visca, E. [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati (Italy); Bachmann, Ch. [EUROfusion PMU, c/o IPP, Boltzmann Str. 2, 85748 Garching (Germany); Autissier, E. [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Barrett, T. [CCFE, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Cocilovo, V.; Crescenzi, F. [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati (Italy); Domalapally, P.K. [Research Cnter Rez, Hlavní 130, 250 68 Husinec–Řež (Czech Republic); Dongiovanni, D. [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati (Italy); Entler, S. [Institute of Plasma Physics CAS, Za Slovankou 3, 182 00 Praha 8 (Czech Republic); Federici, G. [EUROfusion PMU, c/o IPP, Boltzmann Str. 2, 85748 Garching (Germany); Frosi, P. [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati (Italy); Fursdon, M. [CCFE, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Greuner, H. [Max Planck Institute for Plasma Physics, Boltzmann Str. 2, 85748 Garching (Germany); Hancock, D. [CCFE, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Marzullo, D. [CREATE, University of Naples Federico II, P.le Tecchio 80, 80125 Napoli (Italy); McIntosh, S. [CCFE, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Müller, A.V. [Max Planck Institute for Plasma Physics, Boltzmann Str. 2, 85748 Garching (Germany); Porfiri, M.T. [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati (Italy); and others

    2016-11-01

    Highlights: • A brief overview is given on the overall R&D activities of the work package Divertor which is a project of the EUROfusion Consortium. • The rationale of the hydraulic, thermal and structural design scheme is described. • The first results obtained for the preliminary DEMO divertor cassette model are presented. - Abstract: In the European fusion roadmap, reliable power handling has been defined as one of the most critical challenges for realizing a commercially viable fusion power. In this context, the divertor is the key in-vessel component, as it is responsible for power exhaust and impurity removal for which divertor target is subjected to very high heat flux loads. To this end, an integrated R&D project was launched in the EUROfusion Consortium in order to deliver a holistic conceptual design solution together with the core technologies for the entire divertor system of a DEMO reactor. The work package ‘Divertor’ consists of two project areas: ‘Cassette design and integration’ and ‘Target development’. The essential mission of the project is to develop and verify advanced design concepts and the required technologies for a divertor system being capable of meeting the physical and system requirements defined for the next-generation European DEMO reactor. In this contribution, a brief overview is presented of the works from the first project year (2014). Focus is put on the loads specification, design boundary conditions, materials requirements, design approaches, and R&D strategy. Initial ideas and first estimates are presented.

  14. Effect on the Tritium Breeding Ratio due to a distributed ICRF antenna in a DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, A., E-mail: albert.garcia.hp@gmail.com [Max-Planck-Institut für Plasmaphysik (IPP), Garching (Germany); Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Polytechnic University of Catalonia (UPC), Barcelona (Spain); Department of Applied Physics, Ghent University, Ghent (Belgium); Noterdaeme, J.-M. [Max-Planck-Institut für Plasmaphysik (IPP), Garching (Germany); Department of Applied Physics, Ghent University, Ghent (Belgium); Fischer, U. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Dies, J. [Polytechnic University of Catalonia (UPC), Barcelona (Spain)

    2016-11-15

    This thesis reports results of MCNP-5 calculations, with the nuclear data library FENDL-2.1, to assess the effect on the Tritium Breeding Ratio (TBR) due to a distributed Ion Cyclotron Range of Frequencies (ICRF) antenna integrated in the blanket of a DEMO fusion power reactor. A preliminary design of the antenna with a reference configuration of the DEMO reactor was used together with a parametric analysis for different parameters that strongly affect the TBR. These are the type of breeding blanket (Helium Cooled Pebble Bed, Helium Cooled Lithium Lead and Water Cooled Lithium Lead), the covering ratio of the straps of the antenna (the ratio between the surface of all the straps and the projected surface of the antenna slot: 0.49, 0.72 and 0.94), the antenna radial thickness (20 cm and 40 cm), the thickness of the straps (2 cm, 4 cm and a double layer of 0.2 cm plus 2.5 cm with the composition of the First Wall), and finally the poloidal position of the antenna (0°, which is the equatorial port, 40° and 90°, which is the upper port). For an antenna with a full toroidal circumference of 360°, located poloidaly at 40° with a poloidal extension of 1 m and a total First Wall surface of 67 m{sup 2}, the reduction of the TBR is −0.35% for a HCPB blanket concept, −0.53% for a HCLL blanket concept and −0.51% for a WCLL blanket concept. In all cases covered by the parametric analysis, the loss of TBR remains below 0.61%. Such a distributed ICRF antenna has thus only a marginal effect on the TBR for a DEMO reactor.

  15. Demos Center, Militsiia mezhdu Rossiei i Chechnei. Veterany konflikta v rossiiskom obshchestve

    Directory of Open Access Journals (Sweden)

    Elisabeth Sieca-Kozlowski

    2009-03-01

    Full Text Available The Demos study on policemen who are veterans of the Chechen war is the Centre’s second in-depth study. The first dealt with the phenomenon of arbitrariness (“proizvol” in the police force. This new study focuses on one of the contributing factors of this arbitrariness, the fact of having gone through the Chechen war. Although the two Chechen conflicts (1994-1996 and 1999 to the present involved the dispatch of tens of thousands of military and members of “power” ministries to the combat zo...

  16. Assembling a game development scene? Uncovering Finland’s largest demo party

    Directory of Open Access Journals (Sweden)

    Heikki Tyni

    2014-03-01

    Full Text Available The study takes look at Assembly, a large-scale LAN and demo party founded in 1992 and organized annually in Helsinki, Finland. Assembly is used as a case study to explore the relationship between computer hobbyism – including gaming, demoscene and other related activities – and professional game development. Drawing from expert interviews, a visitor query and news coverage we ask what kind of functions Assembly has played for the scene in general, and on the formation and fostering of the Finnish game industry in particular. The conceptual contribution of the paper is constructed around the interrelated concepts of scene, technicity and gaming capital.

  17. Lessons learnt from ITER safety & licensing for DEMO and future nuclear fusion facilities

    CERN Document Server

    Taylor, Neill

    2013-01-01

    One of the strong motivations for pursuing the development of fusion energy is its potentially low environmental impact and very good safety performance. But this safety and environmental potential can only be fully realized by careful design choices. For DEMO and other fusion facilities that will require nuclear licensing, S&E objectives and criteria should be set at an early stage and taken into account when choosing basic design options and throughout the design process. Studies in recent decades of the safety of fusion power plant concepts give a useful basis on which to build the S&E approach and to assess the impact of design choices. The experience of licensing ITER is of particular value, even though there are some important differences between ITER and DEMO. The ITER project has developed a safety case, produced a preliminary safety report and had it examined by the French nuclear safety authorities, leading to the licence to construct the facility. The key technical issues that arose during ...

  18. Effects of magnetic ripple on 3D equilibrium and alpha particle confinement in the European DEMO

    Science.gov (United States)

    Pfefferlé, D.; Cooper, W. A.; Fasoli, A.; Graves, J. P.

    2016-11-01

    An assessment of alpha particle confinement is performed in the European DEMO reference design. 3D MHD equilibria with nested flux-surfaces and single magnetic axis are obtained with the VMEC free-boundary code, thereby including the plasma response to the magnetic ripple created by the finite number of TF coils. Populations of fusion alphas that are consistent with the equilibrium profiles are evolved until slowing-down with the VENUS-LEVIS orbit code in the guiding-centre approximation. Fast ion losses through the last-closed flux-surface are numerically evaluated with two ripple models: (1) using the 3D equilibrium and (2) algebraically adding the non-axisymmetric ripple perturbation to the 2D equilibrium. By virtue of the small ripple field and its non-resonant nature, both models quantitatively agree. Differences are however noted in the toroidal location of particles losses on the last-closed flux-surface, which in the first case is 3D and in the second not. Superbanana transport, i.e. ripple-well trapping and separatrix crossing, is expected to be the dominant loss mechanism, the strongest effect on alphas being between 100-200 KeV. Above this, stochastic ripple diffusion is responsible for a rather weak loss rate, as the stochastisation threshold is observed numerically to be higher than analytic estimates. The level of ripple in the current 18 TF coil design of the European DEMO is not found to be detrimental to fusion alpha confinement.

  19. Preliminary structural assessment of DEMO vacuum vessel against a vertical displacement event

    Energy Technology Data Exchange (ETDEWEB)

    Mozzillo, Rocco, E-mail: rocco.mozzillo@unina.it [CREATE, University of Naples Federico II, DII, P.le Tecchio 80, 80125, Naples (Italy); Tarallo, Andrea; Marzullo, Domenico [CREATE, University of Naples Federico II, DII, P.le Tecchio 80, 80125, Naples (Italy); Bachmann, Christian [EUROfusion PMU, Boltzmannstraße 2, 85748 Garching (Germany); Di Gironimo, Giuseppe [CREATE, University of Naples Federico II, DII, P.le Tecchio 80, 80125, Naples (Italy); Mazzone, Giuseppe [Unità Tecnica Fusione - ENEA C.R. Frascati, Via E. Fermi 45, 00044 Frascati (Italy)

    2016-11-15

    Highlights: • The paper focuses on a preliminary structural analysis of the current concept design of DEMO vacuum vessel. • The Vacuum Vessel was checked against the VDE in combinations with the weight force of all components that the vessel shall bear. • Different configurations for the vacuum vessel supports are considered, showing that the best solution is VV supported at the lower port. • The analyses evaluated the “P damage” according to RCC-MRx code. - Abstract: This paper focuses on a preliminary structural analysis of the current concept design of DEMO vacuum vessel (VV). The VV structure is checked against a vertical load due to a Vertical Displacement Event in combination with the weight force of all components that the main vessel shall bear. Different configurations for the supports are considered. Results show that the greatest safety margins are reached when the tokamak is supported through the lower ports rather than the equatorial ports, though all analyzed configurations are compliant with RCC-MRx design rules.

  20. First Observations of GNSS Ionospheric Scintillations From DemoGRAPE Project

    Science.gov (United States)

    Alfonsi, L.; Cilliers, P. J.; Romano, V.; Hunstad, I.; Correia, E.; Linty, N.; Dovis, F.; Terzo, O.; Ruiu, P.; Ward, J.; Riley, P.

    2016-10-01

    The Istituto Nazionale di Geofisica e Vulcanologia leads an international project funded by the Italian National Program for Antarctic Research, called Demonstrator of Global Navigation Satellite System (GNSS) Research and Application for Polar Environment (DemoGRAPE), in partnership with Politecnico di Torino, Istituto Superiore Mario Boella, and with South African National Space Agency and the Brazilian National Institute of Space Physics, as key collaborators. DemoGRAPE is a new prototype of support for the satellite navigation in Antarctica. Besides the scientific interest, the accuracy of satellite navigation in Antarctica is of paramount importance since there is always the danger that people and vehicles can fall into a crevasse during a snowstorm, when visibility is limited and travel is restricted to following specified routes using satellite navigation systems. The variability of ionospheric delay and ionospheric scintillation are two of the primary factors which affect the accuracy of satellite navigation. The project will provide a demonstrator of cutting edge technology for the empirical assessment of the ionospheric delay and ionospheric scintillations in the polar regions. The scope of the project includes new equipment for the recording and dissemination of GNSS data and products installed at the South African and Brazilian bases in Antarctica. The new equipment will facilitate the exchange of software and derived products via the Cloud computing technology infrastructure. The project portal is accessible at www.demogrape.net. We report the first Global Navigation Satellite System (GNSS) signal scintillations observed in Antarctica.

  1. Neutronic analyses of the preliminary design of a DCLL blanket for the EUROfusion DEMO power plant

    Energy Technology Data Exchange (ETDEWEB)

    Palermo, Iole, E-mail: iole.palermo@ciemat.es; Fernández, Iván; Rapisarda, David; Ibarra, Angel

    2016-11-01

    Highlights: • We perform neutronic calculations for the preliminary DCLL Blanket design. • We study the tritium breeding capability of the reactor. • We determine the nuclear heating in the main components. • We verify if the shielding of the TF coil is maintained. - Abstract: In the frame of the newly established EUROfusion WPBB Project for the period 2014–2018, four breeding blanket options are being investigated to be used in the fusion power demonstration plant DEMO. CIEMAT is leading the development of the conceptual design of the Dual Coolant Lithium Lead, DCLL, breeding blanket. The primary role of the blanket is of energy extraction, tritium production, and radiation shielding. With this aim the DCLL uses LiPb as primary coolant, tritium breeder and neutron multiplier and Eurofer as structural material. Focusing on the achievement of the fundamental neutronic responses a preliminary blanket model has been designed. Thus detailed 3D neutronic models of the whole blanket modules have been generated, arranged in a specific DCLL segmentation and integrated in the generic DEMO model. The initial design has been studied to demonstrate its viability. Thus, the neutronic behaviour of the blanket and of the shield systems in terms of tritium breeding capabilities, power generation and shielding efficiency has been assessed in this paper. The results demonstrate that the primary nuclear performances are already satisfactory at this preliminary stage of the design, having obtained the tritium self-sufficiency and an adequate shielding.

  2. Neutronic performance issues of the breeding blanket options for the European DEMO fusion power plant

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, U., E-mail: ulrich.fischer@kit.edu [Karlsruhe Institute of Technology (KIT), Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Bachmann, C. [EUROfusion—Programme Management Unit, Boltzmannstr. 2, 85748 Garching (Germany); Jaboulay, J.-C. [CEA-Saclay, DEN, DM2S, SERMA, LPEC, 91191 Gif-sur-Yvette (France); Moro, F. [ENEA, Dipartimento Fusione e tecnologie per la Sicurezza Nucleare, Via E. Fermi 45, 00044 Frascati, Rome (Italy); Palermo, I. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (CIEMAT), Madrid (Spain); Pereslavtsev, P. [Karlsruhe Institute of Technology (KIT), Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Villari, R. [ENEA, Dipartimento Fusione e tecnologie per la Sicurezza Nucleare, Via E. Fermi 45, 00044 Frascati, Rome (Italy)

    2016-11-01

    Highlights: • Breeder blanket concepts for DEMO—design features. • Neutronic characteristics of breeder blankets. • Evaluation of Tritium breeding potential. • Evaluation of shielding performance. - Abstract: This paper presents nuclear performance issues of the HCPB, HCLL, DCLL and WCLL breeder blankets, which are under development within the PPPT (Power Plant Physics and Technology) programme of EUROfusion, with the objective to assess the potential and suitability of the blankets for the application to DEMO. The assessment is based on the initial design versions of the blankets developed in 2014. The Tritium breeding potential is considered sufficient for all breeder blankets although the initial design versions of the HCPB, HCLL and DCLL blankets were shown to require further design improvements. Suitable measures have been proposed and proven to be sufficient to achieve the required Tritium Breeding Ratio (TBR) ≥ 1.10. The shielding performance was shown to be sufficient to protect the super-conducting toroidal field coil provided that efficient shielding material mixtures including WC or borated water are utilized. The WCLL blanket does not require the use of such shielding materials due to a very compact blanket support structure/manifold configuration which yet requires design verification. The vacuum vessel can be safely operated over the full anticipated DEMO lifetime of 6 full power years for all blanket concepts considered.

  3. Archimede solar energy molten salt parabolic trough demo plant: Improvements and second year of operation

    Science.gov (United States)

    Maccari, Augusto; Donnola, Sandro; Matino, Francesca; Tamano, Shiro

    2016-05-01

    Since July 2013, the first stand-alone Molten Salt Parabolic Trough (MSPT) demo plant, which was built in collaboration with Archimede Solar Energy and Chiyoda Corporation, is in operation, located adjacent to the Archimede Solar Energy (ASE) manufacturing plant in Massa Martana (Italy). During the two year's operating time frame, the management of the demo plant has shown that MSPT technology is a suitable and reliable option. Several O&M procedures and tests have been performed, as Heat Loss and Minimum Flow Test, with remarkable results confirming that this technology is ready to be extended to standard size CSP plant, if the plant design takes into account molten salt peculiarities. Additionally, the plant has been equipped on fall 2014 with a Steam Generator system by Chiyoda Corporation, in order to test even this important MSPT plant subsystem and to extend the solar field active time, overcoming the previous lack of an adequate thermal load. Here, a description of the plant improvements and the overall plant operation figures will be presented.

  4. A DEMO relevant fast wave current drive high harmonic antenna exploiting the high impedance technique

    Science.gov (United States)

    Milanesio, D.; Maggiora, R.

    2015-12-01

    Ion Cyclotron (IC) antennas are routinely adopted in most of the existing nuclear fusion experiments, even though their main goal, i.e. to couple high power to the plasma (MW), is often limited by rather severe drawbacks due to high fields on the antenna itself and on the unmatched part of the feeding lines. In addition to the well exploited auxiliary ion heating during the start-up phase, some non-ohmic current drive (CD) at the IC range of frequencies may be explored in view of the DEMO reactor. In this work, we suggest and describe a compact high frequency DEMO relevant antenna, based on the high impedance surfaces concept. High-impedance surfaces are periodic metallic structures (patches) usually displaced on top of a dielectric substrate and grounded by means of vertical posts embedded inside the dielectric, in a mushroom-like shape. These structures present a high impedance, within a given frequency band, such that the image currents are in-phase with the currents of the antenna itself, thus determining a significant efficiency increase. After a general introduction on the properties of high impedance surfaces, we analyze, by means of numerical codes, a dielectric based and a full metal solution optimized to be tested and benchmarked on the FTU experiment fed with generators at 433MHz.

  5. Materials for DEMO and reactor applications—boundary conditions and new concepts

    Science.gov (United States)

    Coenen, J. W.; Antusch, S.; Aumann, M.; Biel, W.; Du, J.; Engels, J.; Heuer, S.; Houben, A.; Hoeschen, T.; Jasper, B.; Koch, F.; Linke, J.; Litnovsky, A.; Mao, Y.; Neu, R.; Pintsuk, G.; Riesch, J.; Rasinski, M.; Reiser, J.; Rieth, M.; Terra, A.; Unterberg, B.; Weber, Th; Wegener, T.; You, J.-H.; Linsmeier, Ch

    2016-02-01

    DEMO is the name for the first stage prototype fusion reactor considered to be the next step after ITER towards realizing fusion. For the realization of fusion energy especially, materials questions pose a significant challenge already today. Heat, particle and neutron loads are a significant problem to material lifetime when extrapolating to DEMO. For many of the issues faced, advanced materials solutions are under discussion or already under development. In particular, components such as the first wall and the divertor of the reactor can benefit from introducing new approaches such as composites or new alloys into the discussion. Cracking, oxidation as well as fuel management are driving issues when deciding for new materials. Here {{{W}}}{{f}}/{{W}} composites as well as strengthened CuCrZr components together with oxidation resilient tungsten alloys allow the step towards a fusion reactor. In addition, neutron induced effects such as transmutation, embrittlement and after-heat and activation are essential. Therefore, when designing a component an approach taking into account all aspects is required.

  6. Endogenising demographic variables in demo-economic models: the Bachue experience.

    Science.gov (United States)

    Wery, R; Rodgers, G

    1980-01-01

    The attempt is made in this discussion to describe and draw lessons from the treatment of behavioral demographic variables in the Bachue demo-economic models constructed for the Philippines, Kenya, Brazil and Yugoslavia. Focus is on certain theoretical, technical and practical problems encountered in inserting demographic variables in the system as a whole; how they have been measured in the various applications of the Bachue models, how they are behaviorally explained and linked to the other elements in the system, the data sources used, and some issues of econometric estimates and modelling. 8 issues are dealt with: population accounting and lag structure; fertility; mortality; migration; nuptiality; household formation; schooling; and labor force participation. In each case model structure, dependent and explanatory variables, and empirical strategy are discussed. Summary tables compare the approaches of the different models. The specifics of each country situation rule out the identification of the best solution. Some suggestions regarding more promising approaches are included with respect to choice of variables and the estimation of behavioral models. The endogenous nature of certain demographic elements of a demo-economic model are clear, but construction of the Bachue models has shown that there are no exact rules valid for all cases. There is considerable variety in the way characteristics of the population have been represented in the various applications.

  7. Experimental study on the CFB-FGD of semi-dry process in a demo plant

    Energy Technology Data Exchange (ETDEWEB)

    Tong, H.; Wang, X.; Liu, Q. (and others) [Tsinghua University, Beijing (China). State Key Laboratory of Clean Combustion of Coal

    2003-07-01

    A CFB-FGD demo-plant was established near the pilot power plant of Tsinghua University, with a flue gas capacity of 20,000 Nm{sup 3}/h. The detailed structure and characteristics of the absorber are described in the paper. A series of experiments about how the desulfurization efficiency was influenced by various factors were conducted on this facility, such as sorbent properties, ratio of Ca/S, solids concentration, Approach to Saturation Temperature (ASAT) and CaCl{sub 2} additives. In the meantime the practical problems to be considered in the commercial design were studied too. The experiments shows that 85% desulfurization efficiency is achieved while the ratio of Ca/S is 1.3 and the ASAT is 7{sup o}C. Under the condition that the additive is added in the slurry the ASAT is reduced slightly and the desulfurization efficiency can reach 90%. This demo-plant established the strong base for the commercial use of the technology. 5 refs., 7 figs.

  8. A DEMO relevant fast wave current drive high harmonic antenna exploiting the high impedance technique

    Energy Technology Data Exchange (ETDEWEB)

    Milanesio, D., E-mail: daniele.milanesio@polito.it; Maggiora, R. [Politecnico di Torino, Dipartimento di Elettronica e Telecomunicazioni (DET), Torino (Italy)

    2015-12-10

    Ion Cyclotron (IC) antennas are routinely adopted in most of the existing nuclear fusion experiments, even though their main goal, i.e. to couple high power to the plasma (MW), is often limited by rather severe drawbacks due to high fields on the antenna itself and on the unmatched part of the feeding lines. In addition to the well exploited auxiliary ion heating during the start-up phase, some non-ohmic current drive (CD) at the IC range of frequencies may be explored in view of the DEMO reactor. In this work, we suggest and describe a compact high frequency DEMO relevant antenna, based on the high impedance surfaces concept. High-impedance surfaces are periodic metallic structures (patches) usually displaced on top of a dielectric substrate and grounded by means of vertical posts embedded inside the dielectric, in a mushroom-like shape. These structures present a high impedance, within a given frequency band, such that the image currents are in-phase with the currents of the antenna itself, thus determining a significant efficiency increase. After a general introduction on the properties of high impedance surfaces, we analyze, by means of numerical codes, a dielectric based and a full metal solution optimized to be tested and benchmarked on the FTU experiment fed with generators at 433MHz.

  9. AC susceptibilities of grain-textured superconductors

    Science.gov (United States)

    Sakamoto, N.; Fukuda, Y.; Koga, M.; Akune, T.; Khan, H. R.; Lüders, K.

    2008-09-01

    In-phase χ n‧ and out-phase χ n″ components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field Bdc, an amplitude Ba and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low- Tc metallic superconductors, χ1‧ shows smooth transition and χ1″ does single peak. High- Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in χ1″ and shoulders in χ1‧ appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  10. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  11. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  12. Evaluation of Demo 1C composite flywheel rotor burst test and containment design

    Energy Technology Data Exchange (ETDEWEB)

    Kass, M.D.; McKeever, J.W.; Akerman, M.A.; Goranson, P.L.; Litherland, P.S.; O`Kain, D.U.

    1998-07-01

    Laboratory-Directed funds were provided in FY 1995 for research to develop flywheel containment specifications and to consider concepts that could satisfy these specifications and produce a prototype small, lightweight, inexpensive, mobile flywheel containment. Research activities have included an analytical and pictorial review of the Demo 1C flywheel failure test, which provided significant insight about radial and axial failure modes; calculations of the thickness of ultra-conservative pressure vessel containment; entertainment of advanced containment concepts using lightweight materials and armor literature; consideration of fabrication assembly procedures; and participation in a Flywheel Energy Storage Workshop during which additional flywheel failure experiences were discussed. Based on these activities, calculations, and results, a list of conclusions concerning flywheel containment and its relation to the flywheel are presented followed by recommendations for further research.

  13. Operation and first results of the NEXT-DEMO prototype using a silicon photomultiplier tracking array

    CERN Document Server

    Álvarez, V; Cárcel, S; Castel, J; Cebrián, S; Cervera, A; Conde, C A N; Dafni, T; Dias, T H V T; Díaz, J; Egorov, M; Esteve, R; Evtoukhovitch, P; Fernandes, L M P; Ferrario, P; Ferreira, A L; Freitas, E D C; Gehman, V M; Gil, A; Goldschmidt, A; Gómez, H; Gómez-Cadenas, J J; González-Díaz, D; Gutiérrez, R M; Hauptman, J; Morata, J A Hernando; Herrera, D C; Iguaz, F J; Irastorza, I G; Jinete, M A; Labarga, L; Laing, A; Liubarsky, I; Lopes, J A M; Lorca, D; Losada, M; Luzón, G; Marí, A; Martín-Albo, J; Martínez, A; Martínez, G; Miller, T; Moiseenko, A; Monrabal, F; Monteiro, C M B; Mora, F J; Moutinho, L M; Vidal, J Muñoz; da Luz, H Natal; Navarro, G; Nebot-Guinot, M; Nygren, D; Oliveira, C A B; Palma, R; Pérez, J; Aparicio, J L Pérez; Renner, J; Ripoll, L; Rodríguez, A; Rodríguez, J; Santos, F P; Santos, J M F dos; Seguí, L; Serra, L; Shuman, D; Simón, A; Sofka, C; Sorel, M; Toledo, J F; Tomás, A; Torrent, J; Tsamalaidze, Z; Veloso, J F C A; Villar, J A; Webb, R; White, J T; Yahlali, N

    2013-01-01

    NEXT-DEMO is a high-pressure xenon gas TPC which acts as a technological test-bed and demonstrator for the NEXT-100 neutrinoless double beta decay experiment. In its current configuration the apparatus fully implements the NEXT-100 design concept. This is an asymmetric TPC, with an energy plane made of photomultipliers and a tracking plane made of silicon photomultipliers (SiPM) coated with TPB. The detector in this new configuration has been used to reconstruct the characteristic signature of electrons in dense gas. Demonstrating the ability to identify the MIP and ``blob'' regions. Moreover, the SiPM tracking plane allows for the definition of a large fiducial region in which an excellent energy resolution of 1.82% FWHM at 511 keV has been measured (a value which extrapolates to 0.83% at the xenon Qbetabeta).

  14. Latest results of NEXT-DEMO, the prototype of the NEXT 100 double beta decay experiment

    CERN Document Server

    Serra, L; Martin-Albo, J; Sorel, M; Gomez-Cadenas, J J

    2014-01-01

    NEXT-DEMO is a 1:4.5 scale prototype of the NEXT100 detector, a high-pressure xenon gas TPC that will search for the neutrinoless double beta decay of $^{136}$Xe. X-ray energy depositions produced by the de-excitation of Xenon atoms after the interaction of gamma rays from radioactive sources have been used to characterize the response of the detector obtaining the spatial calibration needed for close-to-optimal energy resolution. Our result, 5.5% FWHM at 30 keV, extrapolates to 0.6% FWHM at the Q value of $^{136}$Xe. Additionally, alpha decays from radon have been used to measure several detection properties and parameters of xenon gas such as electron-ion recombination, electron drift velocity, diffusion and primary scintillation light yield. Alpha spectroscopy is also used to quantify the activity of radon inside the detector, a potential source of background for most double beta decay experiments.

  15. Assembly and test of the W7-X demo-cryostat

    Energy Technology Data Exchange (ETDEWEB)

    Schauer, F. E-mail: schauer@ipp.mpg.de; Bau, H.; Bojko, I.; Brockmann, R.; Feist, J.-H.; Hein, B.; Pieger-Frey, M.; Pirsch, H.; Sapper, J.; Sombach, B.; Stadlbauer, J.; Volzke, O.; Wald, I.; Wanner, M

    2001-10-01

    An overview is given on the status of the demo-cryostat project for the WENDELSTEIN 7-X stellarator. Construction and assembly of the prototype are finished, and the test period is near completion. The intention of this project was to get experience with design and construction of W7-X-components, as well as with assembly of this complex system. The goal is now practically achieved, and it could be demonstrated that the W7-X cryostat can be built with reasonable effort. Many of the solutions found can be adopted directly for W7-X, or are starting points for further improvements. A short description is given of the cryostat, its assembly, and of the most important tests which were performed so far.

  16. Transient Mirror Heating Theory and Experiment in the Jefferson Lab IR Demo FEL

    Energy Technology Data Exchange (ETDEWEB)

    Benson, S.; Michelle D. Shinn.; Neil, G.R.

    2001-01-01

    During commissioning of the IR Demo FEL at Jefferson Lab, we noticed that the FEL exhibited a rapid power drop with time when the first set of 3 mu-m mirrors was used. Thought the rate of power drop was unexpected, it was thought that it could be due to a distortion of the mirrors during a time short compared to a the thermal diffusion time. This transient distortion might affect the laser more than the steady state distortion. This paper presents some analysis of the transient mirror heating problem and some recent experimental results using different mirror substrates and coatings. It is found that the behavior of the first mirror set cannot be reconciled with the observed power fall-off if a linear absorption is assumed. The power drop in more recent experiments is consistent with linear thermal analysis. No anomalous transient effects are seen.

  17. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  18. Gyrotron development at KIT: FULGOR test facility and gyrotron concepts for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Schmid, M., E-mail: martin.schmid@kit.edu [Institute for Pulsed Power and Microwave Technology (IHM), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Franck, J.; Kalaria, P.; Avramidis, K.A.; Gantenbein, G.; Illy, S. [Institute for Pulsed Power and Microwave Technology (IHM), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Jelonnek, J. [Institute for Pulsed Power and Microwave Technology (IHM), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Institute of High Frequency Techniques and Electronics (IHE), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Pagonakis, I. Gr.; Rzesnicki, T. [Institute for Pulsed Power and Microwave Technology (IHM), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Thumm, M. [Institute for Pulsed Power and Microwave Technology (IHM), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Institute of High Frequency Techniques and Electronics (IHE), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany)

    2015-10-15

    Highlights: • Substantial extension of the KIT gyrotron test facility FULGOR has started. • FULGOR will be able to test gyrotrons with continuous RF output power up to 4 MW. • Design of 240 GHz gyrotrons for efficient electron cyclotron current drive is progressing. • Output power of 240 GHz gyrotrons with conventional cavity up to 830 kW, with coaxial cavity up to 2 MW is feasible. • Multi-frequency operation with gyrotrons is also possible (170–267 GHz). - Abstract: At the Karlsruhe Institute of Technology (KIT), theoretical and experimental foundations for the development of future gyrotrons for fusion applications are being laid down. This includes the construction of the new Fusion Long Pulse Gyrotron Laboratory (FULGOR) test facility as well as physical design studies towards DEMO-compatible gyrotrons. Initially FULGOR will comprise of a 10 MW CW power supply, a 5 MW water cooling system (upgradeable to 10 MW), a superconducting 10 T magnet, one or two 2 MW ECRH test loads and a new control and data acquisition system for all these elements. The test facility will then be equipped to test the conventional 1 MW or coaxial 2 MW gyrotrons for DEMO, currently under design, as well as possible upgraded gyrotrons for W7-X and ITER. The design of the new high voltage DC power supply (HVDCPS) is flexible enough to handle gyrotrons with 4 MW CW output power (conceivably up to 170 GHz), but also test gyrotrons with higher frequencies (>250 GHz) which, due to physical limitations in the gyrotron design, will require less power but have more stringent demands on voltage stability.

  19. Tokamak DEMO-FNS: Concept of magnet system and vacuum chamber

    Science.gov (United States)

    Azizov, E. A.; Ananyev, S. S.; Belyakov, V. A.; Bondarchuk, E. N.; Voronova, A. A.; Golikov, A. A.; Goncharov, P. R.; Dnestrovskij, A. Yu.; Zapretilina, E. R.; Ivanov, D. P.; Kavin, A. A.; Kedrov, I. V.; Klischenko, A. V.; Kolbasov, B. N.; Krasnov, S. V.; Krylov, A. I.; Krylov, V. A.; Kuzmin, E. G.; Kuteev, B. V.; Labusov, A. N.; Lukash, V. E.; Maximova, I. I.; Medvedev, S. Yu.; Mineev, A. B.; Muratov, V. P.; Petrov, V. S.; Rodin, I. Yu.; Sergeev, V. Yu.; Spitsyn, A. V.; Tanchuk, V. N.; Trofimov, V. A.; Khayrutdinov, R. R.; Khokhlov, M. V.; Shpanskiy, Yu. S.

    2016-12-01

    The level of knowledge accumulated to date in the physics and technologies of controlled thermonuclear fusion (CTF) makes it possible to begin designing fusion—fission hybrid systems that would involve a fusion neutron source (FNS) and which would admit employment for the production of fissile materials and for the transmutation of spent nuclear fuel. Modern Russian strategies for CTF development plan the construction to 2023 of tokamak-based demonstration hybrid FNS for implementing steady-state plasma burning, testing hybrid blankets, and evolving nuclear technologies. Work on designing the DEMO-FNS facility is still in its infancy. The Efremov Institute began designing its magnet system and vacuum chamber, while the Kurchatov Institute developed plasma-physics design aspects and determined basic parameters of the facility. The major radius of the plasma in the DEMO-FNS facility is R = 2.75 m, while its minor radius is a = 1 m; the plasma elongation is k 95 = 2. The fusion power is P FUS = 40 MW. The toroidal magnetic field on the plasma-filament axis is B t0 = 5 T. The plasma current is I p = 5 MA. The application of superconductors in the magnet system permits drastically reducing the power consumed by its magnets but requires arranging a thick radiation shield between the plasma and magnet system. The central solenoid, toroidal-field coils, and poloidal-field coils are manufactured from, respectively, Nb3Sn, NbTi and Nb3Sn, and NbTi. The vacuum chamber is a double-wall vessel. The space between the walls manufactured from 316L austenitic steel is filled with an iron—water radiation shield (70% of stainless steel and 30% of water).

  20. Quasi-linear modeling of lower hybrid current drive in ITER and DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Cardinali, A., E-mail: alessandro.cardinali@enea.it; Cesario, R.; Panaccione, L.; Santini, F.; Amicucci, L.; Castaldo, C.; Ceccuzzi, S.; Mirizzi, F.; Tuccillo, A. A. [ENEA, Unità Tecnica Fusione, Via E Fermi 45 Rome (Italy)

    2015-12-10

    First pass absorption of the Lower Hybrid waves in thermonuclear devices like ITER and DEMO is modeled by coupling the ray tracing equations with the quasi-linear evolution of the electron distribution function in 2D velocity space. As usually assumed, the Lower Hybrid Current Drive is not effective in a plasma of a tokamak fusion reactor, owing to the accessibility condition which, depending on the density, restricts the parallel wavenumber to values greater than n{sub ∥crit} and, at the same time, to the high electron temperature that would enhance the wave absorption and then restricts the RF power deposition to the very periphery of the plasma column (near the separatrix). In this work, by extensively using the “ray{sup star}” code, a parametric study of the propagation and absorption of the LH wave as function of the coupled wave spectrum (as its width, and peak value), has been performed very accurately. Such a careful investigation aims at controlling the power deposition layer possibly in the external half radius of the plasma, thus providing a valuable aid to the solution of how to control the plasma current profile in a toroidal magnetic configuration, and how to help the suppression of MHD mode that can develop in the outer part of the plasma. This analysis is useful not only for exploring the possibility of profile control of a pulsed operation reactor as well as the tearing mode stabilization, but also in order to reconsider the feasibility of steady state regime for DEMO.

  1. Find the weakest link. A comparison between demographic, genetic and demo-genetic metapopulation extinction times

    Directory of Open Access Journals (Sweden)

    Robert Alexandre

    2011-09-01

    Full Text Available Abstract Background While the ultimate causes of most species extinctions are environmental, environmental constraints have various secondary consequences on evolutionary and ecological processes. The roles of demographic, genetic mechanisms and their interactions in limiting the viabilities of species or populations have stirred much debate and remain difficult to evaluate in the absence of demography-genetics conceptual and technical framework. Here, I computed projected times to metapopulation extinction using (1 a model focusing on the effects of species properties, habitat quality, quantity and temporal variability on the time to demographic extinction; (2 a genetic model focusing on the dynamics of the drift and inbreeding loads under the same species and habitat constraints; (3 a demo-genetic model accounting for demographic-genetic processes and feedbacks. Results Results indicate that a given population may have a high demographic, but low genetic viability or vice versa; and whether genetic or demographic aspects will be the most limiting to overall viability depends on the constraints faced by the species (e.g., reduction of habitat quantity or quality. As a consequence, depending on metapopulation or species characteristics, incorporating genetic considerations to demographically-based viability assessments may either moderately or severely reduce the persistence time. On the other hand, purely genetically-based estimates of species viability may either underestimate (by neglecting demo-genetic interactions or overestimate (by neglecting the demographic resilience true viability. Conclusion Unbiased assessments of the viabilities of species may only be obtained by identifying and considering the most limiting processes (i.e., demography or genetics, or, preferentially, by integrating them.

  2. Activation, decay heat, and waste classification studies of the European DEMO concept

    Science.gov (United States)

    Gilbert, M. R.; Eade, T.; Bachmann, C.; Fischer, U.; Taylor, N. P.

    2017-04-01

    Inventory calculations have a key role to play in designing future fusion power plants because, for a given irradiation field and material, they can predict the time evolution in chemical composition, activation, decay heat, gamma-dose, gas production, and even damage (dpa) dose. For conceptual designs of the European DEMO fusion reactor such calculations provide information about the neutron shielding requirements, maintenance schedules, and waste disposal prospects; thereby guiding future development. Extensive neutron-transport and inventory calculations have been performed for a reference DEMO reactor model with four different tritium-breeding blanket concepts. The results have been used to chart the post-operation variation in activity and decay heat from different vessel components, demonstrating that the shielding performance of the different blanket concepts—for a given blanket thickness—varies significantly. Detailed analyses of the simulated nuclide inventories for the vacuum vessel (VV) and divertor highlight the most dominant radionuclides, potentially suggesting how changes in material composition could help to reduce activity. Minor impurities in the raw composition of W used in divertor tiles, for example, are shown to produce undesirable long-lived radionuclides. Finally, waste classifications, based on UK regulations, and a recycling potential limit, have been applied to estimate the time-evolution in waste masses for both the entire vessel (including blanket modules, VV, divertor, and some ex-vessel components) and individual components, and also to suggest when a particular component might be suitable for recycling. The results indicate that the large mass of the VV will not be classifiable as low level waste on the 100 year timescale, but the majority of the divertor will be, and that both components will be potentially recyclable within that time.

  3. Three-dimensional easy morphological (3-DEMO classification of scoliosis, part I

    Directory of Open Access Journals (Sweden)

    Negrini Alberto

    2006-12-01

    Full Text Available Abstract Background While scoliosis has, for a long time, been defined as a three-dimensional (3D deformity, morphological classifications are confined to the two dimensions of radiographic assessments. The actually existing 3-D classification proposals have been developed in research laboratories and appear difficult to be understood by clinicians. Aim of the study The aim of this study was to use the results of a 3D evaluation to obtain a simple and clinically oriented morphological classification (3-DEMO that might make it possible to distinguish among different populations of scoliotic patients. Method We used a large database of evaluations obtained through an optoelectronic system (AUSCAN that gives a 3D reconstruction of the spine. The horizontal view was used, with a spinal reference system (Top View. An expert clinician evaluated the morphological reconstruction of 149 pathological spines in order to find parameters that could be used for classificatory ends. These were verified in a mathematical way and through computer simulations: some parameters had to be excluded. Pathological data were compared with those of 20 normal volunteers. Results We found three classificatory parameters, which are fully described and discussed in this paper: Direction, the angle between spinal pathological and normal AP axis; Shift, the co-ordinates of the barycentre of the Top View ; Phase, the parameter describing the spatial evolution of the curve. Using these parameters it was possible to distinguish normal and pathological spines, to classify our population and to differentiate scoliotic patients with identical AP classification but different 3D behaviors. Conclusion The 3-DEMO classification offers a new and simple way of viewing the spine through an auxiliary plane using a spinal reference system. Further studies are currently under way to compare this new system with the existing 3-D classifications, to obtain it using everyday clinical and x

  4. Tokamak DEMO-FNS: Concept of magnet system and vacuum chamber

    Energy Technology Data Exchange (ETDEWEB)

    Azizov, E. A., E-mail: Azizov-EA@nrcki.ru; Ananyev, S. S. [National Research Center Kurchatov Institute (Russian Federation); Belyakov, V. A.; Bondarchuk, E. N.; Voronova, A. A. [D.V. Efremov Scientific Research Institute of Electrophysical Apparatus (Russian Federation); Golikov, A. A. [National Research Center Kurchatov Institute (Russian Federation); Goncharov, P. R. [Peter the Great St. Petersburg Polytechnic University (Russian Federation); Dnestrovskij, A. Yu. [National Research Center Kurchatov Institute (Russian Federation); Zapretilina, E. R. [D.V. Efremov Scientific Research Institute of Electrophysical Apparatus (Russian Federation); Ivanov, D. P. [National Research Center Kurchatov Institute (Russian Federation); Kavin, A. A.; Kedrov, I. V. [D.V. Efremov Scientific Research Institute of Electrophysical Apparatus (Russian Federation); Klischenko, A. V.; Kolbasov, B. N. [National Research Center Kurchatov Institute (Russian Federation); Krasnov, S. V. [D.V. Efremov Scientific Research Institute of Electrophysical Apparatus (Russian Federation); Krylov, A. I. [National Research Center Kurchatov Institute (Russian Federation); Krylov, V. A.; Kuzmin, E. G. [D.V. Efremov Scientific Research Institute of Electrophysical Apparatus (Russian Federation); Kuteev, B. V. [National Research Center Kurchatov Institute (Russian Federation); Labusov, A. N. [D.V. Efremov Scientific Research Institute of Electrophysical Apparatus (Russian Federation); and others

    2016-12-15

    The level of knowledge accumulated to date in the physics and technologies of controlled thermonuclear fusion (CTF) makes it possible to begin designing fusion—fission hybrid systems that would involve a fusion neutron source (FNS) and which would admit employment for the production of fissile materials and for the transmutation of spent nuclear fuel. Modern Russian strategies for CTF development plan the construction to 2023 of tokamak-based demonstration hybrid FNS for implementing steady-state plasma burning, testing hybrid blankets, and evolving nuclear technologies. Work on designing the DEMO-FNS facility is still in its infancy. The Efremov Institute began designing its magnet system and vacuum chamber, while the Kurchatov Institute developed plasma-physics design aspects and determined basic parameters of the facility. The major radius of the plasma in the DEMO-FNS facility is R = 2.75 m, while its minor radius is a = 1 m; the plasma elongation is k{sub 95} = 2. The fusion power is P{sub FUS} = 40 MW. The toroidal magnetic field on the plasma-filament axis is B{sub t0} = 5 T. The plasma current is I{sub p} = 5 MA. The application of superconductors in the magnet system permits drastically reducing the power consumed by its magnets but requires arranging a thick radiation shield between the plasma and magnet system. The central solenoid, toroidal-field coils, and poloidal-field coils are manufactured from, respectively, Nb{sub 3}Sn, NbTi and Nb{sub 3}Sn, and NbTi. The vacuum chamber is a double-wall vessel. The space between the walls manufactured from 316L austenitic steel is filled with an iron—water radiation shield (70% of stainless steel and 30% of water).

  5. Integration of Communication Analysis and the OO Method: Manual derivation of the Conceptual Model. The SuperStationery Co. lab demo

    CERN Document Server

    España, Sergio; Pastor, Óscar; Ruiz, Marcela

    2011-01-01

    This document presents a lab demo that exemplifies the manual derivation of an OO Method conceptual model, taking as input a Communication Analysis requirements model. In addition, it is described how the conceptual model is created in the OLIVANOVA Modeler tool. The lab demo corresponds to part of the business processes of a fictional small and medium enterprise named SuperStationery Co. This company provides stationery and office material to its clients. The company acts as a as intermediary: the company has a catalogue of products that are bought from suppliers and sold to clients. This lab demo, besides illustrating the derivation technique, demonstrates that the technique is feasible in practice. Also, the results of this lab demo provide a valuable feedback in order to improve the derivation technique.

  6. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  7. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  8. Systematic cavity design approach for a multi-frequency gyrotron for DEMO and study of its RF behavior

    Science.gov (United States)

    Kalaria, P. C.; Avramidis, K. A.; Franck, J.; Gantenbein, G.; Illy, S.; Pagonakis, I. Gr.; Thumm, M.; Jelonnek, J.

    2016-09-01

    High frequency (>230 GHz) megawatt-class gyrotrons are planned as RF sources for electron cyclotron resonance heating and current drive in DEMOnstration fusion power plants (DEMOs). In this paper, for the first time, a feasibility study of a 236 GHz DEMO gyrotron is presented by considering all relevant design goals and the possible technical limitations. A mode-selection procedure is proposed in order to satisfy the multi-frequency and frequency-step tunability requirements. An effective systematic design approach for the optimal design of a gradually tapered cavity is presented. The RF-behavior of the proposed cavity is verified rigorously, supporting 920 kW of stable output power with an interaction efficiency of 36% including the considerations of realistic beam parameters.

  9. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  10. Progress of R&D on water cooled ceramic breeder for ITER test blanket system and DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Kawamura, Yoshinori, E-mail: kawamura.yoshinori@jaea.go.jp [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan); Tanigawa, Hisashi; Hirose, Takanori; Enoeda, Mikio [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan); Sato, Satoshi [Japan Atomic Energy Agency, 2-4 Shirane Shirakata, Tokai, Ibaraki 319-1195 (Japan); Ochiai, Kentaro [Japan Atomic Energy Agency, 2-166 Omotedate Obuchi, Rokkasho, Aomori 039-3212 (Japan); Konno, Chikara; Edao, Yuki; Hayashi, Takumi [Japan Atomic Energy Agency, 2-4 Shirane Shirakata, Tokai, Ibaraki 319-1195 (Japan); Hoshino, Tsuyoshi; Nakamichi, Masaru; Tanigawa, Hiroyasu [Japan Atomic Energy Agency, 2-166 Omotedate Obuchi, Rokkasho, Aomori 039-3212 (Japan); Nishi, Hiroshi; Suzuki, Satoshi; Ezato, Koichiro; Seki, Yohji [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan); Yamanishi, Toshihiko [Japan Atomic Energy Agency, 2-166 Omotedate Obuchi, Rokkasho, Aomori 039-3212 (Japan)

    2016-11-01

    Highlights: • Thermo-hydraulic calculation in the TBM at the water ingress event has been done. • Shielding calculations for the ITER equatorial port #18 were conducted by using C-lite model. • Prototypic pebbles of Be{sub 17}Ti{sub 2} and Be{sub 12}V had a good oxidation property similar to Be{sub 12}Ti pebble. • Li rich Li{sub 2}TiO{sub 3} pebbles were successfully fabricated using the emulsion method by controlling sintering atmosphere. • New tritium production/recovery experiments at FNS have been started by using ionization chamber as on-line gas monitor. - Abstract: The development of a water cooled ceramic breeder (WCCB) test blanket module (TBM) is being performed as one of the most important steps toward DEMO blanket in Japan. For the TBM testing and development of DEMO blanket, R&D has been performed on the module fabrication technology, breeder and multiplier pebble fabrication technology, tritium production rate evaluation, as well as structural and safety design activities. The fabrication of full-scale first wall, side walls, breeder pebble bed box and back wall was completed, and assembly of TBM with box structure was successfully achieved. Development of advanced breeder and multiplier pebbles for higher chemical stability was continued for future DEMO blanket application. From the view point of TBM test result evaluation and DEMO blanket performance design, the development of the blanket tritium transport simulation technology, investigation of the TBM neutron measurement technology and the evaluation of the tritium production and recovery test using D-T neutron in the fusion neutron source (FNS) facility has been performed. This paper provides an overview of the recent achievements of the development of the WCCB Blanket in Japan.

  11. Characterization of high temperature superconductor cables for magnet toroidal field coils of the DEMO fusion power plant

    Energy Technology Data Exchange (ETDEWEB)

    Bayer, Christoph M.

    2017-05-01

    Nuclear fusion is a key technology to satisfy the basic demand for electric energy sustainably. The official EUROfusion schedule foresees a first industrial DEMOnstration Fusion Power Plant for 2050. In this work several high temperature superconductor sub-size cables are investigated for their applicability in large scale DEMO toroidal field coils. Main focus lies on the electromechanical stability under the influence of high Lorentz forces at peak magnetic fields of up to 12 T.

  12. Development of thermal-hydraulic analysis methodology for multiple modules of water-cooled breeder blanket in fusion DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Geon-Woo; Lee, Jeong-Hun [Department of Nuclear Engineering, Seoul National University 1 Gwanak-ro, Gwanak-gu, Seoul 151-744 (Korea, Republic of); Cho, Hyoung-Kyu, E-mail: chohk@snu.ac.kr [Department of Nuclear Engineering, Seoul National University 1 Gwanak-ro, Gwanak-gu, Seoul 151-744 (Korea, Republic of); Park, Goon-Cherl [Department of Nuclear Engineering, Seoul National University 1 Gwanak-ro, Gwanak-gu, Seoul 151-744 (Korea, Republic of); Im, Kihak [National Fusion Research Institute, 169-148, Yuseong-gu, Daejeon 305-806 (Korea, Republic of)

    2016-02-15

    Highlights: • A methodology to simulate the K-DEMO blanket system was proposed. • The results were compared with the CFD, to verify the prediction capability of MARS. • 46 Blankets in a single sector in K-DEMO were simulated using MARS-KS. • Supervisor program was devised to handle each blanket module individually. • The calculation results showed the flow rates, pressure drops, and temperatures. - Abstract: According to the conceptual design of the fusion DEMO reactor proposed by the National Fusion Research Institute of Korea, the water-cooled breeding blanket system incorporates a total of 736 blanket modules. The heat flux and neutron wall loading to each blanket module vary along their poloidal direction, and hence, thermal analysis for at least one blanket sector is required to confirm that the temperature limitations of the materials are satisfied in all the blanket modules. The present paper proposes a methodology of thermal analysis for multiple modules of the blanket system using a nuclear reactor thermal-hydraulic analysis code, MARS-KS. In order to overcome the limitations of the code, caused by the restriction on the number of computational nodes, a supervisor program was devised, which handles each blanket module separately at first, and then corrects the flow rate, considering pressure drops that occur in each module. For a feasibility test of the proposed methodology, 46 blankets in a single sector were simulated; the calculation results of the parameters, such as mass flow, pressure drops, and temperature distribution in the multiple blanket modules showed that the multi-module analysis method can be used for efficient thermal-hydraulic analysis of the fusion DEMO reactor.

  13. GENDER EQUALITY IN POLITICS IN NEPAL : the Role of Demo Finland to Promote Gender Equality in Nepalese Politics

    OpenAIRE

    2015-01-01

    The research aims to focus on unequal gender power relation and women’s role in decision-making process in the politics in Nepal. This study also evaluates the role of Demo Finland, a Non-Governmental Organization to politically empower women through its project called Mobilizing Youth for Gender Equality in Politics. The study is based on the qualitative research method. A thematic data analysis is used to analyze the data collected from field. The unstructured interview was conducted w...

  14. DTT: a divertor tokamak test facility for the study of the power exhaust issues in view of DEMO

    Science.gov (United States)

    Albanese, R.; WPDTT2 Team; DTT Project Proposal Contributors, the

    2017-01-01

    In parallel with the programme to optimize the operation with a conventional divertor based on detached conditions to be tested on the ITER device, a project has been launched to investigate alternative power exhaust solutions for DEMO, aimed at the definition and the design of a divertor tokamak test facility (DTT). The DTT project proposal refers to a set of parameters selected so as to have edge conditions as close as possible to DEMO, while remaining compatible with DEMO bulk plasma performance in terms of dimensionless parameters and given constraints. The paper illustrates the DTT project proposal, referring to a 6 MA plasma with a major radius of 2.15 m, an aspect ratio of about 3, an elongation of 1.6-1.8, and a toroidal field of 6 T. This selection will guarantee sufficient flexibility to test a wide set of divertor concepts and techniques to cope with large heat loads, including conventional tungsten divertors; liquid metal divertors; both conventional and advanced magnetic configurations (including single null, snow flake, quasi snow flake, X divertor, double null); internal coils for strike point sweeping and control of the width of the scrape-off layer in the divertor region; and radiation control. The Poloidal Field system is planned to provide a total flux swing of more than 35 Vs, compatible with a pulse length of more than 100 s. This is compatible with the mission of studying the power exhaust problem and is obtained using superconducting coils. Particular attention is dedicated to diagnostics and control issues, especially those relevant for plasma control in the divertor region, designed to be as compatible as possible with a DEMO-like environment. The construction is expected to last about seven years, and the selection of an Italian site would be compatible with a budget of 500 M€.

  15. Concept design of the DEMO divertor cassette-to-vacuum vessel locking system adopting a systems engineering approach

    Energy Technology Data Exchange (ETDEWEB)

    Di Gironimo, G., E-mail: giuseppe.digironimo@unina.it [Università degli Studi di Napoli “Federico II”, Dipartimento di Ingegneria Industriale, Piazzale Tecchio 80, 80135 Napoli (Italy); Carfora, D. [Tampere University of Technology, Korkeakoulunkatu 6, 33720 Tampere (Finland); VTT Technical Research Centre of Finland, Tekniikankatu 1, PO Box 1300, FI-33101 Tampere (Finland); Università degli Studi di Napoli “Federico II”, Dipartimento di Ingegneria Industriale, Piazzale Tecchio 80, 80135 Napoli (Italy); Esposito, G.; Lanzotti, A.; Marzullo, D. [Università degli Studi di Napoli “Federico II”, Dipartimento di Ingegneria Industriale, Piazzale Tecchio 80, 80135 Napoli (Italy); Siuko, M. [VTT Technical Research Centre of Finland, Tekniikankatu 1, PO Box 1300, FI-33101 Tampere (Finland)

    2015-05-15

    Highlights: • An iterative and incremental design process for cassette-to-VV locking system of DEMO divertor is presented. • Three different concepts have been developed with a systematic design approach. • The final concept has been selected with Fuzzy-Analytic Hierarchy Process in virtual reality. - Abstract: This paper deals with pre-concept studies of DEMO divertor cassette-to-vacuum vessel locking system under the work program WP13-DAS-07-T06: Divertor Remote Maintenance System pre-concept study. An iterative design process, consistent with Systems Engineering guidelines and named Iterative and Participative Axiomatic Design Process (IPADeP), is used in this paper to propose new innovative solutions for divertor locking system, which can overcome the difficulties in applying the ITER principles to DEMO. The solutions conceived have been analysed from the structural point of view using the software Ansys and, eventually, evaluated using the methodology known as Fuzzy-Analytic Hierarchy Process. Due to the lack and the uncertainty of the requirements in this early conceptual design stage, the aim is to cover a first iteration of an iterative and incremental process to propose an innovative design concept to be developed in more details as the information will be completed.

  16. A review on two previous divertor target concepts for DEMO: mutual impact between structural design requirements and materials performance

    Science.gov (United States)

    You, Jeong-Ha

    2015-09-01

    Development of a diverter target with a sufficient capability of power exhaust is a crucial prerequisite for the realization of a fusion power plant. While the design and technology for divertor target has been successfully developed for ITER, the applicability of this concept is not necessarily assured yet for DEMO mainly because the neutron irradiation dose expected for the DEMO divertor will be an order of magnitude higher than that of the ITER divertor. The possible embrittlement of structural heat sink materials due to irradiation is likely to restrict the structural performance and the operational flexibility of a target component to a considerable extent. For judgment of design feasibility of a target concept a quantitative evaluation of the thermal and structure mechanical performance is needed. In this article, a review on two representative target design concepts considered for the DEMO divertor is presented. Emphasis is put on the mutual impact between the design requirements and the performance of structural materials. Water-cooled and helium-cooled concepts are discussed considering two baseline heat sink materials, CuCrZr alloy and tungsten, respectively. Conclusions are derived from the critical features of the heat sink performance in terms of structural reliability, design/material interface and further R&D needs.

  17. Evaluation of energy and particle impact on the plasma facing components in DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Igitkhanov, Yuri, E-mail: juri.gitkhanov@ihm.fzk.de [Karlsruhe Institute of Technology, IHM, Karlsruhe (Germany); Bazylev, Boris [Karlsruhe Institute of Technology, IHM, Karlsruhe (Germany)

    2012-08-15

    Highlights: Black-Right-Pointing-Pointer We analyze the first wall blanket W/EUROFER configuration for DEMO under steady-state normal operation and off-normal conditions, such as vertical displacements events (VDE) and runaway electrons (RE). The main issue is to find the optimal thickness of the W armor which will prevent tungsten surface from evaporation and melting and, on the other hand, will keep EUROFER below the critical thermal stresses. Black-Right-Pointing-Pointer The minimum thickness of the tungsten amour about 3 mm for W/EUROFER sandwich structure will keep the maximum EUROFER temperature below the critical limit for EUROFER steel under steady-state operation and ITER like cooling conditions. Black-Right-Pointing-Pointer The W surface temperature and the max. EUROFER temperature are increasing with incoming heat flux. For reference conditions (Dw {approx}3 mm, DEUROFER {approx}4 mm) the maximum tolerable heat flux which does not causes in thermal stresses in structural material is about {approx}13.5 MW/m{sup 2}. Black-Right-Pointing-Pointer The RE deposit their energy deeper into W armour and for energies {>=}50 MJ/m{sup 2} and deposition times {<=}0.1 s, the minimum armor thickness required to prevent EUROFER from thermal distraction is {>=}1.4 cm. Black-Right-Pointing-Pointer However, at this thickness the W surface melts. For higher RE energy deposition rates ({>=}100 MJ/m{sup 2} in 0.1 s), the required armor thickness to prevent thermal destruction is even larger so that the bulk of the armor layer will melt and evaporate. - Abstract: We analyze the first wall blanket W/EUROFER configuration for DEMO under steady-state normal operation and off-normal conditions, such as vertical displacement events (VDE) and runaway electrons (RE). The main issue is to find the optimal thickness of the W armor which will prevent tungsten surface from evaporation and melting and, on the other hand, will keep EUROFER below the critical thermal stresses. Under steady

  18. Design of a water cooled monoblock divertor for DEMO using Eurofer as structural material

    Energy Technology Data Exchange (ETDEWEB)

    Richou, Marianne, E-mail: marianne.richou@cea.fr [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Li-Puma, Antonella [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Visca, Eliseo [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, IT-00044 Frascati (Italy)

    2014-10-15

    The performed investigation focus on a monoblock type design for a water cooled DEMO divertor using Eurofer as structural material. In 2013, a study case of such a concept was presented. It was shown that basic concepts using Eurofer as structural material are limited to an incident heat flux of 8 MW m{sup −2}. Since, the EFDA agency issued new specifications. In this study, the conceptual design is reassessed with regard to specifications. Then, steady state thermal analyses and thermo-mechanical elastic analyses have been performed to define an upgrade of the geometry taking into account new specifications, design criteria and the maximum heat flux requirement of 10 MW m{sup −2}. An analysis of the influence of each adjustable geometrical parameter on thermo-mechanical design criteria was performed. As a consequence, geometrical parameters were set in order to fit to materials requirements. For defined hydraulic conditions taken in the most favourable configuration, the limit of this design is estimated to an incident heat flux of 10 MW m{sup −2}. Margin to critical heat flux and rules against progressive deformation/ratcheting in structural material limit the design.

  19. FAST: A European ITER satellite experiment in the view of DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Crisanti, F., E-mail: Crisanti@frascati.enea.it [Associazione Euratom/ENEA sulla Fusione, CP 65-00044 Frascati, Rome (Italy); Cucchiaro, A. [Associazione Euratom/ENEA sulla Fusione, CP 65-00044 Frascati, Rome (Italy); Albanese, R.; Artaserse, G. [Assoc. Euratom-ENEA-CREATE, Univ. Napoli Federico II, Via Claudio 21, 80125 Napoli (Italy); Baruzzo, M.; Bolzonella, T. [Consorzio RFX, EURATOM-ENEA Association, Corso Stati Uniti 4, 35127 Padova (Italy); Brolatti, G.; Calabro, G.; Crescenzi, F.; Coletti, R.; Costa, P.; Corte, A. della; Di Zenobio, A.; Frosi, P. [Associazione Euratom/ENEA sulla Fusione, CP 65-00044 Frascati, Rome (Italy); Harting, D. [Ins. Plasmaphysik, Forschungszentrum, Euratom Ass., Tril. Euregio Cluster, D-52425 Julich (Germany); Taroni, L. Lauro [New College, Oxford OX1 3BN (United Kingdom); Maddaluno, G. [Associazione Euratom/ENEA sulla Fusione, CP 65-00044 Frascati, Rome (Italy); Marcuzzi, D. [Consorzio RFX, EURATOM-ENEA Association, Corso Stati Uniti 4, 35127 Padova (Italy); Maviglia, F. [Assoc. Euratom-ENEA-CREATE, Univ. Napoli Federico II, Via Claudio 21, 80125 Napoli (Italy); Muzzi, L. [Associazione Euratom/ENEA sulla Fusione, CP 65-00044 Frascati, Rome (Italy)

    2011-10-15

    Fusion Advanced Studies Torus (FAST) aims to contribute to the exploitation of ITER and to explore innovative DEMO technology. FAST has been designed to study, in an integrated scenario: (a) relevant plasma-wall interaction problems, with a large power load (P/R {approx} 22 MW/m; P/R{sup 2} {approx} 12 MW/m{sup 2}) and with a full metallic wall; (b) to tackle operational problems in regimes with relevant fusion parameters; (c) to investigate the non-linear dynamics of fast particles (alpha like) in burning plasmas. FAST will operate on a wide parameters range, namely in high performance H-mode (BT {approx} 8.5 T; IP {approx} 8 MA) as well as in advanced Tokamak operation up to full non-inductive current scenario (IP {approx} 2 MA). The main heating is based on 30 MW ICRH, but the ports have been designed to allocate up to 20 MW of 1 MeV NNBI. Helium gas at 30 K is used for cooling of the full machine, a preliminary analysis shows the possibility of realizing FAST with a complete superconductor set of coils. An innovative active system is under development to reduce and to control the magnetic ripple. Tungsten (W) or liquid lithium (L-Li) has been chosen for the divertor material plates and the code EDGE2D has been used to optimize the divertor geometry.

  20. Validation of a FAST Model of the Statoil-Hywind Demo Floating Wind Turbine

    Energy Technology Data Exchange (ETDEWEB)

    Driscoll, Frederick; Jonkman, Jason; Robertson, Amy; Sirnivas, Senu; Skaare, Bjorn; Nielsen, Finn Gunnar

    2016-09-01

    To assess the accuracy of the National Renewable Energy Laboratory's (NREL's) FAST simulation tool for modeling the coupled response of floating offshore wind turbines under realistic open-ocean conditions, NREL developed a FAST model of the Statoil Hywind Demo floating offshore wind turbine, and validated simulation results against field measurements. Field data were provided by Statoil, which conducted a comprehensive test measurement campaign of its demonstration system, a 2.3-MW Siemens turbine mounted on a spar substructure deployed about 10 km off the island of Karmoy in Norway. A top-down approach was used to develop the FAST model, starting with modeling the blades and working down to the mooring system. Design data provided by Siemens and Statoil were used to specify the structural, aerodynamic, and dynamic properties. Measured wind speeds and wave spectra were used to develop the wind and wave conditions used in the model. The overall system performance and behavior were validated for eight sets of field measurements that span a wide range of operating conditions. The simulated controller response accurately reproduced the measured blade pitch and power. The structural and blade loads and spectra of platform motion agree well with the measured data.

  1. Participation as Post-Fordist Politics: Demos, New Labour, and Science Policy.

    Science.gov (United States)

    Thorpe, Charles

    2010-12-01

    In recent years, British science policy has seen a significant shift 'from deficit to dialogue' in conceptualizing the relationship between science and the public. Academics in the interdisciplinary field of Science and Technology Studies (STS) have been influential as advocates of the new public engagement agenda. However, this participatory agenda has deeper roots in the political ideology of the Third Way. A framing of participation as a politics suited to post-Fordist conditions was put forward in the magazine Marxism Today in the late 1980s, developed in the Demos thinktank in the 1990s, and influenced policy of the New Labour government. The encouragement of public participation and deliberation in relation to science and technology has been part of a broader implementation of participatory mechanisms under New Labour. This participatory program has been explicitly oriented toward producing forms of social consciousness and activity seen as essential to a viable knowledge economy and consumer society. STS arguments for public engagement in science have gained influence insofar as they have intersected with the Third Way politics of post-Fordism.

  2. Tritium management and safety issues in ITER and DEMO breeding blankets

    Energy Technology Data Exchange (ETDEWEB)

    Bornschein, B., E-mail: beate.bornschein@kit.edu [Karlsruhe Institute of Technology (KIT), Institute for Technical Physics, Tritium Laboratory Karlsruhe, Hermann v. Helmholtz Platz 1, 76344 Eggenstein Leopoldshafen (Germany); Day, C.; Demange, D. [Karlsruhe Institute of Technology (KIT), Institute for Technical Physics, Tritium Laboratory Karlsruhe, Hermann v. Helmholtz Platz 1, 76344 Eggenstein Leopoldshafen (Germany); Pinna, T. [ENEA UTFUS-TEC, Via E. Fermi 45, 00044 Frascati, Rome (Italy)

    2013-10-15

    Highlights: • Different aspects of tritium management in breeder blankets were reviewed. • Safe and reliable tritium management faces unique technological challenges. • Tritium recovery efficiency in tritium extraction system (TES) is a vital issue. • Tritium tracking accuracy needs to be demonstrated for the whole fuel cycle. • Improved or new processes for TES and CPS are needed in case of DEMO. -- Abstract: Safe, reliable and efficient tritium management in the breeder blanket faces unique technological challenges. Beside the tritium recovery efficiency in the tritium extraction and coolant purification systems, the tritium tracking accuracy between the inner and outer fuel cycle shall also be demonstrated. Furthermore, it is self-evident that safe handling and confinement of tritium need to be stringently assured to evolve fusion as a reliable technique. The present paper gives an overview of tritium management in breeder blankets. After a short introduction into the tritium fuel cycle and blanket basics, open tritium issues are discussed, thereby focusing on tritium extraction from blanket, coolant detritiation and tritium analytics and accountancy, necessary for accurate and reliable processing as well as for book-keeping.

  3. Linguistic Justice for which Demos? The Democratic Legitimacy of Language Regime Choices

    Directory of Open Access Journals (Sweden)

    Garcia Núria

    2016-10-01

    Full Text Available In the European Union language regime debate, theorists of multiculturalism and cosmopolitanism have framed their arguments in reference to different theories of justice and democracy. Philippe Van Parijs advocates the diffusion of a lingua franca, namely English, as means of changing the scale of the justificatory community to the European level and allowing the creation of a transnational demos. Paradoxically, one key dimension of democracy has hardly been addressed in this discussion: the question of the democratic legitimacy of language regime choices and citizens’ preferences on the different language regime scenarios. Addressing the question of the congruence of language policy choices operated by national and European elites and ordinary citizens’ preferences, this paper argues first that the dimension of democratic legitimacy is crucial and needs to be taken into account in discussions around linguistic justice. Criticizing the assumption of a direct correspondence between individuals’ language learning choices and citizens’ language regime preferences made by different authors, the analysis shows the ambivalence of citizens’ preferences measured by survey data. The article secondly raises the question of the boundaries of the political community at which the expression of citizens’ preferences should be measured and demonstrates that the outcome and the fairness of territorial linguistic regimes may vary significantly according to the level at which this democratic legitimacy is taken into account.

  4. Results of availability imposed configuration details developed for K-DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Tom, E-mail: tbrown@pppl.gov [Princeton Plasma Physics Laboratory, Princeton, NJ 08543 (United States); Titus, Peter; Brooks, Art; Zhang, Han; Neilson, Hutch [Princeton Plasma Physics Laboratory, Princeton, NJ 08543 (United States); Im, Kihak; Kim, Keeman [National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of)

    2016-11-01

    The Korean fusion demonstration reactor (K-DEMO) has completed a two year study looking at key Tokamak components and configuration options in preparation of a conceptual design phase. A key part of a device configuration centers on defining an arrangement that enhances the ability to reach high availability values by defining design solutions that foster simplified maintenance operations. To maximize the size and minimize the number of in-vessel components enlarged TF coils were defined that incorporate a pair of windings within each coil to mitigate pressure drop issues and to reduce the cost of the coils. A semi-permanent shield structure was defined to develop labyrinth interfaces between double-null plasma contoured shield modules, provide an entity to align blanket components and provide support against disruption loads—with a load path that equilibrates blanket, TF and PF loads through a base structure. Blanket piping services and auxiliary systems that interface with in-vessel components have played a major role in defining the overall device arrangement—concept details will be presented along with general arrangement features and preliminary results obtained from disruption analysis.

  5. Characterisation of NEXT-DEMO using xenon K$_{\\alpha}$ X-rays

    CERN Document Server

    Lorca, D; Laing, A; Ferrario, P; Gómez-Cadenas, J J; Álvarez, V; Borges, F I G; Camargo, M; Cárcel, S; Cebrián, S; Cervera, A; Conde, C A N; Dafni, T; Díaz, J; Esteve, R; Fernandes, L M P; Ferreira, A L; Freitas, E D C; Gehman, V M; Goldschmidt, A; Gómez, H; González-Díaz, D; Gutiérrez, R M; Hauptman, J; Morata, J A Hernando; Herrera, D C; Irastorza, I G; Labarga, L; Liubarsky, I; Losada, M; Luzón, G; Marí, A; Martínez-Lema, G; Martínez, A; Miller, T; Monrabal, F; Monserrate, M; Monteiro, C M B; Mora, F J; Moutinho, L M; Vidal, J Muñoz; Nebot-Guinot, M; Nygren, D; Oliveira, C A B; Pérez, J; Aparicio, J L Pérez; Renner, J; Ripoll, L; Rodríguez, A; Rodríguez, J; Santos, F P; Santos, J M F dos; Seguí, L; Serra, L; Shuman, D; Simón, A; Sofka, C; Sorel, M; Toledo, J F; Torrent, J; Tsamalaidze, Z; Veloso, J F C A; Webb, R; White, J T; Yahlali, N

    2014-01-01

    The NEXT experiment aims to observe the neutrinoless double beta decay of $^{136}$Xe in a high pressure gas TPC using electroluminescence (EL) to amplify the signal from ionization. Understanding the response of the detector is imperative in achieving a consistent and well understood energy measurement. The abundance of xenon k-shell x-ray emission during data taking has been identified as a multitool for the characterisation of the fundamental parameters of the gas as well as the equalisation of the response of the detector. The NEXT-DEMO prototype is a ~1.5 kg volume TPC filled with natural xenon. It employs an array of 19 PMTs as an energy plane and of 256 SiPMs as a tracking plane with the TPC light tube and SiPM surfaces being coated with tetraphenyl butadiene (TPB) which acts as a wavelength shifter for the VUV scintillation light produced by xenon. This paper presents the measurement of the properties of the drift of electrons in the TPC, the effects of the EL production region, and the extraction of p...

  6. Laser-driven Beat-Wave Current Drive in Dense Plasmas with Demo on CTIX

    Science.gov (United States)

    Liu, Fei; Horton, Robert; Hwang, David; Zhu, Ben; Evans, Russell; Hong, Sean; Hsu, Scott

    2010-11-01

    The ability to remotely generate plasma current in dense plasmas hanging freely in vacuum in voluminous amount without obstruction to diagnostics will greatly enhance our ability to study the physics of high energy density plasmas in strong magnetic fields. Plasma current can be generated through nonlinear beat-wave process by launching two intense electromagnetic waves into unmagnetized plasma. Beat-wave acceleration of electrons has been demonstrated in a low-density plasma using microwaves [1]. The proposed PLX experimental facility presently under construction at Los Alamos offers the opportunity to test the method at a density level scalable to the study of HED plasmas. For PLX beat-wave experiments, CO2 lasers will be used as pump waves due to their high power and tunability. For a typical PLX density ne=10^17cm-3, two CO2 lasers can be separately tuned to 9P(28) and 10P(20) to match the 2.84THz plasma frequency. The beat-wave demo experiment will be conducted on CTIX. The laser arrangement is being converted to two independent single lasers. Frequency-tuning methods, optics focusing system and diagnostics system will be discussed. The laser measurements and results of synchronization of two lasers will be presented, and scaling to PLX experiments will be given. [1] Rogers, J. H. and Hwang, D. Q., PRL. v68 p3877 (1992).

  7. DEMOS PLUS. Robot for decontaminating soils and cavity walls of the reactor and fuel pools NPP primarily during periods of recharging fuel; DEMOS PLUS. Robot para la descontaminacion de suelos y paredes de la cavidad de reactor y piscinas de combustible de CC.NN. principalmente durante los periodos de recarga de combustible

    Energy Technology Data Exchange (ETDEWEB)

    Lacalle Bayo, J.; Vaquer Perez, J. I.; Rosello Garcia, J. I.

    2014-07-01

    In this work the robot Plus Demos, equipment that has been developed by GD Energy Services from the redesign and development of robot Demos show, which took place on last year. This evolution has given the team greater capabilities, highlighting the decontamination of vertical surfaces. The main objective pursued is to minimize operational doses to workers operating in cavity as well as the risk of surface contamination during them. (Author)

  8. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  9. Safety issues related to the intermediate heat storage for the EU DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Carpignano, Andrea [NEMO group, Dipartimento Energia, Politecnico di Torino, C.so Duca degli Abruzzi 24, 10129 Torino (Italy); Pinna, Tonio [ENEA, 00044 Frascati (Italy); Savoldi, Laura; Sobrero, Giulia; Uggenti, Anna Chiara [NEMO group, Dipartimento Energia, Politecnico di Torino, C.so Duca degli Abruzzi 24, 10129 Torino (Italy); Zanino, Roberto, E-mail: roberto.zanino@polito.it [NEMO group, Dipartimento Energia, Politecnico di Torino, C.so Duca degli Abruzzi 24, 10129 Torino (Italy)

    2016-11-01

    Highlights: • IHS affects only the PHTS and the BoP (Balance of Plant). • PIEs list does not change but IHS influences PIEs evolution. • Additional issues to be addressed in PIEs study due to the implementation of HIS. • No safety/operational major obstacles were found for IHS concept. - Abstract: The functional deviations able to compromise system safety in the EU DEMO Primary Heat Transfer System (PHTS) with intermediate heat storage (IHS) based on molten salts are identified and compared to the deviations identified with PHTS without IHS. The resulting safety issues for the Balance of Plant (BoP) have been taken into account. Functional Failure Mode and Effects Analysis (FFMEA) is used to highlight the Postulated Initiating Events (PIE) of incident/accident sequences and to provide some safety insights during the preliminary design. The architecture of the system with IHS does not introduce new PIE with respect to the case without IHS, but it modifies some of them. In particular the two Postulated Initiating Events that are affected by the presence of IHS are the LOCA in the tubes of the HX between primary and intermediate circuit and the loss of heat sink for the first wall or the breeding zone. In fact the IHS introduces some advantages concerning the stability of the secondary circuit, but some weaknesses are associated to the physical-chemical nature of molten salts, especially oxidizing power, corrosive nature and risk of solidification. These issues can be managed in the design by the introduction of new safety functions.

  10. Dynamic outgassing of deuterium, helium and nitrogen from plasma-facing materials under DEMO relevant conditions

    Science.gov (United States)

    Möller, S.; Matveev, D.; Martynova, Y.; Unterberg, B.; Rasinski, M.; Wegener, T.; Kreter, A.; Linsmeier, Ch.

    2017-01-01

    In confined plasma magnetic fusion devices significant amounts of the hydrogen isotopes used for the fusion reaction can be stored in the plasma-facing materials by implantation. The desorption of this retained hydrogen was seen to follow a t α law with α  ≈  -0.7 in tokamaks. For a pulsed fusion reactor this outgassing can define the inter-pulse waiting time. This work presents new experimental data on the dynamic outgassing in ITER grade tungsten exposed under the well-defined conditions of PSI-2 to pure and mixed D2 plasmas. A peak ion flux of 1022 D+ m-2 s is applied for up to 6 h at sample temperatures of up to 900 K. Pure D2 and mixed D2  +  He, D2  +  N2 and D2  +  He  +  N2 plasmas are applied to the sample at 68 V bias. The D2, He, N outgassing at 293 K and 580 k are observed via in-vacuo quadrupole mass spectrometry covering the range of 40 s-200 000 s after exposure. The outgassing decay follows a single power law with exponents α  =  -0.7  to  -1.1 at 293 K, but at 580 K a drop from α  =  -0.25 to  -2.35 is found. For DEMO a pump-down time to 0.5 mPa in the order of 1-5 h can be expected. The outgassing is in all cases dominated by D2.

  11. Assessment of GPS Reflectometry from TechDemoSat-1 for Scatterometry and Altimetry Applications

    Science.gov (United States)

    Shah, R.; Hajj, G. A.

    2015-12-01

    The value of GPS reflectometry for scatterometry and altimetry applications has been a topic of investigation for the past two decades. TechDemoSat-1 (TDS-1), a technology demonstration satellite launched in July of 2014, with an instrument to collect GPS reflections from 4 GPS satellites simultaneously, provide the first extensive data that allows for validation and evaluation of GPS reflectometry from space against more established techniques. TDS-1 uses a high gain (~13 dBi) L1 antenna pointing 6 degrees off nadir with a 60ohalf-beam width. Reflected GPS L1 signals are processed into Delay Doppler Maps (DDMs) inside the receiver and made available (through Level-1b) along with metadata describing the bistatic geometry, antenna gain, etc., on a second-by-second basis for each of the 4 GPS tracks recorded at any given time. In this paper we examine level-1b data from TDS-1 for thousands of tracks collected over the span of Jan.-Feb., 2015. This data corresponds to reflections from various types of surfaces throughout the globe including ice, deserts, forests, oceans, lakes, wetlands, etc. Our analysis will consider how the surface type manifests itself in the DDMs (e.g., coherence vs. non-coherence reflection) and derivable physical quantities. We will consider questions regarding footprint resolution, waveform rise time and corresponding bistatic range accuracy, and level of precision for altimetry (sea surface height) and scatterometry (significant wave height and sea surface wind). Tracks from TDS-1 that coincide with Jason-1 or 2 tracks will be analyzed, where the latter can be used as truth for comparison and validation. Where coincidences are found, vertical delay introduced by the media as measured by Jason will be mapped to bistatic propagation path to correct for neutral atmospheric and ionospheric delays.

  12. Maximal design basis accident of fusion neutron source DEMO-TIN

    Energy Technology Data Exchange (ETDEWEB)

    Kolbasov, B. N., E-mail: Kolbasov-BN@nrcki.ru [National Research Center Kurchatov Institute (Russian Federation)

    2015-12-15

    When analyzing the safety of nuclear (including fusion) facilities, the maximal design basis accident at which the largest release of activity is expected must certainly be considered. Such an accident is usually the failure of cooling systems of the most thermally stressed components of a reactor (for a fusion facility, it is the divertor or the first wall). The analysis of safety of the ITER reactor and fusion power facilities (including hybrid fission–fusion facilities) shows that the initial event of such a design basis accident is a large-scale break of a pipe in the cooling system of divertor or the first wall outside the vacuum vessel of the facility. The greatest concern is caused by the possibility of hydrogen formation and the inrush of air into the vacuum chamber (VC) with the formation of a detonating mixture and a subsequent detonation explosion. To prevent such an explosion, the emergency forced termination of the fusion reaction, the mounting of shutoff valves in the cooling systems of the divertor and the first wall or blanket for reducing to a minimum the amount of water and air rushing into the VC, the injection of nitrogen or inert gas into the VC for decreasing the hydrogen and oxygen concentration, and other measures are recommended. Owing to a continuous feed-out of the molten-salt fuel mixture from the DEMO-TIN blanket with the removal period of 10 days, the radioactivity release at the accident will mainly be determined by tritium (up to 360 PBq). The activity of fission products in the facility will be up to 50 PBq.

  13. Optimization of the breeder zone cooling tubes of the DEMO Water-Cooled Lithium Lead breeding blanket

    Energy Technology Data Exchange (ETDEWEB)

    Di Maio, P.A.; Arena, P.; Bongiovì, G. [Dipartimento di Energia, Ingegneria dell’Informazione e Modelli Matematici, Università di Palermo, Viale delle Scienze, Palermo (Italy); Chiovaro, P., E-mail: pierluigi.chiovaro@unipa.it [Dipartimento di Energia, Ingegneria dell’Informazione e Modelli Matematici, Università di Palermo, Viale delle Scienze, Palermo (Italy); Del Nevo, A. [ENEA Brasimone, Camugnano, BO (Italy); Forte, R. [Dipartimento di Energia, Ingegneria dell’Informazione e Modelli Matematici, Università di Palermo, Viale delle Scienze, Palermo (Italy)

    2016-11-01

    Highlights: • Determination of an optimal configuration for the breeder zone cooling tubes. • Attention has been focused on the toroidal–radial breeder zone cooling tubes lay out. • A theoretical-computational approach based on the Finite Element Method (FEM) has been followed, adopting a qualified commercial FEM code. • Five different configurations have been investigated to optimize the breeder zone cooling tubes arrangement fulfilling all the rules prescribed by safety codes. - Abstract: The determination of an optimal configuration for the breeder zone (BZ) cooling tubes is one of the most important issues in the DEMO Water-Cooled Lithium Lead (WCLL) breeding blanket R&D activities, since BZ cooling tubes spatial distribution should ensure an efficient heat power removal from the breeder, avoiding hotspots occurrence in the thermal field. Within the framework of R&D activities supported by the HORIZON 2020 EUROfusion Consortium action on the DEMO WCLL breeding blanket design, a campaign of parametric analyses has been launched at the Department of Energy, Information Engineering and Mathematical Models of the University of Palermo (DEIM), in close cooperation with ENEA-Brasimone, in order to assess the potential influence of BZ cooling tubes number on the thermal performances of the DEMO WCLL outboard breeding blanket equatorial module under the nominal steady state operative conditions envisaged for it, optimizing their geometric configuration and taking also into account that a large number of cooling pipes can deteriorate the tritium breeding performances of the module. In particular, attention has been focused on the toroidal-radial option for the BZ tube bundles lay-out and a parametric study has been carried out taking into account different tube bundles arrangement within the module. The study has been carried out following a numerical approach, based on the finite element method (FEM), and adopting a qualified commercial FEM code. Results

  14. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  15. Consequences of the technology survey and gap analysis on the EU DEMO R&D programme in tritium, matter injection and vacuum

    Energy Technology Data Exchange (ETDEWEB)

    Day, Chr., E-mail: Christian.Day@kit.edu [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Butler, B. [Culham Science Centre (CCFE), Abingdon (United Kingdom); Giegerich, T. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Lang, P.T. [Max-Planck-Institute of Plasma Physics (IPP), Garching (Germany); Lawless, R. [Culham Science Centre (CCFE), Abingdon (United Kingdom); Meszaros, B. [EUROfusion Consortium, Programme Management Unit, Garching (Germany)

    2016-11-01

    Highlights: • The inner fuel cycle architecture of DEMO is developed in a systems engineering approach as a functional break-down diagram, driven by the need for inventory minimisation. • Technologies to fulfil the required functions are discussed and ranked. • Prime technologies are identified and an associated R&D programme is developed. • The core challenges of a DEMO fuel cycle beyond those already addressed in ITER are discussed. - Abstract: In the framework of the EUROfusion Programme, EU is preparing the conceptual design of the inner fuel cycle of a pulsed tokamak DEMO. This paper illustrates a quantified process to shape a R&D programme that exploits as much as possible previous R&D. In an initial step, the high-level requirements are collected and a novel DEMO inner fuel cycle architecture with its three sub-systems vacuum pumping, matter injection (fuelling and injection of plasma enhancement gases) and tritium systems (tritium plant and breeder coolant purification) is delineated, driven by the DEMO key challenge to reduce tritium inventory. Then, a technology survey is carried out to review potential existing solutions for the required process functions and to assess their maturity and risks. Finally, a decision-making scheme is applied to select the most promising candidates. ITER technology is exploited where possible. As a primary result, a fuel cycle architecture is suggested with an advanced tritium plant that avoids full isotope separation in the main loop and with a Direct Internal Recycling path in the vacuum systems to shorten cycle times. For core fuelling, classical inboard pellet injection technology is selected, in principle similar to that proposed for ITER but aiming for higher launch speeds to achieve deep fuelling of the DEMO plasma. Based on these findings, a tailored R&D programme is shaped that tackles the key questions until 2020.

  16. AC susceptibilities of grain-textured superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, N. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan)], E-mail: saka@te.kyusan-u.ac.jp; Fukuda, Y.; Koga, M.; Akune, T. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan); Khan, H.R. [Institut von Ionenstrahl und Vakuum Technologie, 73728 Esslingen (Germany); Lueders, K. [Freie Universitaet Berlin, Arnimallee, Fac.Physik, D-14195 Berlin (Germany)

    2008-09-15

    In-phase {chi}{sub n}' and out-phase {chi}{sub n}'' components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field B{sub dc}, an amplitude B{sub a} and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low-T{sub c} metallic superconductors, {chi}{sub 1}' shows smooth transition and {chi}{sub 1}'' does single peak. High-T{sub c} oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in {chi}{sub 1}'' and shoulders in {chi}{sub 1}' appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  17. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  18. The DEMO trial: a randomized, parallel-group, observer-blinded clinical trial of strength versus aerobic versus relaxation training for patients with mild to moderate depression

    DEFF Research Database (Denmark)

    2009-01-01

    OBJECTIVE: To assess the benefit and harm of exercise training in adults with clinical depression. METHOD: The DEMO trial is a randomized pragmatic trial for patients with unipolar depression conducted from January 2005 through July 2007. Patients were referred from general practitioners or psych......OBJECTIVE: To assess the benefit and harm of exercise training in adults with clinical depression. METHOD: The DEMO trial is a randomized pragmatic trial for patients with unipolar depression conducted from January 2005 through July 2007. Patients were referred from general practitioners...

  19. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  20. Effect of activation cross-section uncertainties on the radiological assessment of the MFE/DEMO first wall

    Energy Technology Data Exchange (ETDEWEB)

    Cabellos, O. [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, Madrid (Spain)]. E-mail: cabellos@din.upm.es; Reyes, S. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Sanz, J. [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, Madrid (Spain); University Nacional Educacion a Distancia, Dep. Ingenieria Energetica, Juan del Rosal 12, 28040 Madrid (Spain); Rodriguez, A. [University Nacional Educacion a Distancia, Dep. Ingenieria Energetica, Juan del Rosal 12, 28040 Madrid (Spain); Youssef, M. [University of California, Los Angeles, CA (United States); Sawan, M. [University of Wisconsin, Madison, WI (United States)

    2006-02-15

    A Monte Carlo procedure has been applied in this work in order to address the impact of activation cross-sections (XS) uncertainties on contact dose rate and decay heat calculations for the outboard first wall (FW) of a magnetic fusion energy (MFE) demonstration (DEMO) reactor. The XSs inducing the major uncertainty in the prediction of activation related quantities have been identified. Results have shown that for times corresponding to maintenance activities the uncertainties effect is insignificant since the dominant XSs involved in these calculations are based on accurate experimental data evaluations. However, for times corresponding to waste management/recycling activities, the errors induced by the XSs uncertainties, which in this case are evaluated using systematic models, must be considered. It has been found that two particular isotopes, {sup 6}Co and {sup 94}Nb, are key contributors to the global DEMO FW activation uncertainty results. In these cases, the benefit from further improvements in the accuracy of the critical reaction XSs is discussed.

  1. Progress in the engineering design and assessment of the European DEMO first wall and divertor plasma facing components

    Energy Technology Data Exchange (ETDEWEB)

    Barrett, Thomas R., E-mail: tom.barrett@ukaea.uk [CCFE, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Ellwood, G.; Pérez, G.; Kovari, M.; Fursdon, M.; Domptail, F.; Kirk, S.; McIntosh, S.C.; Roberts, S.; Zheng, S. [CCFE, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Boccaccini, L.V. [KIT, INR, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); You, J.-H. [Max Planck Institute for Plasma Physics, Boltzmannstr. 2, 85748 Garching (Germany); Bachmann, C. [EUROfusion, PPPT, Boltzmann Str. 2, 85748 Garching (Germany); Reiser, J.; Rieth, M. [KIT, IAM, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Visca, E.; Mazzone, G. [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati (Italy); Arbeiter, F. [KIT, INR, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Domalapally, P.K. [Research Center Rez, Hlavní 130, 250 68 Husinec – Řež (Czech Republic)

    2016-11-01

    Highlights: • The engineering of the plasma facing components for DEMO is an extreme challenge. • PFC overall requirements, methods for assessment and designs status are described. • Viable divertor concepts for 10 MW/m{sup 2} surface heat flux appear to be within reach. • The first wall PFC concept will need to vary poloidally around the wall. • First wall coolant, structural material and PFC topology are open design choices. - Abstract: The European DEMO power reactor is currently under conceptual design within the EUROfusion Consortium. One of the most critical activities is the engineering of the plasma-facing components (PFCs) covering the plasma chamber wall, which must operate reliably in an extreme environment of neutron irradiation and surface heat and particle flux, while also allowing sufficient neutron transmission to the tritium breeding blankets. A systems approach using advanced numerical analysis is vital to realising viable solutions for these first wall and divertor PFCs. Here, we present the system requirements and describe bespoke thermo-mechanical and thermo-hydraulic assessment procedures which have been used as tools for design. The current first wall and divertor designs are overviewed along with supporting analyses. The PFC solutions employed will necessarily vary around the wall, depending on local conditions, and must be designed in an integrated manner by analysis and physical testing.

  2. Structural integrity for DEMO: An opportunity to close the gap from materials science to engineering needs

    Energy Technology Data Exchange (ETDEWEB)

    Porton, M., E-mail: michael.porton@ccfe.ac.uk [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Wynne, B.P. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); University of Sheffield, Sheffield, South Yorkshire S10 2TN (United Kingdom); Bamber, R.; Hardie, C.D.; Kalsey, M. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom)

    2016-11-01

    Highlights: • Key shortfalls in the current approaches to verification of structural integrity are outlined. • Case studies for high integrity applications in other demanding environments are examined. • Relevant lessons are drawn from fission and space for the design stage and through service life. • Future efforts are suggested to align materials and engineering for DEMO structural integrity. - Abstract: It is clear that fusion demonstration devices offer unique challenges due to the myriad, interacting material degradation effects and the numerous, conflicting requirements that must be addressed in order for in-vessel components to deliver satisfactory performance over the required lifetime. The link between mechanical engineering and materials science is pivotal to assure the timely realisation and exploitation of successful fusion power. A key aspect of this link is the verification of structural integrity, achieved at the design stage via structural design criteria against which designs are judged to be sufficiently resilient (or not) to failure, for a given set of loading conditions and desired lifetime. As various demonstration power plant designs progress through their current conceptual design phases, this paper seeks to highlight key shortfalls in this vital link between engineering needs and materials science, offering a perspective on where future attention can be prioritised to maximise impact. Firstly, issues in applying existing structural design criteria to demonstration power plant designs are identified. Whilst fusion offers particular challenges, there are significant insights to be gained from attempts to address such issues for high performance, high integrity applications in other demanding environments. Therefore case studies from beyond fusion are discussed. These offer examples where similar shortfalls have been successfully addressed, via approaches at the design stage and through service lifetime in order to deliver significant

  3. Classroom Management in Pre-Service Teachers' Teaching Practice Demo Lessons: A Comparison to Actual Lessons by In-Service English Teachers

    Science.gov (United States)

    Korkut, Perihan

    2017-01-01

    The pre-service teachers find the chance to practice their classroom management skills during their practicum as they present demo lessons under supervision of their university instructors and mentor teachers. It had been discovered in a previous study, however, that the interactional features during the classroom management episodes in…

  4. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  5. AcEST: DK956383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TAC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF S...AC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF Sb

  6. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  7. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  8. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  9. Total AC loss of YBCO coated conductor carrying AC transport current in AC transverse magnetic field with various orientations

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, Naoyuki [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Jiang, Zhenan [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Iijima, Yasuhiro [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Kakimoto, Kazuomi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Saitoh, Takashi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan)

    2004-08-01

    Using an electro-magnetic method, we measured the total AC loss of a YBCO coated conductor carrying an AC transport current in an AC transverse magnetic field with various orientations. We measured the magnetization loss (energy flow from the external magnetic field) and the transport loss (energy flow from the transport current circuit) independently during simultaneous application of an AC transverse magnetic field and AC transport current. Their sum gave us the total AC loss. The transport loss increases with increasing AC transverse magnetic field, and the magnetization loss increases with increasing AC transport current. The AC transverse magnetic field and the AC self magnetic field interact with each other at the conductor edges. This nonlinear interaction is a possible cause of the increase in AC loss. Due to the high aspect ratio of YBCO coated conductors, this increase in AC loss due to the interaction between the AC transverse and AC self magnetic fields is observed even when the transverse magnetic field is nearly parallel to the conductor wide-face. When the total AC losses for various transport currents and various field orientations are plotted against a transverse magnetic field component which is perpendicular to the conductor wide-face, the plots with different field angles but identical transport current all agree quite well with each other. The total AC loss is dominated by the self magnetic field and the perpendicular component of the transverse magnetic field, both of which mostly penetrate from the conductor edges.

  10. The enhanced pellet centrifuge launcher at ASDEX Upgrade: Advanced operation and application as technology test facility for ITER and DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Ploeckl, B., E-mail: bernhard.ploeckl@ipp.mpg.de [Max Planck Institute for Plasma Physics, EURATOM Association, Boltzmannstr. 2, 85748 Garching (Germany); Day, Chr. [Karlsruhe Institute of Technology (KIT), 76021 Karlsruhe (Germany); Lamalle, Ph. [ITER Organization, Route de Vinon sur Verdon, CS 90046, 13067 Saint-Paul-lez-Durance (France); Lang, P.T.; Rohde, V.; Viezzer, E. [Max Planck Institute for Plasma Physics, EURATOM Association, Boltzmannstr. 2, 85748 Garching (Germany)

    2015-10-15

    The pellet centrifuge at ASDEX Upgrade has served for more than 20 years as a powerful tool for plasma control. Its recently enhanced control system provides more thorough control over parameters and a detailed view of all measured values. A study has recently been initiated on the conceptual design of an optimized DEMO core particle fuelling system. For this approach, first technical tests aimed on an optimized pellet transfer with respect to the preparation of the solid fuel and the transfer systems have been performed. An investigation of the temperature dependence of transfer efficiency (mass loss due to erosion and broken pellets) has revealed a weak dependence. For ITER, in which it is intended to operate a heating scheme with ICRF minority heating of He-3, test injections are performed using D{sub 2}-pellets as carriers for He-4. Admixing of N{sub 2} was investigated as well.

  11. Demonstrating soil moisture remote sensing with observations from the UK TechDemoSat-1 satellite mission

    Science.gov (United States)

    Chew, Clara; Shah, Rashmi; Zuffada, Cinzia; Hajj, George; Masters, Dallas; Mannucci, Anthony J.

    2016-04-01

    The ability of spaceborne Global Navigation Satellite System (GNSS) bistatic radar receivers to sense changes in soil moisture is investigated using observations from the low Earth orbiting UK TechDemoSat-1 satellite (TDS-1). Previous studies using receivers on aircraft or towers have shown that ground-reflected GNSS signals are sensitive to changes in soil moisture, though the ability to sense this variable from space has yet to be quantified. Data from TDS-1 show a 7 dB sensitivity of reflected signals to temporal changes in soil moisture. If the effects of surface roughness and vegetation on the reflected signals can be quantified, spaceborne GNSS bistatic radar receivers could provide soil moisture on relatively small spatial and temporal scales.

  12. Scoping of material response under DEMO neutron irradiation: comparison with fission and influence of nuclear library selection

    CERN Document Server

    Gilbert, M R

    2016-01-01

    Predictions of material activation inventories will be a key input to virtually all aspects of the operation, safety and environmental assessment of future fusion nuclear plants. Additionally, the neutron-induced transmutation (change) of material composition (inventory) with time, and the creation and evolution of configurational damage from atomic displacements, require precise quantification because they can lead to significant changes in material properties, and thus influence reactor-component lifetime. A comprehensive scoping study has been performed to quantify the activation, transmutation (depletion and build-up) and immediate damage response under neutron irradiation for all naturally occurring elements from hydrogen to bismuth. The resulting database provides a global picture of the response of a material, covering the majority of nuclear technological space, but focussing specifically on typical conditions expected for a demonstration fusion power plant (DEMO). Results from fusion are compared aga...

  13. Current generation by helicons and lower hybrid waves in modern tokamaks and reactors ITER and DEMO. Scenarios, modeling and antennae

    Energy Technology Data Exchange (ETDEWEB)

    Vdovin, V. L., E-mail: vdov@nfi.kiae.ru [National Research Centre ' Kurchatov Institute,' (Russian Federation)

    2013-02-15

    The innovative concept and 3D full-wave code modeling the off-axis current drive by radio-frequency (RF) waves in large-scale tokamaks, ITER and DEMO, for steady-state operation with high efficiency is proposed. The scheme uses the helicon radiation (fast magnetosonic waves at high (20-40) ion cyclotron frequency harmonics) at frequencies of 500-700 MHz propagating in the outer regions of the plasmas with a rotational transform. It is expected that the current generated by helicons, in conjunction with the bootstrap current, ensure the maintenance of a given value of the total current in the stability margin q(0) {>=} 2 and q(a) {>=} 4, and will help to have regimes with a negative magnetic shear and internal transport barrier to ensure stability at high normalized plasma pressure {beta}{sub N} > 3 (the so-called advanced scenarios) of interest for the commercial reactor. Modeling with full-wave three-dimensional codes PSTELION and STELEC showed flexible control of the current profile in the reactor plasmas of ITER and DEMO, using multiple frequencies, the positions of the antennae and toroidal wave slow down. Also presented are the results of simulations of current generation by helicons in the DIII-D, T-15MD, and JT-60AS tokamaks. Commercially available continuous-wave klystrons of the MW/tube range are promising for commercial stationary fusion reactors. The compact antennae of the waveguide type are proposed, and an example of a possible RF system for today's tokamaks is given. The advantages of the scheme (partially tested at lower frequencies in tokamaks) are a significant decline in the role of parametric instabilities in the plasma periphery, the use of electrically strong resonator-waveguide type antennae, and substantially greater antenna-plasma coupling.

  14. Current generation by helicons and lower hybrid waves in modern tokamaks and reactors ITER and DEMO. Scenarios, modeling and antennae

    Science.gov (United States)

    Vdovin, V. L.

    2013-02-01

    The innovative concept and 3D full-wave code modeling the off-axis current drive by radio-frequency (RF) waves in large-scale tokamaks, ITER and DEMO, for steady-state operation with high efficiency is proposed. The scheme uses the helicon radiation (fast magnetosonic waves at high (20-40) ion cyclotron frequency harmonics) at frequencies of 500-700 MHz propagating in the outer regions of the plasmas with a rotational transform. It is expected that the current generated by helicons, in conjunction with the bootstrap current, ensure the maintenance of a given value of the total current in the stability margin q(0) ≥ 2 and q( a) ≥ 4, and will help to have regimes with a negative magnetic shear and internal transport barrier to ensure stability at high normalized plasma pressure β N > 3 (the so-called advanced scenarios) of interest for the commercial reactor. Modeling with full-wave three-dimensional codes PSTELION and STELEC showed flexible control of the current profile in the reactor plasmas of ITER and DEMO, using multiple frequencies, the positions of the antennae and toroidal wave slow down. Also presented are the results of simulations of current generation by helicons in the DIII-D, T-15MD, and JT-60AS tokamaks. Commercially available continuous-wave klystrons of the MW/tube range are promising for commercial stationary fusion reactors. The compact antennae of the waveguide type are proposed, and an example of a possible RF system for today's tokamaks is given. The advantages of the scheme (partially tested at lower frequencies in tokamaks) are a significant decline in the role of parametric instabilities in the plasma periphery, the use of electrically strong resonator-waveguide type antennae, and substantially greater antenna-plasma coupling.

  15. Needs and gaps in the development of aluminum-based corrosion and T-permeation barriers for DEMO blankets

    Energy Technology Data Exchange (ETDEWEB)

    Wulf, Sven-Erik, E-mail: sven-erik.wulf@kit.edu; Krauss, Wolfgang; Konys, Jürgen

    2015-10-15

    Highlights: • New processes for barriers based on electroplating introduced in the last years. • New processes ECA and ECX able to overcome former fabrication problems. • Scales by ECA showed long-term compatibility in flowing Pb–Li (>12,000 h). • Further fusion relevant characterization and optimization of scales is required. • Qualification of T-permeation properties is urgently needed. - Abstract: Low-activation-ferritic–martensitic (RAFM) steels are candidates for structural materials in different blanket designs foreseen for DEMO and partly for TBM's tested in ITER. In all designs the liquid breeder Pb–15.7Li is in direct contact with the structural material, and thus two major topics – corrosion and T-permeation – influence the reliable, safe and economical application of such combination of breeder and structural material. As bare RAFM steels exhibit high corrosion rates of up to 400 μm/h in flowing Pb–15.7Li, Al-based coatings made by different coating processes were developed during the last 15 years and showed promising results in protecting RAFM steels from corrosion and T-permeation reduction. Especially barriers made by HDA, and electroplating (ECA, ECX), proved their ability to protect Eurofer against corrosion in flowing Pb–15.7Li. However, available T-permeation data for coated RAFM steels are rare and partly ambiguous for these coatings. This paper summarizes the state-of-the-art of aluminum-based barrier development and points out gaps and needs in future scale characterization and T-permeation barrier development. Additionally, necessary qualification steps on the path toward a reliable fabrication route are presented that is required to produce aluminum-based corrosion and T-permeation barriers on RAFM steels for blanket applications in future fusion reactors like DEMO.

  16. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    DR OKE

    Present MGs incorporate AC and DC sources and loads along with storage and power ... Keywords: Microgrid (MG), Distributed Energy Resources (DER), Particle ... But in case of renewable based MGs, where small and intermittent sources ...

  17. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed.......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  18. Phase sensitive quantum interference on forbidden transition in ladder scheme

    CERN Document Server

    Koganov, Gennady A

    2014-01-01

    A three level ladder system is analyzed and the coherence of initially electric-dipole forbidden transition is calculated. Due to the presence of two laser fields the initially dipole forbidden transition becomes dynamically permitted due to ac Stark effect. It is shown that such transitions exhibit quantum-interference-related phenomena, such as electromagnetically induced transparency, gain without inversion and enhanced refractive index. Gain and dispersion characteristics of such transitions strongly depend upon the relative phase between the driving and the probe fields. Unlike allowed transitions, gain/absorption behavior of ac-Stark allowed transitions exhibit antisymmetric feature on the Rabi sidebands. It is found that absorption/gain spectra possess extremely narrow sub-natural resonances on these ac Stark allowed forbidden transitions. An interesting finding is simultaneous existence of gain and negative dispersion at Autler-Townes transition which may lead to both reduction of the group velocity a...

  19. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  20. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  1. Electrothermal ac electro-osmosis

    Science.gov (United States)

    Gagnon, Zachary R.; Chang, Hsueh-Chia

    2009-01-01

    Two ac polarization mechanisms, charge accumulation due to electrode double layer charging and bulk permittivity/conductivity gradients generated by Joule heating, are combined in the double layer by introducing zwitterions to produce a new ac electrokinetic pump with the largest velocity (>1 mm/s) and flow penetration depth (100 μm) reported for low-conductivity fluids. The large fluid velocity is due to a quartic scaling with respect to voltage, as is true of electrothermal flow, but exhibits a clear maximum at a frequency corresponding to the electrode double layer inverse RC time.

  2. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  3. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  4. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  5. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  6. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  7. AcEST: DK947455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Picea... 246 9e-64 tr|A8QIH7|A8QIH7_MORAL Chlor...DPTARSDNGSCEYEFKE 479 >tr|A8QIH7|A8QIH7_MORAL Chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase ac

  8. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  9. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  10. Developing Structural, High-heat flux and Plasma Facing Materials for a near-term DEMO Fusion Power Plant: the EU Assessment

    CERN Document Server

    Stork, D; Boutard, J-L; Buckthorpe, D; Diegele, E; Dudarev, S L; English, C; Federici, G; Gilbert, M R; Gonzalez, S; Ibarra, A; Linsmeier, Ch; Puma, A Li; Marbach, G; Morris, P F; Packer, L W; Raj, B; Rieth, M; Tran, M Q; Ward, D J; Zinkle, S J

    2014-01-01

    The findings of the EU 'Materials Assessment Group' (MAG), within the 2012 EU Fusion Roadmap exercise, are discussed. MAG analysed the technological readiness of structural, plasma facing and high heat flux materials for a DEMO concept to be constructed in the early 2030s, proposing a coherent strategy for R&D up to a DEMO construction decision. Technical consequences for the materials required and the development, testing and modelling programmes, are analysed using: a systems engineering approach, considering reactor operational cycles, efficient maintenance and inspection requirements, and interaction with functional materials/coolants; and a project-based risk analysis, with R&D to mitigate risks from material shortcomings including development of specific risk mitigation materials.

  11. Design concept of conducting shell and in-vessel components suitable for plasma vertical stability and remote maintenance scheme in DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Utoh, Hiroyasu, E-mail: uto.hiroyasu@jaea.go.jp [Japan Atomic Energy Agency, Obuchi, Rokkasho-mura, Aomori-ken 039-3212 (Japan); International Fusion Energy Research Centre, 2-166, Obuchi, Rokkasho, Aomori 039-3212 (Japan); Takase, Haruhiko [Japan Atomic Energy Agency, Obuchi, Rokkasho-mura, Aomori-ken 039-3212 (Japan); International Fusion Energy Research Centre, 2-166, Obuchi, Rokkasho, Aomori 039-3212 (Japan); Sakamoto, Yoshiteru; Tobita, Kenji [Japan Atomic Energy Agency, Obuchi, Rokkasho-mura, Aomori-ken 039-3212 (Japan); Mori, Kazuo; Kudo, Tatsuya [Japan Atomic Energy Agency, Obuchi, Rokkasho-mura, Aomori-ken 039-3212 (Japan); International Fusion Energy Research Centre, 2-166, Obuchi, Rokkasho, Aomori 039-3212 (Japan); Someya, Youji; Asakura, Nobuyuki; Hoshino, Kazuo; Nakamura, Makoto; Tokunaga, Shinsuke [Japan Atomic Energy Agency, Obuchi, Rokkasho-mura, Aomori-ken 039-3212 (Japan)

    2016-02-15

    Highlights: • Conceptual design of in-vessel component including conducting shell has been investigated. • The conducting shell design for plasma vertical stability was clarified from the plasma vertical stability analysis. • The calculation results showed that the double-loop shell has the most effect on plasma vertical stability. - Abstract: In order to realize a feasible DEMO, we designed an in-vessel component including the conducting shell. The project is affiliated with the broader approach DEMO design activities and is conceptualized from a plasma vertical stability and engineering viewpoint. The dependence of the plasma vertical stability on the conducing shell parameters and the electromagnetic force at plasma disruption were investigated in numerical simulations (programmed in the 3D eddy current analysis code and a plasma position control code). The simulations assumed the actual shape and position of the vacuum vessel and in-vessel components. The plasma vertical stability was most effectively maintained by the double-loop shell.

  12. Multicriteria selection in concept design of a divertor remote maintenance port in the EU DEMO reactor using an AHP participative approach

    Energy Technology Data Exchange (ETDEWEB)

    Carfora, D. [Tampere University of Technology, Korkeakoulunkatu 6, 33720 Tampere (Finland); Gironimo, G. Di, E-mail: giuseppe.digironimo@unina.it [CREATE, University of Naples Federico II, P.le Tecchio 80, 80125 Napoli (Italy); Esposito, G. [CREATE, University of Naples Federico II, P.le Tecchio 80, 80125 Napoli (Italy); Huhtala, K. [Tampere University of Technology, Korkeakoulunkatu 6, 33720 Tampere (Finland); Määttä, T.; Mäkinen, H. [VTT Technical Research Centre of Finland, P.O. Box 1300, FI-33101 Tampere (Finland); Miccichè, G. [ENEA Brasimone, I:40032 Camugnano (Italy); Mozzillo, R. [CREATE, University of Naples Federico II, P.le Tecchio 80, 80125 Napoli (Italy)

    2016-11-15

    Highlights: • Concept Studies in Divertor Remote Handling. • Prioritization of concept alternatives. • Comparison and evaluation of product alternatives using AHP. - Abstract: The work behind this paper took place in the Eurofusion remote maintenance system project (WPRM) for the EU Demonstration Fusion Power Reactor (DEMO). Following ITER, the aim of DEMO is to demonstrate the capability of generating several hundreds of MW of net electricity by 2050. The main objective of this paper was the study of the most efficient design of the maintenance port for replacing the divertor cassettes in a Remote Handling (RH) point of view. In DEMO overall design, one important consideration is the availability and short down time operations. The inclination of the divertor port has a very important impact on all the RH tasks such as the design of the divertor mover, the divertor locking systems and the end effectors. The current reference scenario of the EU DEMO foresees a 45° inclined port for the remote maintenance (RM) of the divertor in the lower part of the reactor. Nevertheless, in the optic of the systems engineering (SE) approach, in early concept design phase, all possible configurations shall be taken into account. Even the solutions which seem not feasible at all need to be investigated, because they could lead to new and innovative engineering proposals. The different solutions were compared using an approach based on the Analytic Hierarchy Process (AHP). The technique is a multi-criteria decision making approach in which the factors that are important in making a decision are arranged in a hierarchic structure. The results of these studies show how the application of the AHP improved and focused the selection on the concept which is closer to the requirements arose from technical meetings with the experts of the RH field.

  13. Performance of tungsten-based materials and components under ITER and DEMO relevant steady-state thermal loads

    Energy Technology Data Exchange (ETDEWEB)

    Ritz, Guillaume Henri

    2011-07-01

    In nuclear fusion devices the surfaces directly facing the plasma are irradiated with high energy fluxes. The most intense loads are deposited on the divertor located at the bottom of the plasma chamber, which has to withstand continuous heat loads with a power density of several MW . m{sup -2} as well as transient events. These are much shorter (in the millisecond and sub-millisecond regime) but deposit a higher power densities of a few GW . m{sup -2}. The search for materials that can survive to those severe loading conditions led to the choice of tungsten which possesses advantageous attributes such as a high melting point, high thermal conductivity, low thermal expansion and an acceptable activation rate. These properties made it an attractive and promising candidate as armor material for divertors of future fusion devices such as ITER and DEMO. For the DEMO divertor, conceptual studies on helium-cooled tungsten plasma-facing components were performed. The concept was realized and tested under DEMO specific cyclic thermal loads. The examination of the plasma-facing components by microstructural analyses before and after thermal loading enabled to determine the mechanisms for components failure. Among others, it clearly showed the impact of the tungsten grade and the thermal stress induced crack formation on the performance of the armor material and in general of the plasma-facing component under high heat loads. A tungsten qualification program was launched to study the behaviour of various tungsten grades, in particular the crack formation, under fusion relevant steady-state thermal loads. In total, seven commercially available materials from two industrial suppliers were investigated. As the material's thermal response is strongly related to its microstructure, this program comprised different material geometries and manufacturing technologies. It also included the utilization of an actively cooled specimen holder which has been designed to perform

  14. Analysis of the thermo-mechanical behaviour of the DEMO Water-Cooled Lithium Lead breeding blanket module under normal operation steady state conditions

    Energy Technology Data Exchange (ETDEWEB)

    Di Maio, P.A.; Arena, P. [Dipartimento di Energia, Ingegneria dell’Informazione e Modelli Matematici, Università di Palermo, Viale delle Scienze, 90128 Palermo (Italy); Aubert, J. [CEA Saclay, DEN/DANS/DM2S/SEMT, 91191 Gif sur Yvette Cedex (France); Bongiovì, G. [Dipartimento di Energia, Ingegneria dell’Informazione e Modelli Matematici, Università di Palermo, Viale delle Scienze, 90128 Palermo (Italy); Chiovaro, P., E-mail: pierluigi.chiovaro@unipa.it [Dipartimento di Energia, Ingegneria dell’Informazione e Modelli Matematici, Università di Palermo, Viale delle Scienze, 90128 Palermo (Italy); Giammusso, R. [ENEA – C.R. Brasimone, 40032 Camugnano (Italy); Li Puma, A. [CEA Saclay, DEN/DANS/DM2S/SEMT, 91191 Gif sur Yvette Cedex (France); Tincani, A. [ENEA – C.R. Brasimone, 40032 Camugnano (Italy)

    2015-10-15

    Highlights: • A DEMO WCLL blanket module thermo-mechanical behaviour has been investigated. • Two models of the WCLL blanket module have been set-up adopting a code based on FEM. • The water flow domain in the module has been considered. • A set of uncoupled steady state thermo-mechanical analyses has been carried out. • Critical temperature is not overcome. Safety verifications are generally satisfied. - Abstract: Within the framework of DEMO R&D activities, a research cooperation has been launched between ENEA, the University of Palermo and CEA to investigate the thermo-mechanical behaviour of the outboard equatorial module of the DEMO1 Water-Cooled Lithium Lead (WCLL) blanket under normal operation steady state scenario. The research campaign has been carried out following a theoretical–computational approach based on the Finite Element Method (FEM) and adopting a qualified commercial FEM code. In particular, two different 3D FEM models (Model 1 and Model 2), reproducing respectively the central and the lateral poloidal–radial slices of the WCLL blanket module, have been set up. A particular attention has been paid to the modelling of water flow domain, within both the segment box channels and the breeder zone tubes, to simulate realistically the coolant-box thermal coupling. Results obtained are herewith reported and critically discussed.

  15. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  16. Potential and limits of water cooled divertor concepts based on monoblock design as possible candidates for a DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Li-Puma, Antonella, E-mail: antonella.lipuma@cea.fr [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Richou, Marianne; Magaud, Philippe; Missirlian, Marc [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Visca, Eliseo [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, IT-00044 Frascati (Italy); Ridolfini, Vincenzo Pericoli [EFDA-CSU Garching, PPPT department, D-85748 Garching bei München (Germany)

    2013-10-15

    In this paper water-cooled divertor concepts based on tungsten monoblock design identified in previous studies as candidate for fusion power plant have been reviewed to assess their potential and limits as possible candidates for a DEMO concept deliverable in a short to medium term (“conservative baseline design”). The rationale and technology development assumptions that have led to their selection are revisited taking into account present factual information on reactor parameters, materials properties and manufacturing technologies. For that purpose, main parameters impacting the divertor design are identified and their relevance discussed. The state of the art knowledge on materials and relevant manufacturing techniques is reviewed. Particular attention is paid to material properties change after irradiation; phenomenon thresholds (if any) and possible operating ranges are identified (in terms of temperature and damage dose). The suitability of various proposed heat sink/structural and sacrificial layer materials, as proposed in the past, are re-assessed (e.g. with regard to the possibility of reducing peak heat flux and/or neutron radiation damages). As a result, potential and limits of various proposed concepts are highlighted, ranges in which they could operate (if any) defined and possible improvements are proposed. Identified missing point in materials database and/or manufacturing techniques knowledge that should be uppermost investigated in future R and D activities are reported. This work has been carried out in the frame of EFDA PPPT Work Programme activities.

  17. Neutronic design studies of a conceptual DCLL fusion reactor for a DEMO and a commercial power plant

    Science.gov (United States)

    Palermo, I.; Veredas, G.; Gómez-Ros, J. M.; Sanz, J.; Ibarra, A.

    2016-01-01

    Neutronic analyses or, more widely, nuclear analyses have been performed for the development of a dual-coolant He/LiPb (DCLL) conceptual design reactor. A detailed three-dimensional (3D) model has been examined and optimized. The design is based on the plasma parameters and functional materials of the power plant conceptual studies (PPCS) model C. The initial radial-build for the detailed model has been determined according to the dimensions established in a previous work on an equivalent simplified homogenized reactor model. For optimization purposes, the initial specifications established over the simplified model have been refined on the detailed 3D design, modifying material and dimension of breeding blanket, shield and vacuum vessel in order to fulfil the priority requirements of a fusion reactor in terms of the fundamental neutronic responses. Tritium breeding ratio, energy multiplication factor, radiation limits in the TF coils, helium production and displacements per atom (dpa) have been calculated in order to demonstrate the functionality and viability of the reactor design in guaranteeing tritium self-sufficiency, power efficiency, plasma confinement, and re-weldability and structural integrity of the components. The paper describes the neutronic design improvements of the DCLL reactor, obtaining results for both DEMO and power plant operational scenarios.

  18. Landscape refuges delay resistance of the European corn borer to Bt-maize: a demo-genetic dynamic model.

    Science.gov (United States)

    Tyutyunov, Yuri; Zhadanovskaya, Ekaterina; Bourguet, Denis; Arditi, Roger

    2008-08-01

    We constructed a reaction-diffusion model of the development of resistance to transgenic insecticidal Bt crops in pest populations. Kostitzin's demo-genetic model describes local interactions between three competing pest genotypes with alleles conferring resistance or susceptibility to transgenic plants, the spatial spread of insects being modelled by diffusion. This new approach makes it possible to combine a spatial demographic model of population dynamics with classical genetic theory. We used this model to examine the effects of pest dispersal and of the size and shape of the refuge on the efficiency of the "high-dose/refuge" strategy, which was designed to prevent the development of resistance in populations of insect pests, such as the European corn borer, Ostrinia nubilalis Hübner (Lepidoptera, Crambidae). We found that, with realistic combinations of refuge size and pest dispersal, the development of resistance could be considerably delayed. With a small to medium-sized farming area, contiguous refuge plots are more efficient than a larger number of smaller refuge patches. We also show that the formal coupling of classical Fisher-Haldane-Wright population genetics equations with diffusion terms inaccurately describes the development of resistance in a spatially heterogeneous pest population, notably overestimating the speed with which Bt resistance is selected in populations of pests targeted by Bt crops.

  19. Spaceborne GNSS reflectometry for ocean winds: First results from the UK TechDemoSat-1 mission

    Science.gov (United States)

    Foti, Giuseppe; Gommenginger, Christine; Jales, Philip; Unwin, Martin; Shaw, Andrew; Robertson, Colette; Roselló, Josep

    2015-07-01

    First results are presented for ocean surface wind speed retrieval from reflected GPS signals measured by the low Earth orbiting UK TechDemoSat-1 satellite (TDS-1). Launched in July 2014, TDS-1 provides the first new spaceborne Global Navigation Satellite System-Reflectometry (GNSS-R) data since the pioneering UK-Disaster Monitoring Mission (UK-DMC) experiment in 2003. Examples of onboard-processed delay-Doppler maps reveal excellent data quality for winds up to 27.9 m/s. Collocated Advanced Scatterometer (ASCAT) winds are used to develop and evaluate a wind speed algorithm based on signal-to-noise ratio (SNR) and the bistatic radar equation. For SNRs greater than 3 dB, wind speed is retrieved without bias and a precision around 2.2 m/s between 3 and 18 m/s even without calibration. Exploiting lower SNR signals, however, requires good knowledge of the antenna beam, platform attitude, and instrument gain setting. This study demonstrates the capabilities of low-cost, low-mass, and low-power GNSS-R receivers ahead of their launch on the NASA Cyclone GNSS (CYGNSS) constellation in 2016.

  20. Design of a Multi-Tube Pd-Membrane Module for Tritium Recovery from He in DEMO

    Directory of Open Access Journals (Sweden)

    Marco Incelli

    2016-10-01

    Full Text Available Dense self-supported Pd-alloy membranes are used to selectively separate hydrogen and hydrogen isotopes. In particular, deuterium (D and tritium (T are currently identified as the main elements for the sustainability of the nuclear fusion reaction aimed at carbon free power generation. In the fusion nuclear reactors, a breeding blanket produces the tritium that is extracted and purified before being sent to the plasma chamber in order to sustain the fusion reaction. In this work, the application of Pd-alloy membranes has been tested for recovering tritium from a solid breeding blanket through a helium purge stream. Several simulations have been performed in order to optimize the design of a Pd-Ag multi-tube module in terms of geometry, operating parameters, and membrane module configuration (series vs. parallel. The results demonstrate that a pre-concentration stage before the Pd-membrane unit is mandatory because of the very low tritium concentration in the He which leaves the breeding blanket of the fusion reactor. The most suitable operating conditions could be reached by: (i increasing the hydrogen partial pressure in the lumen side and (ii decreasing the shell pressure. The preliminary design of a membrane unit has been carried out for the case of the DEMO fusion reactor: the optimized membrane module consists of an array of 182 Pd-Ag tubes of 500 mm length, 10 mm diameter, and 0.100 mm wall thickness (total active area of 2.85 m2.

  1. Development of Thermal-hydraulic Analysis Methodology for Multi-module Breeding Blankets in K-DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Geon-Woo; Lee, Jeong-Hun; Park, Goon-Cherl; Cho, Hyoung-Kyu [Seoul National University, Seoul (Korea, Republic of); Im, Kihak [National Fusion Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    In this paper, the purpose of the analyses is to extend the capability of MARS-KS to the entire blanket system which includes a few hundreds of single blanket modules. Afterwards, the plan for the whole blanket system analysis using MARS-KS is introduced and the result of the multiple blanket module analysis is summarized. A thermal-hydraulic analysis code for a nuclear reactor safety, MARS-KS, was applied for the conceptual design of the K-DEMO breeding blanket thermal analysis. Then, a methodology to simulate multiple blanket modules was proposed, which uses a supervisor program to handle each blanket module individually at first and then distribute the flow rate considering pressure drops arises in each module. For a feasibility test of the proposed methodology, 10 outboard blankets in a toroidal field sector were simulated, which are connected with each other through the inlet and outlet common headers. The calculation results of flow rates, pressure drops, and temperatures showed the validity of the calculation and thanks to the parallelization using MPI, almost linear speed-up could be obtained.

  2. Phase change of First Wall in Water-Cooled Breeding Blankets of K-DEMO for Vertical

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Geon Woo; Lee, Jeong Hun; Cho, Hyoung Kyu; Park, Goon Cherl [Seoul National University, Seoul (Korea, Republic of); Im, Ki Hak [NFRI, Daejeon (Korea, Republic of)

    2016-05-15

    The purpose of this study is to simulate thermal-hydraulic behavior of a single blanket module when plasma disruption occurs. Plasma disruptions, such as vertical displacement events (VDE), with high heat flux can cause melting and vaporization of plasma facing materials and also burnout of coolant channels. The thermal design, evaluation and validation have been performed in order to establish the conceptual design guidelines of the water-cooled breeding blanket for the K-DEMO reactor. As a part of the NFRI research, Seoul National University (SNU) is conducting transient thermal-hydraulic analysis to confirm the integrity of blanket system for plasma disruption events. Vertical displacement events (VDE) with high heat flux can cause melting and vaporization of plasma facing materials (PFCs) and also burnout of coolant channels. In order to simulate melting of first wall in blanket module when VDE occurs, one-dimensional heat conduction equations were solved numerically with modification of the specific heat of the first wall materials using effective heat capacity method. Temperature profiles in first wall for VDE are shown in fig 7 - 9. At first, temperature of tungsten rapidly raised and even exceeded its melting temperature. When VDE just ended at 0.1 second, 0.83 mm thick of tungsten melted. But the other materials including vanadium and RAFM didn't exceed their melting temperatures after 500 seconds.

  3. High current and low q{sub 95} scenario studies for FAST in the view of ITER and DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Calabrò, G., E-mail: giuseppe.calabro@enea.it [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044 Frascati, Rome (Italy); Crisanti, F.; Ramogida, G. [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044 Frascati, Rome (Italy); Mantica, P.; Baiocchi, B. [Istituto di Fisica del Plasma ‘P.Caldirola’, Associazione Euratom-ENEA-CNR, Milano (Italy); Cucchiaro, A.; Frosi, P.; Fusco, V. [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044 Frascati, Rome (Italy); Liu, Y. [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Mastrostefano, S.; Villone, F. [Associazione EURATOM/ENEA/CREATE, DIEI, Università di Cassino e del Lazio Meridionale (Italy); Vlad, G. [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044 Frascati, Rome (Italy); Fresa, R. [Associazione Euratom-ENEA-CREATE, DIFA-Univ. della Basilicata, Via dell’Ateneo Lucano, 10 I-85100 Potenza (Italy)

    2013-10-15

    The Fusion Advanced Study Torus (FAST) has been proposed as a possible European satellite, in view of ITER and DEMO, in order to: (a) explore plasma wall interaction in reactor relevant conditions, (b) test tools and scenarios for safe and reliable tokamak operation up to the border of stability, and (c) address fusion plasmas with a significant population of fast particles. A new FAST scenario has been designed focusing on low-q operation, at plasma current I{sub P} = 10 MA, toroidal field B{sub T} = 8.5 T, with a q{sub 95} ≈ 2.3 that would correspond to I{sub P} ≈ 20 MA in ITER. The flat-top of the discharge can last a couple of seconds (i.e. half the diffusive resistive time and twice the energy confinement time), and is limited by the heating of the toroidal field coils. A preliminary evaluation of the end-of-pulse temperatures and of the electromagnetic forces acting on the central solenoid pack and poloidal field coils has been performed. Moreover, a VDE plasma disruption has been simulated and the maximum total vertical force applied on the vacuum vessel has been estimated.

  4. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  5. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  6. Magic Wavelength for Hydrogen 1S-2S Transition

    CERN Document Server

    Kawasaki, Akio

    2015-01-01

    The magic wavelength for an optical lattice for hydrogen atoms that cancels the first order AC Stark shift of 1S-2S transition is calculated to be 513 nm. The amount of AC Stark shift $ \\Delta E = -1.19$ kHz/(10kW/cm$^2$) and the slope $d\\Delta E/d \

  7. Optimisation and assessment of theoretical impurity line power coefficients relevant to ITER and DEMO

    Science.gov (United States)

    Henderson, S. S.; Bluteau, M.; Foster, A.; Giunta, A.; O'Mullane, M. G.; Pütterich, T.; Summers, H. P.

    2017-05-01

    Total radiated line power coefficients for ions of medium to heavy weight elements, called { P }{ L }{ T } coefficients in the atomic data and analysis structure, have been improved by algorithmically optimising the selection of configuration sets that underpin the calculation to include the most important radiating transitions driven by both the ground and metastable configurations and to establish and limit the error of truncation. The optimised calculations typically differ from Pütterich by 20%-30% with truncation error ≲ 5 % . Further appraisal of error due to atomic level bundling, atomic structure and collision strength calculation methods has been carried out. It is shown that bundling to configurations is accurate to ≲ 10 % for all ions except those with closed-shell ground configurations which give errors up to a factor 2-3. For near neutral, closed-shell ions, plane-wave Born collision strength calculations, which omit spin-change, give substantial error in comparison with distorted-wave calculations of { P }{ L }{ T }. For highly charged ions, spin-system breakdown reduces the error in the { P }{ L }{ T } markedly, typically ≲ 10 % . The error introduced by the atomic structure codes used here, autostructure and the Cowan code, is probably limited to ≲ 30 % .

  8. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  9. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  10. DC and AC transport properties on La0.8Sr0.2MnO3

    Institute of Scientific and Technical Information of China (English)

    Zhantao Wei; Xinsheng Yang; Li Lv; Min Zhang; Yong Zhang

    2014-01-01

    Magnetoresistive sensor can be widely used in modern transportation field, such as the vehicle positioning and navigation system, vehicle detection system, and intelligent transportation system. In order to improve the efficiency of magnetoresistive sensor, we synthesized La0.8Sr0.2MnO3 polycrystalline bulks at different sintering temperatures and investigated their DC and AC transport properties in this work. As a result, all samples showed insulator-metal (I-M) phase transition, and the transition temperature (TI-M) shifted to higher temperature with the increase of sintering temperature. The TI-M measured at different AC frequencies was smaller than that measured at DC condition, which implied that the I-M phase transition was suppressed at AC frequencies. The resistivity mea-sured at high AC frequencies was larger than that measured at low AC frequencies, which could be attributed to the change of the magnetic penetration depth (d). However, the room-temperature AC-magnetoresistance (MR) at low frequencies was much larger than that at high frequencies and room-temperature DC-MR. These findings demon-strate that reducing the AC frequency is an effective way for enhancing the room-temperature MR, which can be used to promote the efficiency of magnetoresistive sensor.

  11. On radio frequency current drive in the ion cyclotron range of frequencies in DEMO and large ignited plasmas

    Science.gov (United States)

    Brambilla, Marco; Bilato, Roberto

    2015-02-01

    To explore the possibility of efficient fast wave current drive in an ignited plasma in the ion cyclotron (IC) range of frequency in spite of competition from absorption by ions, we have added to the full-wave toroidal code TORIC a set of subroutines which evaluate absorption by these particles at IC harmonic resonances, using a realistic ‘slowing-down’ distribution function, and taking into account that their Larmor radius is comparable or even larger than the fast wave wavelength. The thermalized population of α-particles is not a serious competitor for power absorption as long as their number density is compatible with maintenance of ignition. By contrast, the energetic slowing down fraction, in spite of its even greater dilution, can absorb from the waves a substantial amount of power at the cyclotron resonance and its harmonics. An extensive exploration both in frequency and in toroidal wavenumbers using the parameters of one of the European versions of DEMO shows that three frequency windows exist in which damping is nevertheless predominantly on the electrons. Designing an antenna capable of shaping the launched spectrum to optimize current drive, however, will not be straightforward. Only in a narrow range when the first IC harmonic of tritium is deep inside the plasma on the high-field side of the magnetic axis, and that of deuterium and helium is still outside on the low-field side, it appears possible to achieve a satisfactory current drive efficiency with a conventional multi-strap antenna, preferentially located in the upper part of the vessel. Exploiting the other two windows at quite low and quite high frequencies is either impossible on first principles, or will demand novel ideas in antenna design.

  12. Low-frequency ac transport in silicene nanosystem with normal-metal electrodes

    Science.gov (United States)

    Sun, Yun-Lei; Ye, En-Jia

    2017-08-01

    Low-frequency ac transport properties are investigated theoretically in the zigzag silicene nanosystem with normal-metal electrode/silicene nanoribbon/normal-metal electrode (NSN) structure. Based on the tight-binding approach and ac transport theory, we numerically compute the dc conductance and ac emittance in the nanosystem, by considering the nearest-neighbor hopping, second-nearest-neighbor spin-orbit interaction (SOI) and external electric field. The results show that the anti-resonance effect, caused by the interface scattering between the silicene ribbon and the normal-metal electrodes, is offset by the relatively strong SOI. The SOI induces a quantum phase transition and establishes a topological edge channel in the real space revealed by the local density of states (LDOS), resulting in a constant dc conductance and a vanishing ac emittance around the Dirac point. Further study suggests that the transport property is topologically protected by the SOI from the geometrical size change of the nanosystem.

  13. Current generation by helicons and LH waves in modern tokamaks and reactors FNSF-AT, ITER and DEMO. Scenarios, modeling and antennae

    Energy Technology Data Exchange (ETDEWEB)

    Vdovin, V. [NRC Kurchatov Institute Tokamak Physics Institute, Moscow (Russian Federation)

    2014-02-12

    The Innovative concept and 3D full wave code modeling Off-axis current drive by RF waves in large scale tokamaks, reactors FNSF-AT, ITER and DEMO for steady state operation with high efficiency was proposed [1] to overcome problems well known for LH method [2]. The scheme uses the helicons radiation (fast magnetosonic waves at high (20–40) IC frequency harmonics) at frequencies of 500–1000 MHz, propagating in the outer regions of the plasmas with a rotational transform. It is expected that the current generated by Helicons will help to have regimes with negative magnetic shear and internal transport barrier to ensure stability at high normalized plasma pressure β{sub N} > 3 (the so-called Advanced scenarios) of interest for FNSF and the commercial reactor. Modeling with full wave three-dimensional codes PSTELION and STELEC2 showed flexible control of the current profile in the reactor plasmas of ITER, FNSF-AT and DEMO [2,3], using multiple frequencies, the positions of the antennae and toroidal waves slow down. Also presented are the results of simulations of current generation by helicons in tokamaks DIII-D, T-15MD and JT-60SA [3]. In DEMO and Power Plant antenna is strongly simplified, being some analoge of mirrors based ECRF launcher, as will be shown. For spherical tokamaks the Helicons excitation scheme does not provide efficient Off-axis CD profile flexibility due to strong coupling of helicons with O-mode, also through the boundary conditions in low aspect machines, and intrinsic large amount of trapped electrons, as is shown by STELION modeling for the NSTX tokamak. Brief history of Helicons experimental and modeling exploration in straight plasmas, tokamaks and tokamak based fusion Reactors projects is given, including planned joint DIII-D – Kurchatov Institute experiment on helicons CD [1].

  14. Current generation by helicons and LH waves in modern tokamaks and reactors FNSF-AT, ITER and DEMO. Scenarios, modeling and antennae

    Science.gov (United States)

    Vdovin, V.

    2014-02-01

    The Innovative concept and 3D full wave code modeling Off-axis current drive by RF waves in large scale tokamaks, reactors FNSF-AT, ITER and DEMO for steady state operation with high efficiency was proposed [1] to overcome problems well known for LH method [2]. The scheme uses the helicons radiation (fast magnetosonic waves at high (20-40) IC frequency harmonics) at frequencies of 500-1000 MHz, propagating in the outer regions of the plasmas with a rotational transform. It is expected that the current generated by Helicons will help to have regimes with negative magnetic shear and internal transport barrier to ensure stability at high normalized plasma pressure βN > 3 (the so-called Advanced scenarios) of interest for FNSF and the commercial reactor. Modeling with full wave three-dimensional codes PSTELION and STELEC2 showed flexible control of the current profile in the reactor plasmas of ITER, FNSF-AT and DEMO [2,3], using multiple frequencies, the positions of the antennae and toroidal waves slow down. Also presented are the results of simulations of current generation by helicons in tokamaks DIII-D, T-15MD and JT-60SA [3]. In DEMO and Power Plant antenna is strongly simplified, being some analoge of mirrors based ECRF launcher, as will be shown. For spherical tokamaks the Helicons excitation scheme does not provide efficient Off-axis CD profile flexibility due to strong coupling of helicons with O-mode, also through the boundary conditions in low aspect machines, and intrinsic large amount of trapped electrons, as is shown by STELION modeling for the NSTX tokamak. Brief history of Helicons experimental and modeling exploration in straight plasmas, tokamaks and tokamak based fusion Reactors projects is given, including planned joint DIII-D - Kurchatov Institute experiment on helicons CD [1].

  15. Multiple Module Simulation of Water Cooled Breeding Blankets in K-DEMO Using Thermal-Hydraulic Analysis Code MARS-KS

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Geon-Woo; Lee, Jeong-Hun; Park, Goon-Cherl; Cho, Hyoung-Kyu [Seoul National University, Seoul (Korea, Republic of); Im, Kihak [National Fusion Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    A preliminary concept for the Korean fusion demonstration reactor (K-DEMO) has been studied by the National Fusion Research Institute (NFRI) based on the National Fusion Roadmap of Korea. The feasibility studies have been performed in order to establish the conceptual design guidelines of the breeding blanket. As a part of the NFRI research, Seoul National University (SNU) is conducting thermal design, evaluation and validation of the water-cooled breeding blanket for the K-DEMO reactor. The purpose of this study is to extend the capability of MARS-KS to the overall blanket system analysis which includes 736 blanket modules in total. The strategy for the multi-module blanket system analysis using MARS-KS is introduced and the analysis result of the 46 blanket modules of single sector was summarized. A thermal-hydraulic analysis code for a nuclear reactor safety, MARS-KS, was applied for thermal analysis of the conceptual design of the K-DEMO breeding blanket. Then, a methodology to simulate multiple blanket modules was proposed, which uses a supervisor program to handle each blanket module individually at first and then distribute the flow rate considering the pressure drop that occurs in each module. For a feasibility test of the proposed methodology, 46 blankets in a sector, which are connected with each other through the common headers for the sector inlet and outlet, were simulated. The calculation results of flow rates, pressure drops, and temperatures showed the validity of the calculation. Because of parallelization using the MPI system, the computational time could be reduced significantly. In future, this methodology will be extended to an efficient simulation of multiple sectors, and further validation for transient simulation will be carried out for more practical applications.

  16. GNSS-R Sea/Land and Sea/Ice Transition Dtetectiond from TDS-1 DDMs

    Science.gov (United States)

    Schiavulli, D.; Frappart, F.; Darrozes, J.; Ramilien, G.; Nunziata, F.; Migliaccio, M.

    2016-08-01

    In this paper, Global Navigation Satellite System (GNSS) Reflectometry, GNSS-R, Delay-Doppler Maps (DDMs) are processed to provide added value products for imaging remote sensing. In particular, actual DDMs collected by the UK TechDemoSat- 1 sensor are processed in order to reconstruct the Normalized Radar Cross section field for marine scenarios including non homogeneous elements, i.e. sea/land and sea/ice transition. The result consists of a radar image of the observed scene able to complement data provided by sensors dedicated to imaging remote sensing.

  17. A DEVICE FOR MEASURING SUPERCONDUCTING TRANSITION TEMPERATURE BY AC SUSCEPTIBILITY MEASUREMENT OF SUPERCONDUCTING FILM IN SMALL ^* CRYOCOOLER%在小型制冷机中测量薄片交流磁化率以决定超导转变温度的装置

    Institute of Scientific and Technical Information of China (English)

    褚向华; 王三胜; 杨慧; 陈笃行

    2012-01-01

    In this paper, a device for measuring superconducting transition temperature in small cryocooler, based on principles of electromagnetic induction and superconducting magnetic effect, is introduced. This device consists of a vacuum chamber, a small cryocooler, a vacuum pump, a vacuum gauge, a lock-in amplifier, a temperature controller, a computer and a coil pancake and so on. The coil pancake, which is fixed in the vacuum claamoer, contains a primary coil and secondary coil, the primary coil and secondary coil are respectively wound onto two coil formers. The measured superconducting thin film is put between the primary coil and the secondary coil. The small cryocooler is used to cool superconducting thin film, the vacuum pump is used to pump gas in the vacuum chamber, and the temperature controller is used to measure and control the temperature of superconducting thin filro. The internal oscillator of the lock-in amplifier is connected to the primary coil to provide an excitation field exerted to the superconducting film. At the same time, the lock-in amplifier is used to measure the response of the secondary coil. In our system, the sample temperature datum and the voltage output of the secondary coil are transmitted and saved in the computer; then these datum can be drawn into V--T lines displayed on the computer screen at real time. Experiments show that this device can be used to obtain superconducting transition temperature automatically by measuring ac susceptibility with a lower cost.%本文介绍了一种利用电磁感应原理和超导磁效应,在小型制冷机中测量超导体转变温度的装置.本装置包括密闭的真空室、压缩制冷机、真空泵、真空计、锁相放大器、温控仪、计算机、线圈绕组.其中,线圈绕组置于真空室内,由初级线圈和次级线圈组成,初级线圈和次级线圈分别绕制在两个线圈骨架上;被测超导薄片材料放置于初级线圈和次级线圈之间

  18. 聚变示范堆气体注入系统氚渗透分析%Tritium permeation of gas injection system for DEMO

    Institute of Scientific and Technical Information of China (English)

    王俊; 张国书; 张龙

    2014-01-01

    以中国聚变工程实验堆(CFETR)的堆芯参数为例,参照ITER的相关工程设计,对聚变示范堆(DEMO)气体注入系统(GIS)作出了初步的管道布局考虑。基于此布局,计算了稳态运行下 GIS 含氚管道气流压降,对燃料储存与输运系统的泵压头提出了要求,得出相应泵压头下GIS的氚渗透量。计算结果表明,重力势是管道气流压降的主要原因,在负压情况下,GIS的氚渗透对整体氚循环的影响不大。这为研究DEMO的氚自持问题提供了相关参数,为GIS歧管布局的进一步优化奠定了基础。%In the present work, tritium permeation issue of gas injection system (GIS) in DEMO were focused. Based on the reactor core parameters of Chian Fusion Engineering Test Reactor (CFETR) and referring to accumulated experience of GIS design in ITER, preliminary pipes layout of DEMO GIS was performed. Steady-state tritium gas pressure drop calculation along the pipes and pump head request to the fuel storage and delivery system were made on the basis of the GIS’s structure layout. Tritium permeation under corresponding pump head was calculated at the same time. According to the calculation results, gravitational potential is the main determinant to pressure drop in pipe flow and the tritium permeation in GIS is of little amount to the whole tritium cycle in the case negative pressure. So this work offers related parameters to tritium self-sufficiency issues in DEMO, and also lays the foundation for further optimization of GIS’s structure layout.

  19. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  20. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  1. Shape Dependence of Low-Temperature Magnetic Relaxation of Mn12Ac

    Institute of Scientific and Technical Information of China (English)

    LIU Hai-Qing; SU Shao-Kui; JING Xiu-nian; LIU Ying; LI Yan-rong; HE Lun-Hua; GE Pei-Wen; YAN Qi-Wei; WANG Yun-Ping

    2008-01-01

    We report the discovery that the low-temperature magnetic relaxation in Mn,12 Ac single crystals strongly depends on the shape of the samples. The relaxation time exhibits a minimum at the phase transition point between ferromagnetic and antiferromagnetic phases. The shape dependence is attributed to the dipolar interaction between molecular magnets.

  2. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  3. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  4. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  5. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  6. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  7. Anomalous behavior of magnetostriction and magnetic ac-suseptibility of Gd1-xPrxCo5 polycrystals

    Directory of Open Access Journals (Sweden)

    A. Amirabadizadeh

    2003-12-01

    Full Text Available Magnetostriction and low field ac-susceptibility of polycrystalline Gd1-xPrxCo5 (x = 0, 0.1 and 0.5 alloys are measured in temperature region of 77-300 K. XRD patterns show that our samples are single phase. For x = 0 (GdCo5 there are no anomaly in temperature dependence of magnetostriction and ac-susceptibility curves. For x = 0.1 and 0.5 temperature dependence of ac-susceptibilities show easy-axes phase transitions. In the case of x = 0.1 sample, the easy-axes of magnetization changes from canted to axial (practically, hexagonal c-axis direction as temperature increases, and ac-susceptibility of x = 0.5 sample shows two iterative transitions, first from basal to canted then canted to axial. Magnetostriction of Pr contained samples anomalously decreases at spin reorientation regions.

  8. Constituting the polity, constituting the demos: on the place of the all affected interests principle in democratic theory and in resolving the democratic boundary problem

    Directory of Open Access Journals (Sweden)

    David Owen

    2012-09-01

    Full Text Available This essay considers the role of the ‘all affected interests’ principle in democratic theory, focusing on debates concerning its form, substance and relationship to the resolution of the democratic boundary problem. It begins by defending an ‘all actually affected’ formulation of the principle against Goodin's ‘incoherence argument’ critique of this formulation, before addressing issues concerning how to specify the choice set appropriate to the principle. Turning to the substance of the principle, the argument rejects Nozick's dismissal of its intuitive appeal and considers the two arguments advanced in favour of the principle as a criterion of democratic inclusion: the interlinked interests argument and the tracking power argument. It is shown that neither of these arguments can substantiate a view of the principle as a criterion of democratic inclusion, although both ground a constitutional understanding of the principle as specifying the scope of a duty of justification. It is then proposed that the principle can play an important role in a two-stage resolution of the democratic boundary problem in which it addresses the question of who is entitled to inclusion in the ‘pre-political’ demos that determines whether to constitute a polity. The second stage of this resolution requires an answer to the question of who should constitute the ‘political demos’, that is, the demos of a constituted polity and it is argued that a version of the “all subjected persons” principle can appropriately play this role.

  9. Normal and Accidental Scenarios Analyses with MELCOR 1.8.2 and MELCOR 2.1 for the DEMO Helium-Cooled Pebble Bed Blanket Concept

    Directory of Open Access Journals (Sweden)

    Bruno Gonfiotti

    2015-01-01

    Full Text Available As for Light Water Reactors (LWRs, one of the most challenging accidents for the future DEMOnstration power plant is the Loss of Coolant Accident, which can trigger the pressurization of the confinement structures and components. Hence, careful analyses have to be executed to demonstrate that the confinement barriers are able to withstand the pressure peak within design limits and the residual cooling capabilities of the Primary Heat Transfer System are sufficient to remove the decay heat. To do so, severe accident codes, as MELCOR, can be employed. In detail, the MELCOR code has been developed to cope also with fusion reactors, but unfortunately, these fusion versions are based on the old 1.8.x source code. On the contrary, for LWRs, the newest 2.1.x versions are continuously updated. Thanks to the new features introduced in these latest 2.1.x versions, the main phenomena occurring in the helium-cooled blanket concepts of DEMO can be simulated in a basic manner. For this purpose, several analyses during normal and accidental DEMO conditions have been executed. The aim of these analyses is to compare the results obtained with MELCOR 1.8.2 and MELCOR 2.1 in order to highlight the differences among the results of the main thermal-hydraulic parameters.

  10. TBM/MTM for HTS-FNSF: An Innovative Testing Strategy to Qualify/Validate Fusion Technologies for U.S. DEMO

    Directory of Open Access Journals (Sweden)

    Laila El-Guebaly

    2016-08-01

    Full Text Available The qualification and validation of nuclear technologies are daunting tasks for fusion demonstration (DEMO and power plants. This is particularly true for advanced designs that involve harsh radiation environment with 14 MeV neutrons and high-temperature operating regimes. This paper outlines the unique qualification and validation processes developed in the U.S., offering the only access to the complete fusion environment, focusing on the most prominent U.S. blanket concept (the dual cooled PbLi (DCLL along with testing new generations of structural and functional materials in dedicated test modules. The venue for such activities is the proposed Fusion Nuclear Science Facility (FNSF, which is viewed as an essential element of the U.S. fusion roadmap. A staged blanket testing strategy has been developed to test and enhance the DCLL blanket performance during each phase of FNSF D-T operation. A materials testing module (MTM is critically important to include in the FNSF as well to test a broad range of specimens of future, more advanced generations of materials in a relevant fusion environment. The most important attributes for MTM are the relevant He/dpa ratio (10–15 and the much larger specimen volumes compared to the 10–500 mL range available in the International Fusion Materials Irradiation Facility (IFMIF and European DEMO-Oriented Neutron Source (DONES.

  11. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  12. DEMO-II trial. Aerobic exercise versus stretching exercise in patients with major depression-a randomised clinical trial.

    Directory of Open Access Journals (Sweden)

    Jesper Krogh

    Full Text Available BACKGROUND: The effect of referring patients from a clinical setting to a pragmatic exercise intervention for depressive symptoms, cognitive function, and metabolic variables has yet to be determined. METHODS: Outpatients with major depression (DSM-IV were allocated to supervised aerobic or stretching exercise groups during a three months period. The primary outcome was the Hamilton depression score (HAM-D(17. Secondary outcomes were cognitive function, cardiovascular risk markers, and employment related outcomes. RESULTS: 56 participants were allocated to the aerobic exercise intervention versus 59 participants to the stretching exercise group. Post intervention the mean difference between groups was -0.78 points on the HAM-D(17 (95% CI -3.2 to 1.6; P = .52. At follow-up, the participants in the aerobic exercise group had higher maximal oxygen uptake (mean difference 4.4 l/kg/min; 95% CI 1.7 to 7.0; P = .001 and visuospatial memory on Rey's Complex Figure Test (mean difference 3.2 points; 95% CI 0.9 to 5.5; P = .007 and lower blood glucose levels (mean difference 0.2 mmol/l; 95% CI 0.0 to 0.5; P = .04 and waist circumference (mean difference 2.2 cm; 95% CI 0.3 to 4.1; P = .02 compared with the stretching exercise group. CONCLUSIONS: The results of this trial does not support any antidepressant effect of referring patients with major depression to a three months aerobic exercise program. Due to lower recruitment than anticipated, the trial was terminated prior to reaching the pre-defined sample size of 212 participants; therefore the results should be interpreted in that context. However, the DEMO-II trial does suggest that an exercise program for patients with depression offer positive short-term effects on maximal oxygen uptake, visuospatial memory, fasting glucose levels, and waist circumference. TRIAL REGISTRATION: ClinicalTrials.gov NCT00695552.

  13. Dosimetric impact evaluation of primary coolant chemistry of the internal tritium breeding cycle of a fusion reactor DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Velarde, M. [Instituto de Fusion Nuclear (DENIM), ETSII, Universidad Politecnica Madrid UPM, J. Gutierrez Abascal 2, Madrid 28006 (Spain); Sedano, L. A. [Asociacion Euratom-Ciematpara Fusion, Av. Complutense 22, 28040 Madrid (Spain); Perlado, J. M. [Instituto de Fusion Nuclear (DENIM), ETSII, Universidad Politecnica Madrid UPM, J. Gutierrez Abascal 2, Madrid 28006 (Spain)

    2008-07-15

    Tritium will be responsible for a large fraction of the environmental impact of the first generation of DT fusion reactors. Today, the efforts of conceptual development of the tritium cycle for DEMO are mainly centred in the so called Inner Breeding Tritium Cycle, conceived as guarantee of reactor fuel self-sufficiency. The EU Fusion Programme develops for the short term of fusion power technology two breeding blanket conceptual designs both helium cooled. One uses Li-ceramic material (HCPB, Helium-Cooled Pebble Bed) and the other a liquid metal eutectic alloy (Pb15.7Li) (HCLL, Helium-Cooled Lithium Lead). Both are Li-6 enriched materials. At a proper scale designs will be tested as Test Blanket Modules in ITER. The tritium cycles linked to both blanket concepts are similar, with some different characteristics. The tritium is recovered from the He purge gas in the case of HCPB, and directly from the breeding alloy through a carrier gas in HCLL. For a 3 GWth self-sufficient fusion reactor the tritium breeding need is few hundred grams of tritium per day. Safety and environmental impact are today the top priority design criteria. Dose impact limits should determine the key margins and parameters in its conception. Today, transfer from the cycle to the environment is conservatively assumed to be operating in a 1-enclosure scheme through the tritium plant power conversion system (intermediate heat exchangers and helium blowers). Tritium loss is caused by HT and T{sub 2} permeation and simultaneous primary coolant leakage through steam generators. Primary coolant chemistry appears to be the most natural way to control tritium permeation from the breeder into primary coolant and from primary coolant through SG by H{sub 2} tritium flux isotopic swamping or steel (EUROFER/INCOLOY) oxidation. A primary coolant chemistry optimization is proposed. Dynamic flow process diagrams of tritium fluxes are developed ad-hoc and coupled with tritiated effluents dose impact evaluations

  14. Cluster emission in the radioactive decay of 223Ac

    CERN Document Server

    Steyn, G F; Faccio, D; Bonetti, R; Tretyakova, S P; Shishkin, S V; Ogloblin, A A; Pik-Pichak, G A; Vermeulen, C; van der Meulen, N P; van der Walt, T N; McGee, D

    2010-01-01

    The branching ratio of 223Ac decay by spontaneous 14C emission was measured and a search for 15N clusters was performed. After exposure of a hemispherical array of solid-state nuclear track detectors, 347 14C events were identified and no 15N events. B(14C) = λ(14C)/λ(α) = (3.2 ± 1.0) x 10-11 is consistent with a favoured ground state to ground state transition. As no nitrogen tracks were found, only an upper limit could be inferred for 15N emission, B(15N) = λ(15N)/λ(α) ≤ 2.2 x 10-13 (confidence limit 90%), consistent with an unfavoured transition. Intense 227Pa sources were produced for this study, using the reaction 232Th(p,6n)227Pa. This offered an opportunity to compare the measured source strength with predictions based on published excitation function data.

  15. AC polarographic determination of cloxacillin.

    Science.gov (United States)

    Núñez-Vergara, L J; Silva, M M; Squella, J A

    1982-11-01

    Hydrolysis of cloxacillin at pH 4.0 yields an electroactive product which can be determined by polarography. Depending on the concentration of cloxacillin, one of 2 peaks was obtained: The potential ac peaks for a 4.36 mM cloxacillin solution were peak I, -0.23 V and peak II, -0.13 V. For analytical purposes, the first peak was used. A linear relationship was established for levels of cloxacillin between 2.2 X 10(-5) and 2.2 X 10(-3)M. Average recovery was 98.8% (SD 1.8), indicating satisfactory accuracy for the method. Individual capsule and composite assays as well as interference tests are described.

  16. Developing structural, high-heat flux and plasma facing materials for a near-term DEMO fusion power plant: The EU assessment

    Energy Technology Data Exchange (ETDEWEB)

    Stork, D., E-mail: derek.stork@btinternet.com [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Agostini, P. [ENEA, Brasimone Research Centre, 40032 Cumugnano, Bologna (Italy); Boutard, J.L. [CEA, cab HC, Saclay, F-91191 Gif-sur-Yvette (France); Buckthorpe, D. [AMEC, Booths Park, Chelford Road, Knutsford, Cheshire WA16 8QZ (United Kingdom); Diegele, E. [Karlsruhe Institute for Technology, IMF-I, D-7602 Karlsruhe (Germany); Dudarev, S.L. [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); English, C. [National Nuclear Laboratory, Chadwick House, Warrington Road, Birchwood Park WA3 6AE (United Kingdom); Federici, G. [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching 85748 (Germany); Gilbert, M.R. [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Gonzalez, S. [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching 85748 (Germany); Ibarra, A. [CIEMAT, Avda. Complutense 40, Madrid (Spain); Linsmeier, Ch. [Forschungszentrum Jülich GmbH, Institut für Energie- und Klimaforschung – Plasmaphysik, EURATOM Association, 52425 Jülich (Germany); Li Puma, A. [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Marbach, G. [CEA, cab HC, Saclay, F-91191 Gif-sur-Yvette (France); Morris, P.F. [Formerly of TATA Steel Europe, Swinden Technology Centre, Moorgate, Rotherham S60 3AR (United Kingdom); Packer, L.W. [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Raj, B. [Indian National Academy of Engineering, Shaheed Jeet Singh Marg, New Delhi 110016 (India); Rieth, M. [Karlsruhe Institute for Technology, IMF-I, D-7602 Karlsruhe (Germany); and others

    2014-12-15

    The findings of the EU ‘Materials Assessment Group’ (MAG), within the 2012 EU Fusion Roadmap exercise, are discussed. MAG analysed the technological readiness of structural, plasma facing and high heat flux materials for a DEMO concept to be constructed in the early 2030s, proposing a coherent strategy for R and D up to a DEMO construction decision. A DEMO phase I with a ‘Starter Blanket’ and ‘Starter Divertor’ is foreseen: the blanket being capable of withstanding ⩾2 MW yr m{sup −2} fusion neutron fluence (∼20 dpa in the front-wall steel). A second phase ensues for DEMO with ⩾5 MW yr m{sup −2} first wall neutron fluence. Technical consequences for the materials required and the development, testing and modelling programmes, are analysed using: a systems engineering approach, considering reactor operational cycles, efficient maintenance and inspection requirements, and interaction with functional materials/coolants; and a project-based risk analysis, with R and D to mitigate risks from material shortcomings including development of specific risk mitigation materials. The DEMO balance of plant constrains the blanket and divertor coolants to remain unchanged between the two phases. The blanket coolant choices (He gas or pressurised water) put technical constraints on the blanket steels, either to have high strength at higher temperatures than current baseline variants (above 650 °C for high thermodynamic efficiency from He-gas coolant), or superior radiation-embrittlement properties at lower temperatures (∼290–320 °C), for construction of water-cooled blankets. Risk mitigation proposed would develop these options in parallel, and computational and modelling techniques to shorten the cycle-time of new steel development will be important to achieve tight R and D timescales. The superior power handling of a water-cooled divertor target suggests a substructure temperature operating window (∼200–350 °C) that could be realised, as a

  17. Developing structural, high-heat flux and plasma facing materials for a near-term DEMO fusion power plant: The EU assessment

    Science.gov (United States)

    Stork, D.; Agostini, P.; Boutard, J. L.; Buckthorpe, D.; Diegele, E.; Dudarev, S. L.; English, C.; Federici, G.; Gilbert, M. R.; Gonzalez, S.; Ibarra, A.; Linsmeier, Ch.; Li Puma, A.; Marbach, G.; Morris, P. F.; Packer, L. W.; Raj, B.; Rieth, M.; Tran, M. Q.; Ward, D. J.; Zinkle, S. J.

    2014-12-01

    The findings of the EU 'Materials Assessment Group' (MAG), within the 2012 EU Fusion Roadmap exercise, are discussed. MAG analysed the technological readiness of structural, plasma facing and high heat flux materials for a DEMO concept to be constructed in the early 2030s, proposing a coherent strategy for R&D up to a DEMO construction decision. A DEMO phase I with a 'Starter Blanket' and 'Starter Divertor' is foreseen: the blanket being capable of withstanding ⩾2 MW yr m-2 fusion neutron fluence (∼20 dpa in the front-wall steel). A second phase ensues for DEMO with ⩾5 MW yr m-2 first wall neutron fluence. Technical consequences for the materials required and the development, testing and modelling programmes, are analysed using: a systems engineering approach, considering reactor operational cycles, efficient maintenance and inspection requirements, and interaction with functional materials/coolants; and a project-based risk analysis, with R&D to mitigate risks from material shortcomings including development of specific risk mitigation materials. The DEMO balance of plant constrains the blanket and divertor coolants to remain unchanged between the two phases. The blanket coolant choices (He gas or pressurised water) put technical constraints on the blanket steels, either to have high strength at higher temperatures than current baseline variants (above 650 °C for high thermodynamic efficiency from He-gas coolant), or superior radiation-embrittlement properties at lower temperatures (∼290-320 °C), for construction of water-cooled blankets. Risk mitigation proposed would develop these options in parallel, and computational and modelling techniques to shorten the cycle-time of new steel development will be important to achieve tight R&D timescales. The superior power handling of a water-cooled divertor target suggests a substructure temperature operating window (∼200-350 °C) that could be realised, as a baseline-concept, using tungsten on a copper

  18. Silencing of Two Insulin Receptor Genes Disrupts Nymph-Adult Transition of Alate Brown Citrus Aphid

    Science.gov (United States)

    Ding, Bi-Yue; Shang, Feng; Zhang, Qiang; Xiong, Ying; Yang, Qun; Niu, Jin-Zhi; Smagghe, Guy; Wang, Jin-Jun

    2017-01-01

    Insulin receptors play key roles in growth, development, and polymorphism in insects. Here, we report two insulin receptor genes (AcInR1 and AcInR2) from the brown citrus aphid, Aphis (Toxoptera) citricidus. Transcriptional analyses showed that AcInR1 increased during the nymph–adult transition in alate aphids, while AcInR2 had the highest expression level in second instar nymphs. AcInR1 is important in aphid development from fourth instar nymphs to adults as verified by dsRNA feeding mediated RNAi. The silencing of AcInR1 or/and AcInR2 produced a variety of phenotypes including adults with normal wings, malformed wings, under-developed wings, and aphids failing to develop beyond the nymphal stages. Silencing of AcInR1 or AcInR2 alone, and co-silencing of both genes, resulted in 73% or 60%, and 87% of aphids with problems in the transition from nymph to normal adult. The co-silencing of AcInR1 and AcInR2 resulted in 62% dead nymphs, but no mortality occurred by silencing of AcInR1 or AcInR2 alone. Phenotypes of adults in the dsInR1 and dsInR2 were similar. The results demonstrate that AcInR1 and AcInR2 are essential for successful nymph–adult transition in alate aphids and show that RNAi methods may be useful for the management of this pest. PMID:28230772

  19. Examining the Link Between Public Transit Use and Active Commuting

    Directory of Open Access Journals (Sweden)

    Melissa Bopp

    2015-04-01

    Full Text Available Background: An established relationship exists between public transportation (PT use and physical activity. However, there is limited literature that examines the link between PT use and active commuting (AC behavior. This study examines this link to determine if PT users commute more by active modes. Methods: A volunteer, convenience sample of adults (n = 748 completed an online survey about AC/PT patterns, demographic, psychosocial, community and environmental factors. t-test compared differences between PT riders and non-PT riders. Binary logistic regression analyses examined the effect of multiple factors on AC and a full logistic regression model was conducted to examine AC. Results: Non-PT riders (n = 596 reported less AC than PT riders. There were several significant relationships with AC for demographic, interpersonal, worksite, community and environmental factors when considering PT use. The logistic multivariate analysis for included age, number of children and perceived distance to work as negative predictors and PT use, feelings of bad weather and lack of on-street bike lanes as a barrier to AC, perceived behavioral control and spouse AC were positive predictors. Conclusions: This study revealed the complex relationship between AC and PT use. Further research should investigate how AC and public transit use are related.

  20. Simulational studies of epitaxial semiconductor superlattices: Quantum dynamical phenomena in ac and dc electric fields

    Energy Technology Data Exchange (ETDEWEB)

    Reynolds, Joseph [Iowa State Univ., Ames, IA (United States)

    1997-10-08

    Using high-accuracy numerical methods the author investigates the dynamics of independent electrons in both ideal and realistic superlattices subject to arbitrary ac and/or dc electric fields. For a variety of superlattice potentials, optically excited initial wave packets, and combinations of ac and dc electric fields, he numerically solves the time-dependent Schroedinger equation. In the case of ideal periodic superlattice potentials, he investigates a long list of dynamical phenomena involving multiple miniband transitions and time-dependent electric fields. These include acceleration effects associated with interminiband transitions in strong fields, Zener resonances between minibands, dynamic localization with ac fields, increased single-miniband transport with an auxiliary resonant ac field, and enhanced or suppressed interminiband probability exchange using an auxiliary ac field. For all of the cases studied, the resulting time-dependent wave function is analyzed by projecting the data onto convenient orthonormal bases. This allows a detailed comparison with approximately analytic treatments. In an effort to explain the rapid decay of experimentally measured Bloch oscillation (BO) signals the author incorporates a one-dimensional representation of interface roughness (IR) into their superlattice potential. He shows that as a result of IR, the electron dynamics can be characterized in terms of many discrete, incommensurate frequencies near the Block frequency. Chapters 2, 3, 4 and 5 have been removed from this report and will be processed separately.

  1. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  2. AcEST: BP916793 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SC complexes subunit ssr2 OS=S... 66 6e-14 sp|Q9XI07|SWI3C_ARATH SWI/SNF complex subunit SWI3C OS=Arabidops...... 65 1e-12 sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidops... 66 2e-12 sp|P97496|SMRC1_MOU...2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidops... 59 9e-09 sp|Q8W475|SWI3A_ARATH SWI/SNF complex s...ional adapter ADA2 OS=Oryza sati... 47 3e-05 sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidops...... 45 2e-04 sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidops... 44 3e-04 sp|Q5ZJF3|TAD2A_C

  3. The Ethylene Biosynthesis Gene CitACS4 Regulates Monoecy/Andromonoecy in Watermelon (Citrullus lanatus.

    Directory of Open Access Journals (Sweden)

    Susana Manzano

    Full Text Available Monoecious and andromonoecious cultivars of watermelon are characterised by the production of male and female flower or male and hermaphrodite flowers, respectively. The segregation analysis in the offspring of crosses between monoecious and andromonoecious lines has demonstrated that this trait is controlled by a single gene pair, being the monoecious allele M semi-dominant to the andromonoecious allele A. The two studied F1 hybrids (MA had a predominantly monoecious phenotype since both produced not only female flowers, but also bisexual flowers with incomplete stamens, and hermaphrodite flowers with pollen. Given that in other cucurbit species andromonoecy is conferred by mutations in the ethylene biosynthesis genes CmACS7, CsACS2 and CpACS27A we have cloned and characterised CitACS4, the watermelon gene showing the highest similarity with the formers. CitACS4 encoded for a type ACS type III enzyme that is predominantly expressed in pistillate flowers of watermelon. In the andromonoecious line we have detected a missense mutation in a very conserved residue of CitACS4 (C364W that cosegregates with the andromonoecious phenotype in two independent F2 populations, concomitantly with a reduction in ethylene production in the floral buds that will develop as hermaphrodite flowers. The gene does not however co-segregates with other sex expression traits regulated by ethylene in this species, including pistillate flowering transition and the number of pistillate flowers per plant. These data indicate that CitAC4 is likely to be involved in the biosynthesis of the ethylene required for stamen arrest during the development of female flowers. The C364W mutation would reduce the production of ethylene in pistillate floral buds, promoting the conversion of female into hermaphrodite flowers, and therefore of monoecy into andromonoecy.

  4. The Ethylene Biosynthesis Gene CitACS4 Regulates Monoecy/Andromonoecy in Watermelon (Citrullus lanatus).

    Science.gov (United States)

    Manzano, Susana; Aguado, Encarnación; Martínez, Cecilia; Megías, Zoraida; García, Alicia; Jamilena, Manuel

    2016-01-01

    Monoecious and andromonoecious cultivars of watermelon are characterised by the production of male and female flower or male and hermaphrodite flowers, respectively. The segregation analysis in the offspring of crosses between monoecious and andromonoecious lines has demonstrated that this trait is controlled by a single gene pair, being the monoecious allele M semi-dominant to the andromonoecious allele A. The two studied F1 hybrids (MA) had a predominantly monoecious phenotype since both produced not only female flowers, but also bisexual flowers with incomplete stamens, and hermaphrodite flowers with pollen. Given that in other cucurbit species andromonoecy is conferred by mutations in the ethylene biosynthesis genes CmACS7, CsACS2 and CpACS27A we have cloned and characterised CitACS4, the watermelon gene showing the highest similarity with the formers. CitACS4 encoded for a type ACS type III enzyme that is predominantly expressed in pistillate flowers of watermelon. In the andromonoecious line we have detected a missense mutation in a very conserved residue of CitACS4 (C364W) that cosegregates with the andromonoecious phenotype in two independent F2 populations, concomitantly with a reduction in ethylene production in the floral buds that will develop as hermaphrodite flowers. The gene does not however co-segregates with other sex expression traits regulated by ethylene in this species, including pistillate flowering transition and the number of pistillate flowers per plant. These data indicate that CitAC4 is likely to be involved in the biosynthesis of the ethylene required for stamen arrest during the development of female flowers. The C364W mutation would reduce the production of ethylene in pistillate floral buds, promoting the conversion of female into hermaphrodite flowers, and therefore of monoecy into andromonoecy.

  5. KBSA Concept Demo

    Science.gov (United States)

    1993-04-01

    93-38 has been reviewed and is approved for publication. DONALD M. ELEFANTE Project Engineer FOR THE COMMANDER: •ER Chief Scientist Command, Control...NOTES Rome Laboratory Project Engineer: Donald M. Elefante /C3CA/(315)330-3565. 12a. DISTRIBUTION/AVAILABILUTY STATEMENT 12b. DISTRIBUTION CODE...organizations and people: "* Rome Laboratory: Don Elefante , Doug White, Frank Sliwa, Nancy Roberts, Joe Carozzoni, and Lou Hoebel. "* Andersen

  6. Construct Demo Input Deck

    Science.gov (United States)

    2010-06-01

    agents more or less likely to interact in order to capture differences in factors such as seniority, career type, introversion , or other factors which... Intelligence Modeling Conference. Oak Ridge National Laboratory, TN Krackhardt D, Carley K. 1998. A PCANS Model of Structure in Organization. In

  7. Doppler dart demo

    Science.gov (United States)

    Marry, Stephanie

    2015-01-01

    During last summer at Barrington High School, I taught a course in a summer bridge program designed to prepare students for physics. As an element of the course, students were asked to design a quantitative lab relating to something they enjoyed doing outside of school. The project required students to collect data, observe the effects of changing one variable, and present their conclusions. One group of students chose to determine the best method for completing timed paintball target practice courses. They wanted to see how firing a paint gun while moving toward and away from the target would affect the time required to complete the course. To answer these questions they decided to employ two automatic 18-dart Nerf® guns and a skateboard. Two experiments were performed, one with the student firing the dart gun while riding the skateboard toward the target and one with him firing the dart gun while riding the skateboard away from the target (Fig. 1). (Note: Teachers should inform their school administrators of their intent to use toy guns in class.)

  8. Demo III Operational Concept

    Science.gov (United States)

    2007-11-02

    Mounted /Unmounted, Manned/Unmanned) Performance Goals 3 ISO 9001 Certified Game Plan Technology Development Modeling & Simulation Test Bed Integration 99 00... Powertrain • 78 Hp VW Turbo Diesel Engine • 70 GPM Sunstrand Hydrostatic Pump • Pump Drive Sized for 4300 RPM and 2500 RPM Engine Speeds • 15 Cu In...Planning & Simulation OCU/XUV Cooperative Mobility Controller (Wingman) AMS RSTA Platoon-level Mission Execution Section-level Mission Execution Vehicle

  9. The DEMO Quasisymmetric Stellarator

    OpenAIRE

    McFadden, Geoffrey B.; Garabedian, Paul R.

    2010-01-01

    The NSTAB nonlinear stability code solves differential equations in conservation form, and the TRAN Monte Carlo test particle code tracks guiding center orbits in a fixed background, to provide simulations of equilibrium, stability, and transport in tokamaks and stellarators. These codes are well correlated with experimental observations and have been validated by convergence studies. Bifurcated 3D solutions of the 2D tokamak problem have been calculated that model persistent disruptions, neo...

  10. Memory effect in ac plasma displays

    Science.gov (United States)

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  11. Electric field in an AC dielectric barrier discharge overlapped with a nanosecond pulse discharge

    Science.gov (United States)

    Goldberg, Benjamin M.; Shkurenkov, Ivan; Adamovich, Igor V.; Lempert, Walter R.

    2016-08-01

    The effect of ns discharge pulses on the AC barrier discharge in hydrogen in plane-to-plane geometry is studied using time-resolved measurements of the electric field in the plasma. The AC discharge was operated at a pressure of 300 Torr at frequencies of 500 and 1750 Hz, with ns pulses generated when the AC voltage was near zero. The electric field vector is measured by ps four-wave mixing technique, which generates coherent IR signal proportional to the square of electric field. Absolute calibration was done using an electrostatic (sub-breakdown) field applied to the discharge electrodes, when no plasma was generated. The results are compared with one-dimensional kinetic modeling of the AC discharge and the nanosecond pulse discharge, predicting behavior of both individual micro-discharges and their cumulative effect on the electric field distribution in the electrode gap, using stochastic averaging based on the experimental micro-discharge temporal probability distribution during the AC period. Time evolution of the electric field in the AC discharge without ns pulses, controlled by a superposition of random micro-discharges, exhibits a nearly ‘flat top’ distribution with the maximum near breakdown threshold, reproduced quite well by kinetic modeling. Adding ns pulse discharges on top of the AC voltage waveform changes the AC discharge behavior in a dramatic way, inducing transition from random micro-discharges to a more regular, near-1D discharge. In this case, reproducible volumetric AC breakdown is produced at a well-defined moment after each ns pulse discharge. During the reproducible AC breakdown, the electric field in the plasma exhibits a sudden drop, which coincides in time with a well-defined current pulse. This trend is also predicted by the kinetic model. Analysis of kinetic modeling predictions shows that this effect is caused by large-volume ionization and neutralization of surface charges on the dielectrics by ns discharge pulses. The present

  12. An Assessment of the Penetrations in the First Wall Required for Plasma Measurments for Control of an Advanced Tokamak Plasma Demo

    Energy Technology Data Exchange (ETDEWEB)

    Kenneth M. Young

    2010-02-22

    A Demonstration tokamak (Demo) is an essential next step toward a magnetic-fusion based reactor. One based on advanced-tokamak (AT) plasmas is especially appealing because of its relative compactness. However, it will require many plasma measurements to provide the necessary signals to feed to ancillary systems to protect the device and control the plasma. This note addresses the question of how much intrusion into the blanket system will be required to allow the measurements needed to provide the information required for plasma control. All diagnostics will require, at least, the same shielding designs as planned for ITER, while having the capability to maintain their calibration through very long pulses. Much work is required to define better the measurement needs and the quantity and quality of the measurements that will have to be made, and how they can be integrated into the other tokamak structures.

  13. The DEMO trial: a randomized, parallel-group, observer-blinded clinical trial of strength versus aerobic versus relaxation training for patients with mild to moderate depression

    DEFF Research Database (Denmark)

    Krogh, Jesper; Saltin, Bengt; Gluud, Christian

    2009-01-01

    OBJECTIVE: To assess the benefit and harm of exercise training in adults with clinical depression. METHOD: The DEMO trial is a randomized pragmatic trial for patients with unipolar depression conducted from January 2005 through July 2007. Patients were referred from general practitioners......: Our findings do not support a biologically mediated effect of exercise on symptom severity in depressed patients, but they do support a beneficial effect of strength training on work capacity. TRIAL REGISTRATION: (ClinicalTrials.gov) Identifier: NCT00103415....... or psychiatrists and were eligible if they fulfilled the International Classification of Diseases, Tenth Revision, criteria for unipolar depression and were aged between 18 and 55 years. Patients (N = 165) were allocated to supervised strength, aerobic, or relaxation training during a 4-month period. The primary...

  14. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  15. R&D around a photoneutralizer-based NBI system (Siphore) in view of a DEMO Tokamak steady state fusion reactor

    Science.gov (United States)

    Simonin, A.; Achard, Jocelyn; Achkasov, K.; Bechu, S.; Baudouin, C.; Baulaigue, O.; Blondel, C.; Boeuf, J. P.; Bresteau, D.; Cartry, G.; Chaibi, W.; Drag, C.; de Esch, H. P. L.; Fiorucci, D.; Fubiani, G.; Furno, I.; Futtersack, R.; Garibaldi, P.; Gicquel, A.; Grand, C.; Guittienne, Ph.; Hagelaar, G.; Howling, A.; Jacquier, R.; Kirkpatrick, M. J.; Lemoine, D.; Lepetit, B.; Minea, T.; Odic, E.; Revel, A.; Soliman, B. A.; Teste, P.

    2015-11-01

    Since the signature of the ITER treaty in 2006, a new research programme targeting the emergence of a new generation of neutral beam (NB) system for the future fusion reactor (DEMO Tokamak) has been underway between several laboratories in Europe. The specifications required to operate a NB system on DEMO are very demanding: the system has to provide plasma heating, current drive and plasma control at a very high level of power (up to 150 MW) and energy (1 or 2 MeV), including high performances in term of wall-plug efficiency (η  >  60%), high availability and reliability. To this aim, a novel NB concept based on the photodetachment of the energetic negative ion beam is under study. The keystone of this new concept is the achievement of a photoneutralizer where a high power photon flux (~3 MW) generated within a Fabry-Perot cavity will overlap, cross and partially photodetach the intense negative ion beam accelerated at high energy (1 or 2 MeV). The aspect ratio of the beam-line (source, accelerator, etc) is specifically designed to maximize the overlap of the photon beam with the ion beam. It is shown that such a photoneutralized based NB system would have the capability to provide several tens of MW of D0 per beam line with a wall-plug efficiency higher than 60%. A feasibility study of the concept has been launched between different laboratories to address the different physics aspects, i.e. negative ion source, plasma modelling, ion accelerator simulation, photoneutralization and high voltage holding under vacuum. The paper describes the present status of the project and the main achievements of the developments in laboratories.

  16. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  17. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  18. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Energy Technology Data Exchange (ETDEWEB)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  19. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  20. AcEST: DK954326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available mily ATPase, CDC48 subfamily OS=Met... 125 1e-27 tr|B8GJ73|B8GJ73_9EURY AAA famil...al transitional endo... 122 1e-26 tr|A7IB30|A7IB30_METB6 AAA family ATPase, CDC48 subfamily OS=Met...... 122 2e-26 tr|A2SR43|A2SR43_METLZ AAA family ATPase, CDC48 subfamily OS=Met... 122 2e-26...et... 120 5e-26 tr|Q2FSR5|Q2FSR5_METHJ AAA family ATPase, CDC48 subfamily OS=Met... 120 5e-26 >tr|O81459|O81

  1. Molecular modeling of methyl-α-Neu5Ac analogues docked against cholera toxin--a molecular dynamics study.

    Science.gov (United States)

    Blessy, J Jino; Sharmila, D Jeya Sundara

    2015-02-01

    Molecular modeling of synthetic methyl-α-Neu5Ac analogues modified in C-9 position was investigated by molecular docking and molecular dynamics (MD) simulation methods. Methyl-α-Neu5Ac analogues were docked against cholera toxin (CT) B subunit protein and MD simulations were carried out for three Methyl-α-Neu5Ac analogue-CT complexes (30, 10 and 10 ns) to estimate the binding activity of cholera toxin-Methyl-α-Neu5Ac analogues using OPLS_2005 force field. In this study, direct and water mediated hydrogen bonds play a vital role that exist between the methyl-α-9-N-benzoyl-amino-9-deoxy-Neu5Ac (BENZ)-cholera toxin active site residues. The Energy plot, RMSD and RMSF explain that the simulation was stable throughout the simulation run. Transition of phi, psi and omega angle for the complex was calculated. Molecular docking studies could be able to identify the binding mode of methyl-α-Neu5Ac analogues in the binding site of cholera toxin B subunit protein. MD simulation for Methyl-α-9-N-benzoyl-amino-9-deoxy-Neu5Ac (BENZ), Methyl-α-9-N-acetyl-9-deoxy-9-amino-Neu5Ac and Methyl-α-9-N-biphenyl-4-acetyl-deoxy-amino-Neu5Ac complex with CT B subunit protein was carried out, which explains the stable nature of interaction. These methyl-α-Neu5Ac analogues that have computationally acceptable pharmacological properties may be used as novel candidates for drug design for cholera disease.

  2. Magnetization of YBCO film with ac travelling magnetic waves of relatively short wavelengths

    Science.gov (United States)

    Wang, Wei; Coombs, Tim

    2017-02-01

    The magnetizations of the YBCO film with ac travelling magnetic waves of relatively short wavelengths were studied. The results have verified that the reported "intermediate value" of the superconducting current density [Wang et al., Appl. Phys. Lett. 104(3), 032602 (2014)] was caused by the existence of multiple transition regions in the sample: the magnetic poles induce ±JC in the pole regions, which produces two transition regions within each wavelength λ ( +JC→-JC→+JC , and vice versa, while the symbol → indicates the transition region). The current densities in the transition region are with intermediate values, which are smaller than the critical value. In case of relatively short wavelength, there are multiple transition regions, which occupy a large fraction of the YBCO sample with intermediate current values. Moreover, the wavelike current distributions might help explain the flux transportation and dc output voltage in HTS flux pump.

  3. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  4. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  5. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  6. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  7. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  8. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  9. Micro pumping methods based on AC electrokinetics and Electrorheologically actuated PDMS valves

    Science.gov (United States)

    Soni, Gaurav; Squires, Todd; Meinhart, Carl

    2006-11-01

    We have developed 2 different micropumping methods for transporting ionic fluids through microchannels. The first method is based on Induced Charge Electroosmosis (ICEO) and AC flow field-effect. We used an AC electric field to produce a symmetric ICEO flow on a planar electrode, called `gate'. In order to break the symmetry of ICEO, we applied an additional AC voltage to the gate electrode. Such modulation of the gate potential is called field effect and produces a unidirectional pumping over the gate surface. We used micro PIV to measure pumping velocities for a range of ionic concentration, AC frequency and gate voltage. We have also conducted numerical simulations to understand the deteriorating effect of lateral conduction of surface charge on the pumping velocities. The second method is based on vibration of a flexible PDMS diaphragm actuated by an electrorheological (ER) fluid. ER fluid is a colloidal suspension exhibiting a reversible liquid-to-solid transition under an electric field. This liquid-to-solid transition can yield very high shear stress and can be used to open and close a PDMS valve. Three such valves were fabricated and actuated in a peristaltic fashion in order to achieve positive displacement pumping of fluids.

  10. A Generalised Fault Protection Structure Proposed for Uni-grounded Low-Voltage AC Microgrids

    Science.gov (United States)

    Bui, Duong Minh; Chen, Shi-Lin; Lien, Keng-Yu; Jiang, Jheng-Lun

    2016-04-01

    This paper presents three main configurations of uni-grounded low-voltage AC microgrids. Transient situations of a uni-grounded low-voltage (LV) AC microgrid (MG) are simulated through various fault tests and operation transition tests between grid-connected and islanded modes. Based on transient simulation results, available fault protection methods are proposed for main and back-up protection of a uni-grounded AC microgrid. In addition, concept of a generalised fault protection structure of uni-grounded LVAC MGs is mentioned in the paper. As a result, main contributions of the paper are: (i) definition of different uni-grounded LVAC MG configurations; (ii) analysing transient responses of a uni-grounded LVAC microgrid through line-to-line faults, line-to-ground faults, three-phase faults and a microgrid operation transition test, (iii) proposing available fault protection methods for uni-grounded microgrids, such as: non-directional or directional overcurrent protection, under/over voltage protection, differential current protection, voltage-restrained overcurrent protection, and other fault protection principles not based on phase currents and voltages (e.g. total harmonic distortion detection of currents and voltages, using sequence components of current and voltage, 3I0 or 3V0 components), and (iv) developing a generalised fault protection structure with six individual protection zones to be suitable for different uni-grounded AC MG configurations.

  11. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  12. Consistent behaviour of AC susceptibility and transport properties in magnetic superconductor RuSr 2GdCu 2O 8

    Science.gov (United States)

    Očko, M.; Živkovic, I.; Prester, M.; Drobac, Dj.; Ariosa, D.; Berger, H.; Pavuna, D.

    2004-02-01

    We report on AC susceptibility, resistivity, thermopower and measurements of sintered magnetic superconductor RuSr 2GdCu 2O 8. The antiferromagnetic phase transition at 133 K is seen clearly in the AC susceptibility as well as in the derivative of resistivity and thermopower. Above the antiferromagnetic transition, we have found some new evidences of the similarity between HTC compounds and the magnetic superconductor. The onset of superconductivity is observed by both transport methods at 46 K, and an explanation why it is not seen in the AC susceptibility data is given. The end of the SC transition occurs at about 24 K in all measured properties. We discuss the steps of broad SC transition, especially the maximum in susceptibility at 34 K, and compare our results with related studies reported in the literature.

  13. Consistent behaviour of AC susceptibility and transport properties in magnetic superconductor RuSr{sub 2}GdCu{sub 2}O{sub 8}

    Energy Technology Data Exchange (ETDEWEB)

    Ocko, M. E-mail: ocko@ifs.hr; Zivkovic, I.; Prester, M.; Drobac, Dj.; Ariosa, D.; Berger, H.; Pavuna, D

    2004-02-01

    We report on AC susceptibility, resistivity, thermopower and measurements of sintered magnetic superconductor RuSr{sub 2}GdCu{sub 2}O{sub 8}. The antiferromagnetic phase transition at 133 K is seen clearly in the AC susceptibility as well as in the derivative of resistivity and thermopower. Above the antiferromagnetic transition, we have found some new evidences of the similarity between HTC compounds and the magnetic superconductor. The onset of superconductivity is observed by both transport methods at 46 K, and an explanation why it is not seen in the AC susceptibility data is given. The end of the SC transition occurs at about 24 K in all measured properties. We discuss the steps of broad SC transition, especially the maximum in susceptibility at 34 K, and compare our results with related studies reported in the literature.

  14. Levels in 221Fr fed by the α decay of 225Ac

    Science.gov (United States)

    Ardisson, G.; Gasparro, J.; Barci, V.; Sheline, R. K.

    2000-12-01

    The α decay of 225Ac to 221Fr was reinvestigated by γ-ray spectroscopic studies with HPGe detectors and 225Ac sources purified using continuous elution processes. Energies and intensities of about 120 γ-ray transitions were measured. Among these, 40 are reported for the first time. A 221Fr level scheme with 46 excited states and 124 transitions is proposed. The level structure is described in terms of a reflection asymmetric structure with parity doublet bands Kπ=1/2+/-, 3/2+/-, 5/2+/-, and 3/2+/- in order of increasing energy. Both strong and intermediate coupling models have been shown to be in good agreement with the experimental data.

  15. Current distribution effects in AC impedance spectroscopy of electroceramic point contact and thin film model electrodes

    DEFF Research Database (Denmark)

    Nielsen, Jimmi; Jacobsen, Torben

    2010-01-01

    The Finite-Element-Method (FEM) was used for the simulations of the effect of a changing current distribution during AC impedance spectrum recording on electroceramic point contact and thin film model electrodes. For pure electronic conducting point contact electrodes the transition from the prim......The Finite-Element-Method (FEM) was used for the simulations of the effect of a changing current distribution during AC impedance spectrum recording on electroceramic point contact and thin film model electrodes. For pure electronic conducting point contact electrodes the transition from...... regarding its significance is provided. The associated characteristic impedance spectrum shape change is simulated and its origin discussed. Furthermore, the characteristic shape of impedance spectra of thin electroceramic film electrodes with lateral ohmic resistance is studied as a function...

  16. Josephson effects in an alternating current biased transition edge sensor

    CERN Document Server

    Gottardi, Luciano; Akamatsu, Hiroki; van der Kuur, Jan; Bruijn, Marcel P; Hartog, Roland H den; Hijmering, Richard; Khosropanah, Pourya; Lambert, Colin; van der Linden, Anton J; Ridder, Marcel L; Suzuki, Toyo; Gao, Jan R

    2016-01-01

    We report the experimental evidence of the ac Josephson effect in a transition edge sensor (TES) operating in a frequency domain multiplexer and biased by ac voltage at MHz frequencies. The effect is observed by measuring the non-linear impedance of the sensor. The TES is treated as a weakly linked superconducting system and within the resistively shunted junction model framework. We provide a full theoretical explanation of the results by finding the analytic solution of the non-inertial Langevian equation of the system and calculating the non-linear response of the detector to a large ac bias current in the presence of noise.

  17. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift

  18. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  19. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  20. Reinvestigation of superconducting phase diagram of UGe{sub 2} by AC magnetic susceptibility experiment

    Energy Technology Data Exchange (ETDEWEB)

    Ban, S. [Deptartment of Physics, University of Nagoya, Nagoya, 464-8602 (Japan)]. E-mail: f060214d@mbox.nagoya-u.ac.jp; Deguchi, K. [Deptartment of Physics, University of Nagoya, Nagoya, 464-8602 (Japan); Aso, N. [Institute for Solid State Physics, University of Tokyo, Kashiwa 277-8581 (Japan); Homma, Y. [Oarai Branch, Inst. for Mater. Research, University of Tohoku, Ibaraki 311-1313 (Japan); Shiokawa, Y. [Oarai Branch, Inst. for Mater. Research, University of Tohoku, Ibaraki 311-1313 (Japan); Sato, N.K. [Deptartment of Physics, University of Nagoya, Nagoya, 464-8602 (Japan)

    2007-03-15

    We report a superconducting phase diagram of the ferromagnetic superconductor UGe{sub 2} investigated by AC magnetic susceptibility measurements. In contrast to previous phase diagrams, we found that the superconducting transition temperature and volume fraction show a 'M-shaped' structure as a function of pressure. From this observation, we suggest that both of two critical points will play a crucial role in the occurrence of superconductivity in UGe{sub 2}.

  1. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  2. Power Electronic Transformer based Three-Phase PWM AC Drives

    Science.gov (United States)

    Basu, Kaushik

    A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common

  3. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  4. Dynamic Stark effect and forbidden-transition spectrallineshapes

    Energy Technology Data Exchange (ETDEWEB)

    Stalnaker, Jason E.; Budker, D.; Freedman, S.J.; Guzman, J.S.; Rochester, S.M.; Yashchuk, V.V.

    2005-12-15

    We report on an experimental and theoretical study of thedynamic (ac) Stark effect on a for bidden transition. A general frameworkfor parameterizing and describing off-resonant ac-Stark shifts ispresented. A model is developed to calculate spectral line shapesresulting from resonant excitation of atoms in an intense standinglight-wave in the presence of off-resonant ac-Stark shifts. The model isused in the analysis and interpretation of a measurement of the ac-Starkshifts of the static-electric-field-induced 6s2 1S0 -->5d6s 3D1transition at 408 nm in atomic Yb. The results are in agreement withestimates of the ac-Stark shift of the transition under the assumptionthat the shift is dominated by that of the 6s2 1S0 ground state. Adetailed description of the experiment and analysis is presented. Abi-product of this work is an ind ependent determination (from thesaturation behavior of the 408-nm transition) of the Stark transitionpolarizability, which is found to be in agreement with our earliermeasurement. This work is part of the ongoing effort aimed at a precisionmeasurement of atomic parity-violation effects in Yb.

  5. MoMar-Demo at Lucky Strike. A near-real time multidisciplinary observatory of hydrothermal processes and ecosystems at the Mid-Atlantic Ridge

    Science.gov (United States)

    Cannat, M.; Sarradin, P.; Blandin, J.; Escartin, J.; Colaco, A.; MoMAR-Demo Scientific Party : Aron Michael, Aumont Virginie, Baillard Christian, Ballu Valérie, Barreyre Thibaut, Blandin Jérôme, Blin Alexandre, Boulart Cédric, Cannat Mathilde, Carval Thierry, Castillo Alain, Chavagnac Valérie, Coail Jean Yves, Colaço Ana, Corela Carlos, Courrier Christophe, Crawford Wayne, Cuvelier Daphné, Daniel Romuald, Dausse Denis, Escartin Javier, Fabrice Fontaine, Gabsi Taoufik, Gayet Nicolas, Guyader Gérard, Lallier François, Lecomte Benoit, Legrand Julien, Lino Silva, Miranda Miguel, Mitard Emmelyne, Pichavant Pascal, Pot Olivier, Reverdin Gilles, Rommevaux Céline, Sarradin Pierre Marie, Sarrazin Jozée, Tanguy Virginie, Villinger Heinrich, Zbinden Magali

    2011-12-01

    The MoMAR "Monitoring the Mid-Atlantic Ridge" project was initiated by InterRidge in 1998 to study the environmental instability resulting from active mid-ocean-ridge processes at hydrothermal vent fields south of the Azores. It then developped into a component of the ESONET (European Seafloor Observatory Network) and EMSO (European Multidisciplinary Subsea Observatory) programs, which coordinate eulerian observatory initiatives in the seas around Europe. MoMAR experiments have started in 2006 and address two main questions : What are the feedbacks between volcanism, deformation, seismicity, and hydrothermalism at a slow spreading mid-ocean ridge? and How does the hydrothermal ecosystem couple with these sub-seabed processes? The MoMAR-Demo project started in 2010 with partial support from ESONET. It has been implemented so far by 2 cruises of the RV Pourquoi Pas ? during which we successfully deployed (in 2010), and upgraded (in 2011) a near-realtime buoyed observatory system. The system comprises two Sea Monitoring Nodes (SeaMoN) at the seafloor, which are acoustically linked to a surface relay buoy (BoRel), ensuring satellite communication to a land base station in Brest (France). One SeaMoN node connects to a 3-components seismometer and an hydrophone for seismic event detection, and two pressure probes for geodetic measurements, and the other SeaMoN node connects to a video camera, a dissolved-iron analyzer, and an optode (oxygen and temperature probe) for ecological time studies. The BOREL transmission buoy is equiped with GPS (geodetic experiment and buoy location) and meteo station. Data and/or status signals from these sensors are transmitted every 6 hours, and put on line in compliance with the ESONET-EMSO data policy (temporary access through http://www.ifremer.fr/WC2en/allEulerianNetworks). The MoMAR-Demo system also allows for interactive connections and changes of data transmission rates on demand. It is nested in arrays of autonomous sensors (OBSs

  6. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  7. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  8. AC optik - visuaalisen identiteetin suunnittelu optikkoliikkeelle

    OpenAIRE

    Valén, Wilma

    2017-01-01

    Toteutin opinnäytetyöni yhdessä pienen loviisalaisen optikkoliikkeen, AC optikin kanssa. Opinnäytetyössäni suunnittelen AC optikille uuden visuaalisen ilmeen ja brändätyn pakkauksen, jossa silmälasit ja oheistavara on helppo luovuttaa asiakkaalle. Taustoitan aihettani yksityisyrittäjälle tärkeistä näkökulmista eli keskittymällä positiivisen asiakaskokemuksen tärkeyteen brändin rakentamisessa. Sen lisäksi käyn läpi visuaalisen identiteetin suunnittelun elementtejä ja pakkauksen asemaa brän...

  9. AC410 Unit 2 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

      AC410 Unit 2 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-2-homework-assignment/   3-31 Ron Barber, CPA, is auditing the financial statements of DGF, Inc., a publicly held company. During the course of the audit, Barber discovered that DGF has been making illegal bribes to foreign government officials to obtain business, and he reported the matter to senior management and the board of directors of DGF. Required: If management a...

  10. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  11. Cascaded Buck-Boost AC/AC converter%级联式Buck-Boost AC/AC变换器

    Institute of Scientific and Technical Information of China (English)

    张友军; 丁明昌; 任永保; 王阿敏; 翁振明

    2010-01-01

    详细分析了Buck型和Boost型AC/AC变换器的工作原理及其控制方法,在此基础上提出了一种新型级联式Buck-Boost AC/AC变换器及其三模式控制策略.三模式控制策略是比较输入电压与基准输出电压的大小,使得变换器只有3种工作模式:Buck模式、Boost模式和滤波模式.该电路虽然由Buck型和Boost型AC/AC变换器2级变换器级联而成,并采用2级占空比调制,但实际上最多只存在一级功率变换,具有控制简单、变换效率高、开关管电压应力低等优点.仿真结果证明了级联式Buck-Boost AC/AC变换器及其控制策略的可行性和理论分析的正确性.

  12. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  13. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  14. Phase transitions

    CERN Document Server

    Solé, Ricard V

    2011-01-01

    Phase transitions--changes between different states of organization in a complex system--have long helped to explain physics concepts, such as why water freezes into a solid or boils to become a gas. How might phase transitions shed light on important problems in biological and ecological complex systems? Exploring the origins and implications of sudden changes in nature and society, Phase Transitions examines different dynamical behaviors in a broad range of complex systems. Using a compelling set of examples, from gene networks and ant colonies to human language and the degradation o

  15. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  16. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  17. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  18. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  19. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  20. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  1. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  2. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  3. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  4. Aging, Counterfeiting Configuration Control (AC3)

    Science.gov (United States)

    2010-01-31

    relabeled fake microcircuit chips from overseas - threaten the reliability, safety, and performance of DoD systems. These systems are vulnerable... NASA , Raytheon internal, etc. Aging, Counterfeiting Configuration Control (AC3) Page 13 of 28 are important in determining the alert’s priority

  5. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  6. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  7. Conspiração e demoção: mecanismos de simplicação da estrutura silábica

    Directory of Open Access Journals (Sweden)

    Dermeval da Hora

    2008-07-01

    Full Text Available

    Defende-se que alguns fenômenos sincrônicos da Língua Portuguesa, dentre eles a redução dos ditongos átonos finais, a monotongação dos ditongos crescentes orais e o apagamento da vibrante pós-vocálica em posição de coda, parecem caminhar na direção da simplificação da estrutura silábica da língua. Estes fenômenos, aparentemente diferentes entre si, demonstram possuir, no entanto, um traço em comum: em todos eles, a simplificação é resultado de um mesmo processo – a demoção da restrição de fidelidade MAX-IO. Para entender esta hipótese, porém, faz-se necessário um repasse do que vem a ser a idéia de conspiração e um entendimento de como a sílaba está estruturada nas línguas naturais.

  8. Zebrafish embryotoxicity test for developmental (neuro)toxicity: Demo case of an integrated screening approach system using anti-epileptic drugs.

    Science.gov (United States)

    Beker van Woudenberg, Anna; Snel, Cor; Rijkmans, Eke; de Groot, Didima; Bouma, Marga; Hermsen, Sanne; Piersma, Aldert; Menke, Aswin; Wolterbeek, André

    2014-11-01

    To improve the predictability of the zebrafish embryotoxicity test (ZET) for developmental (neuro)toxicity screening, we used a multiple-endpoints strategy, including morphology, motor activity (MA), histopathology and kinetics. The model compounds used were antiepileptic drugs (AEDs): valproic acid (VPA), carbamazepine (CBZ), ethosuximide (ETH) and levetiracetam (LEV). For VPA, histopathology was the most sensitive parameter, showing effects already at 60μM. For CBZ, morphology and MA were the most sensitive parameters, showing effects at 180μM. For ETH, all endpoints showed similar sensitivity (6.6mM), whereas MA was the most sensitive parameter for LEV (40mM). Inclusion of kinetics did not alter the absolute ranking of the compounds, but the relative potency was changed considerably. Taking all together, this demo-case study showed that inclusion of multiple-endpoints in ZET may increase the sensitivity of the assay, contribute to the elucidation of the mode of toxic action and to a better definition of the applicability domain of ZET.

  9. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  10. Dynamics of supercooled liquid and plastic crystalline ethanol: Dielectric relaxation and AC nanocalorimetry distinguish structural α- and Debye relaxation processes

    Science.gov (United States)

    Chua, Y. Z.; Young-Gonzales, A. R.; Richert, R.; Ediger, M. D.; Schick, C.

    2017-07-01

    Physical vapor deposition has been used to prepare glasses of ethanol. Upon heating, the glasses transformed into the supercooled liquid phase and then crystallized into the plastic crystal phase. The dynamic glass transition of the supercooled liquid is successfully measured by AC nanocalorimetry, and preliminary results for the plastic crystal are obtained. The frequency dependences of these dynamic glass transitions observed by AC nanocalorimetry are in disagreement with conclusions from previously published dielectric spectra of ethanol. Existing dielectric loss spectra have been carefully re-evaluated considering a Debye peak, which is a typical feature in the dielectric loss spectra of monohydroxy alcohols. The re-evaluated dielectric fits reveal a prominent dielectric Debye peak, a smaller and asymmetrically broadened peak, which is identified as the signature of the structural α-relaxation and a Johari-Goldstein secondary relaxation process. This new assignment of the dielectric processes is supported by the observation that the AC nanocalorimetry dynamic glass transition temperature, Tα, coincides with the dielectric structural α-relaxation process rather than the Debye process. The combined results from dielectric spectroscopy and AC nanocalorimetry on the plastic crystal of ethanol suggest the occurrence of a Debye process also in the plastic crystal phase.

  11. Dicty_cDB: FCL-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC21 (Link to dictyBase) - - - Contig-U15479-1 FCL-AC21E ...(Link to Original site) - - - - - - FCL-AC21E 632 Show FCL-AC21 Library FCL (Link to library) Clone ID FCL-AC2... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC21Q.Seq.d/ Representative seq. ID FCL-AC2...1E (Link to Original site) Representative DNA sequence >FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC2...M/SL/SLG7-D/SLG773Q.Seq.d/ 1205 0.0 FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC21

  12. Automatic Control Systems (ACS for Generation and Sale of Electric Power Under Conditions of Industry-Sector Liberalization

    Directory of Open Access Journals (Sweden)

    Yu. Petrusha

    2013-01-01

    Full Text Available Possible risks pertaining to transition of electric-power industry to market relations have been considered in the paper. The paper presents an integrated ACS for generation and sale of electric power as an improvement of methodology for organizational and technical management. The given system is based on integration of operating Automatic Dispatch Control System (ADCS and developing Automatic Electricity Meter Reading System (AEMRS. The paper proposes to form an inter-branch sector of ACS PLC (Automatic Control System for Prolongation of Life Cycle users which is oriented on provision of development strategy.

  13. A novel wireless power and data transmission AC to DC converter for an implantable device.

    Science.gov (United States)

    Liu, Jhao-Yan; Tang, Kea-Tiong

    2013-01-01

    This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz.

  14. AC Conductivity and Dielectric Relaxation Behavior of Sb2S3 Bulk Material

    Science.gov (United States)

    Abd El-Rahman, K. F.; Darwish, A. A. A.; Qashou, Saleem I.; Hanafy, T. A.

    2016-07-01

    The Sb2S3 bulk material was used for next-generation anode for lithium-ion batteries. Alternative current (AC) conductivity, dielectric properties and electric modulus of Sb2S3 have been investigated. The measurements were carried out in the frequency range from 40 Hz to 5 MHz and temperature range from 293 K to 453 K. The direct current (DC) conductivity, σ DC, shows an activated behavior and the calculated activation energy is 0.50 eV. The AC conductivity, σ AC, was found to increase with the increase of temperature and frequency. The conduction mechanism of σ AC was controlled by the correlated barrier hopping model. The behavior of the dielectric constant, ɛ', and dielectric loss index, ɛ'', reveal that the polarization process of Sb2S3 is dipolar in nature. The behavior of both ɛ' and ɛ'' reveals that bulk Sb2S3 has no ferroelectric or piezoelectric phase transition. The dielectric modulus, M, gives a simple method for evaluating the activation energy of the dielectric relaxation. The calculated activation energy from M is 0.045 eV.

  15. AC Zeeman Effect of Atom%原子的交流塞曼效应

    Institute of Scientific and Technical Information of China (English)

    邢爱堂

    1999-01-01

    The formula of level shifts in AC Zeeman effect is derived on the base of a simple semiclassical method. The theoretical predictions of this formula are qualitatively in good agreement with the phenomena observed in AC Zeeman experiment. Furthermore,two important properties of AC Zeeman effect are predicted in theory:the level shifts in AC Zeeman effect of atom are the transient courses concurring with transition;the level shifts have saturation property.%用一种简单的半经典方法推导出了交流塞曼效应中的能级移动公式.从这一公式得到的结果与实验中观察到的现象是一致的,而且从理论上预言了交流塞曼效应的2个重要性质:原子交流塞曼效应中的能级移动是与跃迁同时发生的瞬态过程;能级移动具有饱和性.

  16. AC impedance spectroscopy on copper phthalocyanine thin films

    Science.gov (United States)

    Robinson, Kyle P.

    Impedance spectroscopy is used to study copper phthalocyanine thin films in order to disentangle the contributions of the crystal and the unavoidable grain boundaries. The spectroscopy data is fit with an equivalent circuit model to determine resistance, capacitance, and activation energy for different grain morphologies. The copper phthalocyanine thin films are deposited via thermal evaporation on platinum interdigitated electrodes on glass substrates at different temperatures from 300 to 530 K with constant thickness of 22 nm. AC measurements, implementing a precision LCR meter are taken from 20Hz - 2 MHz, and at measurement temperatures from 25 - 90 °C. Stabilizing current by subjecting samples to 5 days in the dark, the impedance spectrum can be represented by Cole-Cole plots, which show either one or two peaks. The two maxima may be attributed to the crystalline bulk and grain boundaries of the film. We observe that the grain boundary resistance component changes by three orders of magnitude when varying the grain morphology, and the capacitance changes by one order of magnitude. The resistance of the grain boundary shows a minimum near the phase transition temperature of 450 K, followed by an increase in resistance for samples deposited at higher temperatures. The capacitance on the other hand, shows a maximum near the phase transition temperature. Similarly, the activation energy for the grain boundary peaks at 1.29 +/- 0.12 eV at the same phase-transition tempemture, whereas the crystalline bulk component has a constant activation energy of 0.36 +/- 0.08 eV for all sample of different grain sizes. Additional data taken using a perpendicular configuration for a 30 nm thick cobalt phthalocyanine thin film shows a double peak. The low temperature measurements for these samples are interpreted to have two contributions from micro-shorts and crystalline bulk.

  17. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  18. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  19. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  20. Alpha decay sup 2 sup 2 sup 5 Ac-> sup 2 sup 2 sup 1 Fr

    CERN Document Server

    Kudrya, S A; Fominykh, V I; Gorozhankin, V M; Gromov, K Y; Malikov, S R; Malov, L A; Sergienko, V A; Tsupko-Sitnikov, V V; Yakushev, E A

    2002-01-01

    In-depth investigation of (alpha-gamma)-coincidences at the sup 2 sup 2 sup 5 Ac decay is carried out. Twenty-one new weak gamma-rays are found; 18 gamma-rays earlier ascribed to the sup 2 sup 2 sup 5 Ac decay are not confirmed. The quantitative analysis of the (alpha-gamma)-coincidences makes it possible to find the intensity of population of sup 2 sup 2 sup 1 Fr levels by the alpha decay and multipolarities of five weak gamma-transitions. The conversion electron spectrum is investigated in the range of 5-24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV gamma-transition is found. The proposed sup 2 sup 2 sup 5 Ac decay scheme includes 31 excited sup 2 sup 2 sup 1 Fr states. Parities are established for 16 of them. Possible spin values are proposed for sup 2 sup 2 sup 1 Fr levels. Properties of excited sup 2 sup 2 sup 1 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the assumption of static octupole deformation

  1. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  2. The superconducting proposal for the CS magnet system of FAST: a preliminary analysis of the heat load due to AC losses

    CERN Document Server

    Pompeo, N

    2011-01-01

    FAST (Fusion Advanced Studies Torus), the Italian proposal of a Satellite Facility to ITER, is a compact tokamak (R$_0$ = 1.82 m, a = 0.64 m, triangularity $\\delta$ = 0.4) able to investigate non-linear dynamics effects of $\\alpha$-particle behavior in burning plasmas and to test technical solutions for the first wall/divertor directly relevant for ITER and DEMO. Currently, ENEA is investigating the feasibility of a superconducting solution for the magnet system. This paper focuses on the analysis of the CS (Central Solenoid) magnet thermal behavior. In particular, considering a superconducting solution for the CS which uses the room available in the resistive design and referring to one of the most severe scenario envisaged for FAST, the heat load of the CS winding pack due to AC losses is preliminarily evaluated. The results provide a tentative baseline for the definition of the strand requirements and conductor design, that can be accepted in order to fulfil the design requirements.

  3. RHIC AC DIPOLE DESIGN AND CONSTRUCTION.

    Energy Technology Data Exchange (ETDEWEB)

    BAI,M.; METH,M.; PAI,C.; PARKER,B.; PEGGS,S.; ROSER,T.; SANDERS,R.; TRBOJEVIC,D.; ZALTSMAN,A.

    2001-06-18

    Two ac dipoles with vertical and horizontal magnetic field have been proposed at RHIC for applications in linear and non-linear beam dynamics and spin manipulations. A magnetic field amplitude of 380 Gm is required to produce a coherent oscillation of 5 times the rms beam size at the top energy. We take the ac dipole frequency to be 1.0% of the revolution frequency away from the betatron frequency. To achieve the strong magnetic field with minimum power loss, an air-core magnet with two seven turn winding of low loss Litz wire resonating at 64 kHz is designed. The system is also designed to allow one to connect the two magnet winding in series to resonate at 37 kHz for the spin manipulation. Measurements of a half length prototype magnet are also presented.

  4. Nanorod dynamics in ac electric fields

    Energy Technology Data Exchange (ETDEWEB)

    Ruda, H E; Shik, A [Centre for Advanced Nanotechnology, University of Toronto, Toronto, M5S 3E3 (Canada)

    2010-06-11

    Metal and semiconductor nanorods polarized by an external electric field tend to align parallel to this field. We derived the equation of motion for this alignment, taking into account electrostatic forces, thermal fluctuations and viscous resistance of the liquid the nanorods are suspended in. It was solved for a strong ac electric field, as well as for the combination of strong dc and weak ac fields. The results were used for calculations of the capacity of the nanorod solution, its frequency dispersion and dependence on the field strength. Modification of the nanorod absorption spectra under the influence of an electric field was also considered. It was shown that metal nanorods in laser radiation, with the frequency belonging to the interval between longitudinal and transverse plasmon modes, tend to align perpendicular, rather than parallel, to the optical electric field.

  5. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  6. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  7. Lazy AC-Pattern Matching for Rewriting

    OpenAIRE

    Walid Belkhir; Alain Giorgetti

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  8. Lazy AC-Pattern Matching for Rewriting

    Directory of Open Access Journals (Sweden)

    Walid Belkhir

    2012-04-01

    Full Text Available We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  9. Cryocooled Josephson standards for AC voltage metrology

    Science.gov (United States)

    Durandetto, P.; Sosso, A.; Monticone, E.; Trinchera, B.; Fretto, M.; Lacquaniti, V.

    2017-05-01

    The Josephson effect is worldwide used as a basis for constant reference voltages in national metrological institutes and in calibration laboratories of industry. Research on Josephson voltage standards is aiming at a fundamental change also in the metrology of the volt for AC and arbitrary waveforms: programmable Josephson voltage standards converting a digital code into a quantum-accurate stepwise waveform are already available in primary laboratories and even more advanced standards for converting sub-nanosecond binary coded pulses into any arbitrary signal with quantum accuracy are now actively developed and tested. A new experimental setup based on a two-stage Gifford-McMahon cryocooler has been developed at INRiM for the operation of AC-Josephson voltage standards. Among its distinct features, the possibility of employing both the aforementioned techniques (programmable and pulsed Josephson voltage standards) is particularly interesting. Quantum-based AC voltage sine waves have been synthesized with both programmable and pulse-driven arrays, although their accuracy is still limited by thermal oscillations due to the cryocooler piston motion.

  10. The Hubble Legacy Archive ACS Grism Data

    CERN Document Server

    Kuemmel, M; Fosbury, R; Haase, J; Hook, R N; Kuntschner, H; Lombardi, M; Micol, A; Nilsson, K K; Stoehr, F; Walsh, J R

    2011-01-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 \\mu$m, with a dispersion of $40 \\ \\AA / pixel$ and a resolution of $\\sim 80\\ \\AA$ for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47,919 datasets (65% of the total number of extracted spect...

  11. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  12. Tessellations & Transitions.

    Science.gov (United States)

    Cassidy, Joan

    1998-01-01

    Describes two sixth-grade lessons on the work of M. C. Escher: (1) the first lesson instructs students on tessellations, or tiles that interlock in a repeated pattern; (2) the second lesson explores Escher's drawings of transitions from two- to three-dimensional space. (DSK)

  13. Presidential Transitions

    Science.gov (United States)

    2006-06-09

    Morton Mintz and Stuart Auerbach, “Ford Solicits Suggestions on No. 2 Man,” Washington Post, Aug. 11, 1974, p. A1. 64 Fred Austin, “Ford Begins Move...representatives of the federal departments and agencies to ensure a smooth transition. Management and organizational issues should be CRS-23 105 Carl Brauer

  14. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  15. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  16. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  17. Sustainable Transition

    DEFF Research Database (Denmark)

    2014-01-01

    What. The chapter addresses designing for sustainability as interventions in socio-technical systems and social practices of users and communities. It calls for reflexive design practices challenging dominant regimes and shaping alternative design spaces. The specific case is the reconfiguration...... of agendas/vision, technologies, actors and institutions in the emergent design of an urban mobility system based on an electric car sharing system. Why. Designing for sustainability is a fundamental challenge for future design practices; designers have to obtain an ability to contribute to sustainable...... transition processes. Where. Addresses design processes aimed at sustainable transition enacted in complex social settings, socio-technical systems involving many different actors and agendas. How. The chapter outlines a conceptual and analytic framework for a reflexive design practice for sustainability...

  18. Transition Operators

    CERN Document Server

    Alcock-Zeilinger, Judith

    2016-01-01

    In this paper, we give a generic algorithm of the transition operators between Hermitian Young projection operators corresponding to equivalent irreducible representations of SU(N), using the compact expressions of Hermitian Young projection operators derived in a companion paper. We show that the Hermitian Young projection operators together with their transition operators constitute a fully orthogonal basis for the algebra of invariants of $V^{\\otimes m}$ that exhibits a systematically simplified multiplication table. We discuss the full algebra of invariants over $V^{\\otimes 3}$ and $V^{\\otimes 4}$ as explicit examples. In our presentation we make use of various standard concepts such as Young projection operators, Clebsch-Gordan operators, and invariants (in birdtrack notation). We tie these perspectives together and use them to shed light on each other.

  19. AC Electric Field Activated Shape Memory Polymer Composite

    Science.gov (United States)

    Kang, Jin Ho; Siochi, Emilie J.; Penner, Ronald K.; Turner, Travis L.

    2011-01-01

    Shape memory materials have drawn interest for applications like intelligent medical devices, deployable space structures and morphing structures. Compared to other shape memory materials like shape memory alloys (SMAs) or shape memory ceramics (SMCs), shape memory polymers (SMPs) have high elastic deformation that is amenable to tailored of mechanical properties, have lower density, and are easily processed. However, SMPs have low recovery stress and long response times. A new shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive fillers to enhance its thermo-mechanical characteristics. A new composition of shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive functionalized graphene sheets (FGS) to enhance its thermo-mechanical characteristics. The elastic modulus of LaRC-SMPC is approximately 2.7 GPa at room temperature and 4.3 MPa above its glass transition temperature. Conductive FGSs-doped LaRC-SMPC exhibited higher conductivity compared to pristine LaRC SMP. Applying an electric field at between 0.1 Hz and 1 kHz induced faster heating to activate the LaRC-SMPC s shape memory effect relative to applying DC electric field or AC electric field at frequencies exceeding1 kHz.

  20. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  1. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  2. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  3. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  4. Frequency-driven quantum oscillations in a graphene layer under circularly polarized ac fields

    Energy Technology Data Exchange (ETDEWEB)

    Vega Monroy, R., E-mail: ricardovega@mail.uniatlantico.edu.co; Martinez Castro, O.; Salazar Cohen, G.

    2015-06-19

    In this paper we predict a new type of quantum oscillations driven by the frequency of a circularly polarized ac field in a monolayer of graphene placed inside an optical cavity. We show that the displacement of the structure of photon-dressed electron states near the Fermi level and the electron transitions, from extended states to bound photon-dressed electron states inside an energy gap, lead to a periodic change of singularities in the electron density of states, resulting in quantum oscillations in thermodynamic, transport and other properties in graphene.

  5. “Two conditions for a successful partnership: high-levels of NGO professionalism and the readiness of local and regional administrations to find new forms of partnership” - Interview with Asmik Novikova, Demos Centre, Moscow, 6 March and 12 October 2008

    Directory of Open Access Journals (Sweden)

    Gilles Favarel-Garrigues

    2009-03-01

    Full Text Available Introducing DemosPIPSS.ORG - Could you introduce yourself and describe your career (including what circumstances brought you to work for Demos? Asmik Novikova: After I graduated from Moscow State University in the summer of 2001, I wondered where I could find a good place for my research plans. I wished to develop and conduct sociological surveys, but not in an overly academic way. I felt that sociology was a very effective tool to study the current situation in Russian society and maybe fin...

  6. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    Directory of Open Access Journals (Sweden)

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  7. Specific heat and frequency-dependent ac-susceptibility of PrNi2 below 1 K

    Science.gov (United States)

    Greidanus, F. J. A. M.; De Jongh, L. J.; Huiskamp, W. J.; Buschow, K. H. J.

    1982-01-01

    Ac-susceptibility measurements on PrNi2 show broad anomalies, the temperature of the susceptibility maximum shifting from 0.3-0.5 K as the frequency is varied in between 3 Hz and 3 kHz. On the other hand the specific heat is featureless in the same temperature range. The behaviour is interpreted in terms of a mixed electronic-nuclear phase transition. Strong relaxation effects are observed in the susceptibility at temperatures close to the maxima.

  8. Cascading failures in ac electricity grids

    Science.gov (United States)

    Rohden, Martin; Jung, Daniel; Tamrakar, Samyak; Kettemann, Stefan

    2016-09-01

    Sudden failure of a single transmission element in a power grid can induce a domino effect of cascading failures, which can lead to the isolation of a large number of consumers or even to the failure of the entire grid. Here we present results of the simulation of cascading failures in power grids, using an alternating current (AC) model. We first apply this model to a regular square grid topology. For a random placement of consumers and generators on the grid, the probability to find more than a certain number of unsupplied consumers decays as a power law and obeys a scaling law with respect to system size. Varying the transmitted power threshold above which a transmission line fails does not seem to change the power-law exponent q ≈1.6 . Furthermore, we study the influence of the placement of generators and consumers on the number of affected consumers and demonstrate that large clusters of generators and consumers are especially vulnerable to cascading failures. As a real-world topology, we consider the German high-voltage transmission grid. Applying the dynamic AC model and considering a random placement of consumers, we find that the probability to disconnect more than a certain number of consumers depends strongly on the threshold. For large thresholds the decay is clearly exponential, while for small ones the decay is slow, indicating a power-law decay.

  9. Electrothermally driven flows in ac electrowetting.

    Science.gov (United States)

    García-Sánchez, Pablo; Ramos, Antonio; Mugele, Frieder

    2010-01-01

    Mixing within sessile drops can be enhanced by generating internal flow patterns using ac electrowetting. While for low ac frequencies, the flow patterns have been attributed to oscillations of the drop surface, we provide here the driving mechanism of the hitherto unexplained high-frequency flows. We show that: (1) the electric field in the liquid bulk becomes important, leading to energy dissipation due to Joule heating and a temperature increase of several degrees Celsius, and (2) the fluid flow at these frequencies is generated by electrothermal effect, i.e., gradients in temperature give rise to gradients in conductivity and permittivity, the electric field acting on these inhomogeneities induces an electrical body force that generates the flow. We solved numerically the equations for the electric, temperature and flow fields. The temperature is obtained from a convection-diffusion equation where Joule heating is introduced as a source term. From the solution of the electric field and the temperature, we compute the electrical force that acts as a body force in Stokes equations. Our numerical results agree with previous experimental observations.

  10. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  11. Conformational Transitions

    Science.gov (United States)

    Czerminski, Ryszard; Roitberg, Adrian; Choi, Chyung; Ulitsky, Alexander; Elber, Ron

    1991-10-01

    Two computational approaches to study plausible conformations of biological molecules and the transitions between them are presented and discussed. The first approach is a new search algorithm which enhances the sampling of alternative conformers using a mean field approximation. It is argued and demonstrated that the mean field approximation has a small effect on the location of the minima. The method is a combination of the LES protocol (Locally Enhanced Sampling) and simulated annealing. The LES method was used in the past to study the diffusion pathways of ligands from buried active sites in myoglobin and leghemoglobin to the exterior of the protein. The present formulation of LES and its implementation in a Molecular Dynamics program is described. An application for side chain placement in a tetrapeptide is presented. The computational effort associated with conformational searches using LES grows only linearly with the number of degrees of freedom, whereas in the exact case the computational effort grows exponentially. Such saving is of course associated with a mean field approximation. The second branch of studies pertains to the calculation of reaction paths in large and flexible biological systems. An extensive mapping of minima and barriers for two different tetrapeptides is calculated from the known minima and barriers of alanine tetrapeptide which we calculated recently.1 The tetrapeptides are useful models for the formation of secondary structure elements since they are the shortest possible polymers of this type which can still form a complete helical turn. The tetrapeptides are isobutyryl-val(χ1=60)-ala-ala and isobutyryl-val(χ1=-60)-ala-ala. Properties of the hundreds of minima and of the hundreds intervening barriers are discussed. Estimates for thermal transition times between the many conformers (and times to explore the complete phase space) are calculated and compared. It is suggested that the most significant effect of the side chain size is

  12. Rapid transitions

    Energy Technology Data Exchange (ETDEWEB)

    Hamrin, J.G.

    1980-01-01

    Solar energy programs are entering a critical transitional period as we move from the initial marketing of solar technologies into a phase of widespread commercialization. We face the dual challenge of trying to get enough solar systems in place fast enough to prove solar is a viable alternative, while trying to ensure the systems are designed and installed properly, proving the energy savings as promised. This is a period of both great opportunity and high risk as the field becomes crowded with new solar cheerleaders and supporters but seldom enough competent players. The status of existing and proposed programs for the accelerated commercialization of solar energy in California is described.

  13. Transit space

    DEFF Research Database (Denmark)

    Raahauge, Kirsten Marie

    2008-01-01

    This article deals with representations of one specific city, Århus, Denmark, especially its central district. The analysis is based on anthropological fieldwork conducted in Skåde Bakker and Fedet, two well-off neighborhoods. The overall purpose of the project is to study perceptions of space...... and the interaction of cultural, social, and spatial organizations, as seen from the point of view of people living in Skåde Bakker and Fedet. The focus is on the city dwellers’ representations of the central district of Århus with specific reference to the concept of transit space. When applied to various Århusian...

  14. Magnetic irreversibility in granular superconductors: ac susceptibility study

    Energy Technology Data Exchange (ETDEWEB)

    Perez, F.; Obradors, X.; Fontcuberta, J. (ICMAB, CSIC, Bellaterra, Barcelona (Spain)); Vallet, M.; Gonzalez-Calbet, J. (Lab. Magnetismo Aplicado, RENFE-U.C. Madrid, Las Matas (Spain))

    1991-12-01

    Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.).

  15. Transport AC Losses in Striated YBCO Coated Conductors (Postprint)

    Science.gov (United States)

    2012-02-01

    AFRL-RZ-WP-TP-2012-0124 TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) G.A. Levin and P.N. Barnes Mechanical Energy...TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) 5a. CONTRACT NUMBER In-house 5b. GRANT NUMBER 5c. PROGRAM ELEMENT...2006. 14. ABSTRACT DC current-voltage characteristics and transport ac losses of striated and non-striated Y1Ba2Cu3O7-δ ( YBCO ) coated conductors

  16. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  17. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...

  18. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  19. Evaluation of a.c. conductivity behaviour of graphite filled polysulphide modified epoxy composites

    Indian Academy of Sciences (India)

    Navin Chand; Deepak Jain

    2004-06-01

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled and unfilled epoxy composites. It was observed that the dielectric constant, tan and a.c. conductivity increase with increasing temperature. Near the transition temperature the materials show anomalous behaviour for the observed properties. Peaks of dielectric constant, tan and a.c. conductivity were observed to shift towards lower temperature with increasing frequency. Clear relaxation (tan ) peaks around 169°C were observed in epoxy resin, which shifted to lower temperature side on increasing the frequency. Addition of 2.91 wt% graphite shifted the tan peaks towards higher temperature side by creating hindrances to the rotation of polymer dipoles. Addition of 2.91 wt% graphite leads to an increased relaxation time of dipoles in polysulphide epoxy from 1.44 × 10-5-3.92 × 10-5 (s) at 90°C by creating the hindrance to the rotation of dipoles.

  20. Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing

    CERN Document Server

    Gottardi, Luciano; de Korte, Piet A J; Hartog, Roland Den; Dirks, Bob; Popescu, Manuela; Hoevers, Henk F C; Bruijn, Marcel; Borderias, Maria Parra; Takei, Y

    2016-01-01

    We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDMconfiguration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/RN < 0.5). The measured energy resolution at 5.89keV is 2.7eV for DC bias and 3.7eV for AC bias, while the baseline resolution is 2.8eV and 3.3eV, respectively.

  1. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Science.gov (United States)

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  2. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  3. The impact of personal background and school contextual factors on academic competence and mental health functioning across the primary-secondary school transition.

    Directory of Open Access Journals (Sweden)

    Sharmila Vaz

    Full Text Available Students negotiate the transition to secondary school in different ways. While some thrive on the opportunity, others are challenged. A prospective longitudinal design was used to determine the contribution of personal background and school contextual factors on academic competence (AC and mental health functioning (MHF of 266 students, 6-months before and after the transition to secondary school. Data from 197 typically developing students and 69 students with a disability were analysed using hierarchical linear regression modelling. Both in primary and secondary school, students with a disability and from socially disadvantaged backgrounds gained poorer scores for AC and MHF than their typically developing and more affluent counterparts. Students who attended independent and mid-range sized primary schools had the highest concurrent AC. Those from independent primary schools had the lowest MHF. The primary school organisational model significantly influenced post-transition AC scores; with students from Kindergarten--Year 7 schools reporting the lowest scores, while those from the Kindergarten--Year 12 structure without middle school having the highest scores. Attending a school which used the Kindergarten--Year 12 with middle school structure was associated with a reduction in AC scores across the transition. Personal background factors accounted for the majority of the variability in post-transition AC and MHF. The contribution of school contextual factors was relatively minor. There is a potential opportunity for schools to provide support to disadvantaged students before the transition to secondary school, as they continue to be at a disadvantage after the transition.

  4. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  5. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  6. Fuzzy efficiency optimization of AC induction motors

    Science.gov (United States)

    Jani, Yashvant; Sousa, Gilberto; Turner, Wayne; Spiegel, Ron; Chappell, Jeff

    1993-01-01

    This paper describes the early states of work to implement a fuzzy logic controller to optimize the efficiency of AC induction motor/adjustable speed drive (ASD) systems running at less than optimal speed and torque conditions. In this paper, the process by which the membership functions of the controller were tuned is discussed and a controller which operates on frequency as well as voltage is proposed. The membership functions for this dual-variable controller are sketched. Additional topics include an approach for fuzzy logic to motor current control which can be used with vector-controlled drives. Incorporation of a fuzzy controller as an application-specific integrated circuit (ASIC) microchip is planned.

  7. ac impedance of the carbon monofluoride electrode

    Science.gov (United States)

    Suchanski, M. R.

    1985-09-01

    The ac impedance of carbon monofluoride (CF) half-cells and Li/CF batteries that contain 1M LiBF4/4-butyrolactone electrolyte was measured as a function of state of charge. The nonfaradaic components of the CF half-cell impedance were resolved with the aid of a one-dimensional macroscopic treatment of a porous electrode. The values of the nonfaradaic components and their variation with charge withdrawn provide information concerning the nature of cathode discharge products, the degree of tortuosity in the cathode and separator matrices, and the cathode failure mechanism. The CF electrode capacitance, as measured by the low frequency quadrature impedance, can serve as a semiquantitative measure of battery state of charge under certain conditions.

  8. The AC and DC Conductivity of Nanocomposites

    Directory of Open Access Journals (Sweden)

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  9. Transcranial alternating current stimulation (tACS

    Directory of Open Access Journals (Sweden)

    Andrea eAntal

    2013-06-01

    Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.

  10. Correlation between AC and DC transport properties of Mn substituted cobalt ferrite

    Science.gov (United States)

    Supriya, Sweety; Kumar, Sunil; Kar, Manoranjan

    2016-12-01

    The CoFe2-xMnxO4 compound is prepared by following the sol gel technique. The structural analysis through XRD and Rietveld has been confirmed for the single cubic phase having F d 3 ¯ m space group for CoFe2-xMnxO4 and also verified it through Raman spectroscopy measurements. The tetrahedral site observed to be red shifted with increase in Mn concentration in cobalt ferrite. All the XRD patterns have been analyzed by employing the Rietveld refinement technique. The particle size was found to be in the range of 30-40 nm. The electrical properties of polycrystalline CoFe2-xMnxO4 for x = 0.00, 0.10, 0.15, and 0.2, spinel ferrite was investigated by impedance spectroscopy. The influence of doping, frequency and temperature on the electrical transport properties of the CoFe2-xMnxO4 for x = 0.00, 0.10, 0.15, and 0.20 were investigated. The magnitude of Z' and Z″ decreases with increase in temperature. Only one semicircle is observed in each Cole Cole plot which reveals that ac conductivity is dominated by grains. The grain resistance and grain boundary resistance both were found to decrease as a function of temperature. Temperature variation of DC electrical conductivity follows the Arrhenius relationship. A detailed analysis of electrical parameters provides assistance in connecting information regarding the conduction mechanism as well as determination of both dielectric and magnetic transition temperatures in the substituted cobalt ferrite. Detailed analysis of ac impedance and DC resistivity measurement reveals that, the magnetic ordering temperature in the Mn substituted cobalt ferrite does not respond to the frequency of ac electrical signal; however, it responds to the DC resistivity. The correlation between ac impedance and DC resistivity has been established.

  11. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  12. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can accurately produce...... the correct volt-sec average at its output, while simultaneously achieving inductive voltage boosting. More interestingly, these performance features are achieved with no increase in the number of semiconductor commutations, and hence no increase in switching losses. The proposed converter therefore offers...

  13. Equivalent circuit models for ac impedance data analysis

    Science.gov (United States)

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  14. A remark on Kov\\'acs' vanishing theorem

    CERN Document Server

    Fujino, Osamu

    2012-01-01

    We give an alternative proof of Kov\\'acs' vanishing theorem. Our proof is based on the standard arguments of the minimal model theory. We do not need the notion of Du Bois pairs. We reduce Kov\\'acs' vanishing theorem to the well-known relative Kawamata--Viehweg--Nadel vanishing theorem.

  15. 40 CFR Appendixes A-C to Part 403 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true A Appendixes A-C to Part 403 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS GENERAL PRE-TREAT-MENT REGULATIONS FOR EXIST-ING AND NEW SOURCES OF POLLUTION Appendixes A-C to Part 403 ...

  16. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  17. Considerations for an Ac Dipole for the LHC

    CERN Document Server

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  18. Precursors of Short GRBs Registered by SPI-ACS/INTEGRAL

    Science.gov (United States)

    Minaev, P.; Pozanenko, A.

    2016-10-01

    We have searched for precursors in light curves of short gamma-ray bursts registered by SPI-ACS/INTEGRAL in 2002-2014. The portion of short bursts with precursor activity will be less than 0.4% from all short bursts registered by SPI-ACS.

  19. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  20. The topological AC effect on noncommutative phase space

    CERN Document Server

    Li, K; Li, Kang; Wang, Jianhua

    2006-01-01

    The Aharonov-Casher (AC) effect in non-commutative(NC) quantum mechanics is studied. Instead of using the star product method, we use a generalization of Bopp's shift method. After solving the Dirac equations both on noncommutative space and noncommutative phase space by the new method, we obtain the corrections to AC phase on NC space and NC phase space respectively.

  1. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  2. Resistivity and AC calorimetry measurements on CeNiGe{sub 2} under pressure

    Energy Technology Data Exchange (ETDEWEB)

    Holmes, A.T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan)]. E-mail: alex@djebel.mp.es.osaka-u.ac.jp; Muramatsu, T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Miyake, A. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Kaczorowski, D. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wroclaw (Poland); Bukowski, Z. [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wroclaw (Poland); Kagayama, T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Shimizu, K. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan)

    2007-03-15

    We present resistivity and AC calorimetry measurements of single crystalline CeNiGe{sub 2} under high pressure and low temperature in a diamond anvil cell. CeNiGe{sub 2} is a highly anisotropic, antiferromagnetic Kondo system at ambient pressure, located close to the boundary with non-magnetic systems. It has two ordering temperatures, T{sub N1}=3.9K and T{sub N2}=3.2K, which are suppressed under pressure. Between 0.7 and 1.4GPa only a single transition was identified, with T{sub N} reaching 1.9K by 1.4 GPa. At 1.9GPa two transitions could again be seen by AC calorimetry at 2.0 and 1.3K, accompanied by a qualitative change in the behaviour of the resistivity. The Sommerfeld coefficient showed a maximum of 755mJmol{sup -1}K{sup -2} at 1.4GPa, up from 448mJmol{sup -1}K{sup -2} at close to ambient pressure. The residual resistivity was found to decrease sharply above 1.4GPa after an initial increase with pressure.

  3. New switching pattern for AC/AC converters with RB-IGBTs for offshore wind parks

    OpenAIRE

    Mogstad, Anne Berit

    2008-01-01

    Offshore wind power has an increasing interest in the research community and among the politicians. Therefore it is important to find the right solutions to meet the environmental and commercial requirements to give offshore wind power a promising future. This thesis are proposing a new converter topology for offshore wind parks. Since the topology is based on DC transmission in stead of AC transmission it is better suited for use in this type of parks. All the converters are located in the w...

  4. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  5. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  6. Spin reorientation transition process in single crystal NdFeO3

    Science.gov (United States)

    Song, Gaibei; Jiang, Junjie; Kang, Baojuan; Zhang, Jincang; Cheng, Zhenxiang; Ma, Guohong; Cao, Shixun

    2015-06-01

    The spin reorientation transition in single crystal NdFeO3 is studied using AC magnetic susceptibility, hysteresis loops, and polarized terahertz (THz) time domain spectroscopy measurements. Different frequency dependence behaviors of AC susceptibility reflect that the dynamic response of magnetization inside the spin reorientation region differs from the phase outside the transition region. The magnetization hysteresis loops at different temperatures reveal that domains formed during the spin reorientation process, which coincides with the abrupt increase of AC magnetic susceptibility during the transition. In addition, temperature dependent THz wave excitation of quasi-antiferromagnetic mode indicates the process of spin reorientation as a continuous rotation of Fe3+ spins rather than a mixed phase of Γ4 and Γ2.

  7. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  8. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  9. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  10. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  11. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    Institute of Scientific and Technical Information of China (English)

    房绪鹏

    2006-01-01

    提出了一种新型AC/AC变流器电路--单相电压型Z源AC/AC变流器;介绍了其电路拓扑、工作原理、控制方法等;给出了相应的仿真和实验结果.仿真和实验证实了该电路拓扑的合理性和优越性.

  12. Effect of electric fields on the stabilization of premixed laminar bunsen flames at low AC frequency: Bi-ionic wind effect

    KAUST Repository

    Kim, Minkuk

    2012-03-01

    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally by applying AC electric fields at low frequency below 60. Hz together with DC in the single electrode configuration. The blowoff velocity has been measured for varying AC voltage and frequency. A transition frequency between low and high frequency regimes has been identified near 40-50. Hz, where AC electric fields have minimal effect on flame stabilization. In the low frequency regime, the blowoff velocity decreased linearly with AC voltage such that the flames became less stable. This was consistent with the DC result, implying the influence of the ionic wind effect. The variation of blowoff velocity with AC frequency showed a non-monotonic behavior in that the velocity decreased and then increased, exhibiting minimum blowoff velocity near 6-8. Hz. Based on the molecular kinetic theory, the developing degree of ionic wind was derived. By considering the ionic wind effects arising from both positive and negative ions in a flame zone, the bi-ionic wind effect successfully explained the non-monotonic behavior of blowoff velocity with AC frequency in the low frequency regime. © 2011 The Combustion Institute.

  13. Mechanism of Transition-Metal Nanoparticle Catalytic Graphene Cutting.

    Science.gov (United States)

    Ma, Liang; Wang, Jinlan; Yip, Joanne; Ding, Feng

    2014-04-03

    Catalytic cutting by transition-metal (TM) particles is a promising method for the synthesizing of high-quality graphene quantum dots and nanoribbons with smooth edges. Experimentally, it is observed that the cutting always results in channels with zigzag (ZZ) or armchair (AC) edges. However, the driving force that is responsible for such a cutting behavior remains a puzzle. Here, by calculating the interfacial formation energies of the TM-graphene edges with ab initio method, we show that the surface of a catalyst particle tends to be aligned along either AC or ZZ direction of the graphene lattice, and thus the cutting of graphene is guided as such. The different cutting behaviors of various catalysts are well-explained based on the competition between TM-passivated graphene edges and the etching-agent-terminated ones. Furthermore, the kinetics of graphene catalytic cutting along ZZ and AC directions, respectively, are explored at the atomic level.

  14. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    Science.gov (United States)

    2010-07-01

    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning tests...

  15. An Ac transposon system based on maize chromosome 4S for isolating long-distance-transposed Ac tags in the maize genome.

    Science.gov (United States)

    Wang, Fei; Li, Zhaoying; Fan, Jun; Li, Pengfei; Hu, Wei; Wang, Gang; Xu, Zhengkai; Song, Rentao

    2010-12-01

    Transposon tagging is an important tool for gene isolation and functional studies. In maize, several transposon-tagging systems have been developed, mostly using Activator/Dissociation (Ac/Ds) and Mutator systems. Here, we establish another Ac-based transposon system with the donor Ac tightly linked with sugary1 (su1) on maize chromosome 4S. Newly transposed Ac (tr-Acs) were detected based on a negative dosage effect, and long-distance-transposed Ac events were identified and isolated from the donor Ac by a simple backcross scheme. In this study, we identified 208 independent long-distance-transposed Ac lines. Thirty-one flanking sequences of these tr-Acs were isolated and localized in the maize genome. As found in previous studies, the tr-Acs preferentially inserted into genic sequences. The distribution of tr-Acs is not random. In our study, the tr-Acs preferentially transposed into chromosomes 1, 2, 9 and 10. We discuss the preferential distribution of tr-Acs from Ac systems. Our system is complementary to two other Ac-based regional-mutagenesis systems in maize, and the combined use of these systems will achieve an even and high-density distribution of Ac elements throughout the maize genome for functional-genomics studies.

  16. WLCG Operations portal demo tutorial

    CERN Document Server

    CERN. Geneva

    2016-01-01

    This is a navigation through http://wlcg-ops.web.cern.ch/ the Worldwide LHC Computing Grid (WLCG) Operations' portal. In this portal you will find documentation and information about WLCG Operation activities for: System Administrators at the WLCG sites LHC Experiments Operation coordination people, including Task Forces and Working Groups

  17. From Deng to the Demos?

    DEFF Research Database (Denmark)

    Mulvad, Andreas Møller

    2017-01-01

    -dissident strategy of change within rather than against the party-state, but their visions differ greatly. Trade unionist and 1989 protest leader Han Dongfang favors a social democratic vision based on strengthening the collective bargaining power of the Chinese working class within the market economy. In contrast......, the self-declared ‘petty bourgeois’ vision of agricultural economist Wen Tiejun advocates resisting marketization, reinvigorating traditional lifestyles, and enhancing the power of the peasantry through self-organization. I argue that both visions are in partial tension with the status quo: While Han...... of a populist counter-hegemony depends on the extent to which the gap between laborism and peasantism is overcome both organizationally and intellectually....

  18. Demo biomassagewassen binnen project Energieboerderij

    NARCIS (Netherlands)

    Mheen, van der H.J.C.J.

    2011-01-01

    Door de Stuurgroep Energieboerderij werd op 16 maart 2011 de in een velddemo te beproeven gewassen vastgesteld. Gekozen werd voor de navolgende acht gewassen: Landschapsmais, Mariadistel, Tagetes minuta, Tagetes patula, Milkweed, Switchgrass, Reed Canary Grass (RCG) en Witte Krodde. Met uitzondering

  19. Demo biomassagewassen binnen project Energieboerderij

    OpenAIRE

    Mheen, van der, H.J.C.J.

    2011-01-01

    Door de Stuurgroep Energieboerderij werd op 16 maart 2011 de in een velddemo te beproeven gewassen vastgesteld. Gekozen werd voor de navolgende acht gewassen: Landschapsmais, Mariadistel, Tagetes minuta, Tagetes patula, Milkweed, Switchgrass, Reed Canary Grass (RCG) en Witte Krodde. Met uitzondering van de matig ontwikkelde Witte Krodde en Milkweed werd van alle gewassen op het tijdstip van maximale gewasvorming de hoeveelheid biomassa bepaald en werd aan gedroogde gewasmonsters de methaangas...

  20. Demo biomassagewassen binnen project Energieboerderij

    NARCIS (Netherlands)

    Mheen, van der H.J.C.J.

    2011-01-01

    Door de Stuurgroep Energieboerderij werd op 16 maart 2011 de in een velddemo te beproeven gewassen vastgesteld. Gekozen werd voor de navolgende acht gewassen: Landschapsmais, Mariadistel, Tagetes minuta, Tagetes patula, Milkweed, Switchgrass, Reed Canary Grass (RCG) en Witte Krodde. Met uitzondering

  1. Demo biomassagewassen binnen project Energieboerderij

    OpenAIRE

    Mheen, van der, H.

    2011-01-01

    Door de Stuurgroep Energieboerderij werd op 16 maart 2011 de in een velddemo te beproeven gewassen vastgesteld. Gekozen werd voor de navolgende acht gewassen: Landschapsmais, Mariadistel, Tagetes minuta, Tagetes patula, Milkweed, Switchgrass, Reed Canary Grass (RCG) en Witte Krodde. Met uitzondering van de matig ontwikkelde Witte Krodde en Milkweed werd van alle gewassen op het tijdstip van maximale gewasvorming de hoeveelheid biomassa bepaald en werd aan gedroogde gewasmonsters de methaangas...

  2. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  3. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  4. Glass Transition Temperature Depression at the Percolation Threshold in Carbon Nanotube-Epoxy Resin and Polypyrrole-Epoxy Resin Composites

    OpenAIRE

    Barrau, Sophie; Demont, Philippe; Maraval, Céline; Bernès, Alain; Lacabanne, Colette

    2005-01-01

    The glass transition temperatures of conducting composites, obtained by blending carbon nanotubes (CNTs) or polypyrrole (PPy) particles with epoxy resin, were investigated by using both differential scanning calorimetry (DSC) and dynamical mechanical thermal analysis (DMTA). For both composites, dc and ac conductivity measurements revealed an electrical percolation threshold at which the glass transition temperature and mechanical modulus of the composites pass through a minimum.

  5. The complete Ac/Ds transposon family of maize.

    Science.gov (United States)

    Du, Chunguang; Hoffman, Andrew; He, Limei; Caronna, Jason; Dooner, Hugo K

    2011-12-01

    The nonautonomous maize Ds transposons can only move in the presence of the autonomous element Ac. They comprise a heterogeneous group that share 11-bp terminal inverted repeats (TIRs) and some subterminal repeats, but vary greatly in size and composition. Three classes of Ds elements can cause mutations: Ds-del, internal deletions of the 4.6-kb Ac element; Ds1, ~400-bp in size and sharing little homology with Ac, and Ds2, variably-sized elements containing about 0.5 kb from the Ac termini and unrelated internal sequences. Here, we analyze the entire complement of Ds-related sequences in the genome of the inbred B73 and ask whether additional classes of Ds-like (Ds-l) elements, not uncovered genetically, are mobilized by Ac. We also compare the makeup of Ds-related sequences in two maize inbreds of different origin. We found 903 elements with 11-bp Ac/Ds TIRs flanked by 8-bp target site duplications. Three resemble Ac, but carry small rearrangements. The others are much shorter, once extraneous insertions are removed. There are 331 Ds1 and 39 Ds2 elements, many of which are likely mobilized by Ac, and two novel classes of Ds-l elements. Ds-l3 elements lack subterminal homology with Ac, but carry transposase gene fragments, and represent decaying Ac elements. There are 44 such elements in B73. Ds-l4 elements share little similarity with Ac outside of the 11-bp TIR, have a modal length of ~1 kb, and carry filler DNA which, in a few cases, could be matched to gene fragments. Most Ds-related elements in B73 (486/903) fall in this class. None of the Ds-l elements tested responded to Ac. Only half of Ds insertion sites examined are shared between the inbreds B73 and W22. The majority of Ds-related sequences in maize correspond to Ds-l elements that do not transpose in the presence of Ac. Unlike actively transposing elements, many Ds-l elements are inserted in repetitive DNA, where they probably become methylated and begin to decay. The filler DNA present in most elements

  6. Transition to Adulthood

    Science.gov (United States)

    ... Quick summary of transition IDEA’s definition of transition services Considering the definition Students at the heart of planning their transition ... fix that! Keep reading… Back to top IDEA’s Definition of Transition Services Any discussion of transition services must begin with ...

  7. Measurement of AC loss of superconductors by vaporizing method

    Energy Technology Data Exchange (ETDEWEB)

    Wakabayashi, Hiroshi; Isono, Takaaki; Matsui, Kunihiro; Fujisaki, Reishi; Nunoya, Yoshihiko; Koizumi, Norikiyo; Takahashi, Yoshikazu; Tsuji, Hiroshi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1995-07-01

    In Japan Atomic Energy Research Institute, the development of superconducting pulse conductors for next period nuclear fusion reactors has been carried out. For these conductors, the rated current of 46 kA and the rated magnetic field of 13T are demanded. When the pulse excitation of superconductors is carried out, AC loss arises, and the temperature of the superconductors rises, and when it exceeds a certain value, the superconducting state cannot be maintained. Therefore, the AC loss of pulse conductors must be limited to a low value. It is difficult to evaluate the AC loss of superconductors by calculation, therefore, it is evaluated by actual measurement. There are magnetizing method and vaporizing method for measuring the AC loss. This time, the equipment for measuring the AC loss of 40 kA class superconductors by vaporizing method which measures the helium gas quantity vaporizing at the time of AC loss occurrence was designed and manufactured for the first time. The method of measuring the AC loss, the structure of the measuring equipment, the helium gas recovering part and the measuring part, the countermeasures for preventing helium gas leakage, the resistance heater for calibration, and the results of measurement are reported. (K.I.)

  8. Faint Galaxies in deep ACS observations

    CERN Document Server

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L

    2003-01-01

    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  9. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  10. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  11. Structural Transitions in Topologically Constrained DNA

    Science.gov (United States)

    Leger, J.; Romano, G.; Sarkar, A.; Robert, J.; Bourdieu, L.; Chatenay, D.; Marko, J. F.

    2000-03-01

    We propose a theoretical explanation for results of recent single molecule micromanipulation experiments (Leger et al, PRL 83, 1066, 1999) on double-stranded DNA with fixed linking number. The topological constraint leads to novel structural transitions, including a shift of the usual 60 pN B-form to S-form transition force plateau up to a force of 100 pN when linking is fixed at zero. Our model needs five distinct states to explain the four different observed transitions. The various constant-force plateaus observed for different fixed values of linking correspond to a mixture of different pairs of states, weighted to satisfy the topological constraint. Our model allows us to conclude that sufficiently overtwisted DNA (positive linkage number) undergoes a transition from B-form DNA to a mixture of S-form and P-form DNA at a force plateau near 45 pN, and then to homogeneous P-form DNA at a force plateau near 110 pN. A similar two-step transition occurs for undertwisted DNA, and by analysing the twisting necessary to produce pure S-form DNA we conclude that the S-state has helix repeat of 38 bp. Support from the Whitaker Foundation, the NSF, the ACS-PRF and Research Corporation is gratefully acknowledged.

  12. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  13. Recurrent Security Gaps In 802.11ac Routers

    OpenAIRE

    Mohammed Farik; ABM Shawkat Ali

    2015-01-01

    Abstract In comparison to earlier IEEE 802.11 standard abgn routers todays popular 802.11ac standard routers have enhanced security. However 802.11ac router still has major security vulnerabilities. The novelty of this paper is that we not only highlight multiple security vulnerabilities in 802.11ac router technologies that still have not been secured since the earlier standards but also present some new ideas with solutions. We believe that our line of thoughts on security vulnerabilities ga...

  14. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  15. Cyclotron production of Ac-225 for targeted alpha therapy.

    Science.gov (United States)

    Apostolidis, C; Molinet, R; McGinley, J; Abbas, K; Möllenbeck, J; Morgenstern, A

    2005-03-01

    The feasibility of producing Ac-225 by proton irradiation of Ra-226 in a cyclotron through the reaction Ra-226(p,2n)Ac-225 has been experimentally demonstrated for the first time. Proton energies were varied from 8.8 to 24.8 MeV and cross-sections were determined by radiochemical analysis of reaction yields. Maximum yields were reached at incident proton energies of 16.8 MeV. Radiochemical separation of Ac-225 from the irradiated target yielded a product suitable for targeted alpha therapy of cancer.

  16. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  17. Thermal hysteresis of Morin transition in hematite particles.

    Science.gov (United States)

    Suber, L; Imperatori, P; Mari, A; Marchegiani, G; Mansilla, M Vasquez; Fiorani, D; Plunkett, W R; Rinaldi, D; Cannas, C; Ennas, G; Peddis, D

    2010-07-14

    Rhombohedral shaped, single crystal hematite particles with narrow size distribution (D(TEM) = 93 +/- 2 nm) were prepared by hydrolysis of iron chloride and polymerisation in water. The results of field dependent magnetization measurements at different warming-cooling rates and ac susceptibility measurements at varying frequencies are reported and discussed. Thermal hysteresis (DeltaT(M)) associated with the Morin transition and field dependence of the Morin temperature (T(M)) are observed in warming-cooling cycles (DeltaT(M) = 25 and 13 K for H = 0.1 and 3 T, respectively) due to the first order phase transition. A frequency dependence of ac susceptibility is observed above T(M), as a result of the relaxation of the magnetic moment of hematite particles in the weak-ferromagnetic phase.

  18. Single-Phase Four Switch Z-Source AC-AC Converters%单相四开关Z源AC-AC变换器

    Institute of Scientific and Technical Information of China (English)

    汤雨; 谢少军; 张超华

    2007-01-01

    提出了一种单相四开关Z源AC-AC变换器,它包括电压型与电流型两类.与传统脉宽调制AC-AC变换器相比,它具有如下特点:输出电压范围宽且可升可降,输出电压与输入电压可同相或反相,冲击和谐波电流小,可靠性高.针对AC-AC变换器中固有的开关管换流问题,提出了一种适用于单相四开关Z源AC-AC变换器的换流方案,无需外加缓冲吸收电路即可实现开关管的安全换流.以电压型单相四开关Z源AC-AC变换器为例,对其进行了理论分析、仿真和原理试验研究.实验结果证实了Z源变换器的特性及换流方案的可行性.

  19. Characterizing the Outer Divertor Leg Transition to Full Detachment

    Science.gov (United States)

    McLean, A. G.; Allen, S. L.; Fenstermacher, M. E.; Lasnier, C. J.; Meyer, W. H.; Porter, G. D.; Soukhanovskii, V. A.; Bray, B. D.; Carlstrom, T. N.; Leonard, A. W.; Liu, C.; Eldon, D.; Groth, M.; Stangeby, P. C.; Tsui, C. K.

    2013-10-01

    Experiments at DIII-D have explored the transition from an attached to fully detached divertor condition in L- and H-mode with an unprecedented level of detail. Improved divertor Thomson scattering capturing Te operation in future devices. This work supported in part by the US Department of Energy under DE-AC52-07NA27344 and DE-FC02-04ER54698.

  20. PyTransit: Transit light curve modeling

    Science.gov (United States)

    Parviainen, Hannu

    2015-05-01

    PyTransit implements optimized versions of the Giménez and Mandel & Agol transit models for exoplanet transit light-curves. The two models are implemented natively in Fortran with OpenMP parallelization, and are accessed by an object-oriented python interface. PyTransit facilitates the analysis of photometric time series of exoplanet transits consisting of hundreds of thousands of data points, and of multipassband transit light curves from spectrophotometric observations. It offers efficient model evaluation for multicolour observations and transmission spectroscopy, built-in supersampling to account for extended exposure times, and routines to calculate the projected planet-to-star distance for circular and eccentric orbits, transit durations, and more.