WorldWideScience

Sample records for ac transit demos

  1. Alameda-Contra Costa Transit District (AC Transit) Fuel Cell Transit Buses: Preliminary Evaluation Results

    Chandler, K.; Eudy, L.

    2007-03-01

    This report provides an evaluation of three prototype fuel cell-powered transit buses operating at AC Transit in Oakland, California, and six baseline diesel buses similar in design to the fuel cell buses.

  2. Breeding blanket for DEMO

    Proust, E. (Commissariat a l' Energie Atomique (CEA), DRN/DMT/SERMA, CE, Saclay (France)); Anzidei, L. (ENEA/FUS, C.R.E., Frascati (Italy)); Casini, G. (Commission of the European Communities, Joint Research Center, Ispara (Italy)); Dalle Donne, M. (Kernforschungszentrum Karlsruhe GmbH (Germany)); Giancarli, L. (Commissariat a l' Energie Atomique (CEA), DRN/DMT/SERMA, CE, Saclay (France)); Malang, S. (Kernforschungszentrum Karlsruhe GmbH (Germany))

    1993-03-01

    This paper presents the main design features, their rationale, and the main critical issues for the development, of the four DEMO-relevant blanket concepts presently being investigated within the framework of the European Test-Blanket Development Programme. (orig.)

  3. Breeding blanket for Demo

    Proust, E.; Giancarli, L. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. de Mecanique et de Technologie; Anzidei, L. [ENEA, Frascati (Italy). Centro Ricerche Energia; Casini, G. [Commission of the European Communities, Ispra (Italy). Joint Research Centre; Dalle Donne, M.; Malang, S. [Kernforschungszentrum Karlsruhe GmbH (Germany)

    1992-12-31

    This paper presents the main design features, their rationale, and the main critical issues for the development, of the four DEMO-relevant blanket concepts presently investigated within the framework of the European Test-Blanket Development Programme.

  4. National Fuel Cell Bus Program: Accelerated Testing Evaluation Report and Appendices, Alameda-Contra Costa Transit District (AC Transit)

    Chandler, K.; Eudy, L.

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 through October 2008. Evaluation results include implementation experience, fueling station operation, fuel cell bus operations at Golden Gate Transit, and evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and roadcalls).

  5. National Fuel Cell Bus Program: Accelerated Testing Evaluation Report #2, Alameda-Contra Costa Transit District (AC Transit) and Appendices

    Eudy, L.; Chandler, K.

    2010-06-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006, comparing similar diesel buses operating from the same depot. It covers November 2007 through February 2010. Results include implementation experience, fueling station operation, evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and road calls), and a summary of achievements and challenges encountered during the demonstration.

  6. DEMO diagnostics and burn control

    Biel, W.; de M. Baar,; Dinklage, A.; Felici, F.; Konig, R.; Meister, H.; Treutterer, W.; Wenninger, R.

    2015-01-01

    The development of the control system for a tokamak demonstration fusion reactor (DEMO) faces unprecedented challenges. First, the requirements for control reliability and accuracy are more stringent than on existing fusion devices: any loss of plasma control on DEMO may result in a disruption which

  7. International Perspectives on a Path to MFE DEMO

    Neilson, George H.; Abdou, M.; Federici, Gianfranco; Garofalo, A. M.; Kamendje, R.; Kaw, Predhiman K.; Kim, Keeman; Kurtz, Richard J.; Kuteev, Boris V.; Ward, David; Yamada, Hiroshi; Zohm, Hartmut

    2013-01-07

    The establishment of the ITER project marks a transition in the world fusion program to one increasingly focused on the demonstration of electricity generation from fusion, or DEMO. In recent years, planning and design activities for next steps toward DEMO have intensified in many countries, and international discussions have identified both needs and opportunities for greater international collaboration in developing a DEMO Programme. The scientific and technical issues for fusion are well known and, while there is no agreement on a single roadmap to fusion, there is substantial scope to add value through international cooperation, particularly in promoting a coordinated DEMO programme. The International Atomic Energy Agency, as a world organization dedicated to fostering international collaboration in the development of nuclear energy for peaceful purposes, is well suited to provide auspices for an activity promoting an international exchange of technical information and strategic thinking that would benefit all parties. Accordingly, an IAEA DEMO Programme Workshop series focus on the scientific and technical issues for fusion development toward DEMO has been established. The first workshop will be held 15-18 October 2012 in the U.S.A.

  8. DemoCensus_BLCK2000

    Vermont Center for Geographic Information — DemoCensus_BLCK2000 includes Census 2000 Block boundaries and SF1 attributes. The data was downloaded (http://arcdata.esri.com/data/tiger2000/tiger_download.cfm) by...

  9. DEMO blanket testing in ITER. Influence on reaching DEMO

    Shatalov, G. E-mail: geshat@nfi.kiae.ru

    2001-10-01

    ITER goal was specified as one step between now and the DEMO fusion reactor. One of the major issues is the tritium breeding blankets test relevant to future reactors. The major objectives of blanket modules (TBM) experiments in ITER are reduced in comparison with proposed test objectives in ITER-FDR. Thus, results of DEMO blanket designs testing in ITER will provide limited (but still useful) information that will need strong support from non-fusion facilities testing. The role of non-fusion tests is increased now to provide additional data required for DEMO blanket construction and qualification. A strategy of testing steps to DEMO blanket qualifications has to include parallel testing in ITER and in non-fusion devices. Experiments in fission reactors are able to provide essential data on materials radiation properties; tritium release, inventory and permeation; and thermomechanical behavior of the blanket breeder/multiplier. However, the volume in fission reactors is rather small and neutron spectra differ from the fusion reactor one. Nonetheless in the near future one depends primarily on fission reactor irradiation. The powerful accelerator based neutron source IFMIF could also provide useful information on radiation material properties. Plasma based neutron sources of different fusion devices could be the best choice for testing DEMO materials and blanket mock-ups. Timetable and costs of these devices are not clear now.

  10. The DEMO Quasisymmetric Stellarator

    Geoffrey B. McFadden

    2010-02-01

    Full Text Available The NSTAB nonlinear stability code solves differential equations in conservation form, and the TRAN Monte Carlo test particle code tracks guiding center orbits in a fixed background, to provide simulations of equilibrium, stability, and transport in tokamaks and stellarators. These codes are well correlated with experimental observations and have been validated by convergence studies. Bifurcated 3D solutions of the 2D tokamak problem have been calculated that model persistent disruptions, neoclassical tearing modes (NTMs and edge localized modes (ELMs occurring in the International Thermonuclear Experimental Reactor (ITER, which does not pass the NSTAB simulation test for nonlinear stability. So we have designed a quasiaxially symmetric (QAS stellarator with similar proportions as a candidate for the demonstration (DEMO fusion reactor that does pass the test [1]. The configuration has two field periods and an exceptionally accurate 2D symmetry that furnishes excellent thermal confinement and good control of the prompt loss of alpha particles. Robust coils are found from a filtered form of the Biot-Savart law based on a distribution of current over a control surface for the coils and the current in the plasma defined by the equilibrium calculation. Computational science has addressed the issues of equilibrium, stability, and transport, so it remains to develop an effective plan to construct the coils and build a diverter.

  11. Stick-slip to sliding transition of dynamic contact lines under AC electrowetting

    Mannetje, 't D.J.C.M.; Mugele, F.; Ende, van den D.

    2013-01-01

    We show that at low velocities the dynamics of a contact line of a water drop moving over a Teflon-like surface under ac electrowetting must be described as stick–slip motion, rather than one continuous movement. At high velocities we observe a transition to a slipping regime. In the slipping regime

  12. DEMO diagnostics and burn control

    Biel, Wolfgang, E-mail: w.biel@fz-juelich.de [Institute of Energy and Climate Research, Forschungszentrum Jülich GmbH, Jülich (Germany); Department of Applied Physics, Ghent University (Belgium); Baar, Marco de [FOM-Institute DIFFER, Nieuwegein (Netherlands); Eindhoven University of Technology (Netherlands); Dinklage, Andreas [Max-Planck-Institut für Plasmaphysik, Greifswald (Germany); Felici, Federico [Eindhoven University of Technology (Netherlands); König, Ralf [Max-Planck-Institut für Plasmaphysik, Greifswald (Germany); Meister, Hans; Treutterer, Wolfgang [Max-Planck-Institut für Plasmaphysik, Garching (Germany); Wenninger, Ronald [Max-Planck-Institut für Plasmaphysik, Garching (Germany); EFDA Power Plant Physics and Technology, Garching (Germany)

    2015-10-15

    Highlights: • An initial concept for the DEMO diagnostic and control system is presented. • A preliminary list of control functions and candidate diagnostics is developed. • Challenges regarding disruptions, power exhaust and radiation control are highlighted. • The need for introducing realistic control margins is emphasized. • On outline of the future R&D plan is presented. - Abstract: The development of the control system for a tokamak demonstration fusion reactor (DEMO) faces unprecedented challenges. First, the requirements for control reliability and accuracy are more stringent than on existing fusion devices: any loss of plasma control on DEMO may result in a disruption which could damage the inner wall of the machine, while operating the device with larger margins against the operational limits would lead to a reduction of the electrical output power. Second, the performance of DEMO control is limited by space restrictions for the implementation of components (optimization of the tritium breeding rate), by lifetime issues for the front-end parts (neutron and gamma radiation, erosion and deposition acting on all components) and by slow, weak and indirect action of the available actuators (plasma shaping, heating and fuelling). The European DEMO conceptual design studies include the development of a reliable control system, since the details of the achievable plasma scenario and the machine design may depend on the actual performance of the control system. In the first phase of development, an initial understanding of the prime choices of diagnostic methods applicable to DEMO, implementation and performance issues, the interrelation with the plasma scenario definition, and the planning of necessary future R&D have been obtained.

  13. Russian DEMO-S reactor with continuous plasma burn

    Shatalov, G. E-mail: geshat@qq.nfi.kiae.su; Kirillov, I.; Sokolov, Yu.; Strebkov, Yu.; Vasiliev, N

    2000-11-01

    A conceptual study of DEMO-S steady state reactor is being carried out in RF. The main goals of the study are aimed at establishing physics and engineering basis and limitations of the reactor. It was assumed that DEMO is a next step after international thermonuclear experimental reactors (ITER) operation, and so conservative assumptions were used in the study based on ITER engineering. A steady state operation mode is recommended with fusion power of 2-3 GW and maximum first wall (FW) neutron load of 3-4 MW m{sup -2}. The reactor has to operate in advance plasma mode with high fraction of bootstrap current. The reversed shear regime and operation in H-mode are evaluated. A lifetime of 30-40 MW m{sup -2} is assumed for the DEMO plant, with three to four changes of plasma facing components. The general reactor layout is determined. Two options of breeding blanket with ceramic and liquid lithium breeders are presented, supported by neutronic, thermalhydraulic and mechanical calculations. A conventional type of water or Li cooling divertor targets with maximum heat load of {approx}10 MW m{sup -2} was chosen. Heat to electricity conversion schemes are analysed for both helium and liquid metal coolant with net efficiency of 35-40%. Aspects of radioactive waste management are considered.

  14. Demo of Gaze Controlled Flying

    Alapetite, Alexandre; Hansen, John Paulin; Scott MacKenzie, I.

    2012-01-01

    Development of a control paradigm for unmanned aerial vehicles (UAV) is a new challenge to HCI. The demo explores how to use gaze as input for locomotion in 3D. A low-cost drone will be controlled by tracking user’s point of regard (gaze) on a live video stream from the UAV....

  15. RF H and CD systems for DEMO - Challenges and opportunities

    Franke, T.; Wenninger, R. [EFDA Close Support Unit, Boltzmannstr. 2, D - 85748 Garching, Germany and Max-Planck-Institut für Plasmaphysik, EURATOM Association, Boltzmannstr. 2, D - 85748 Garching (Germany); Barbato, E.; Cardinali, A.; Cesario, R.; Mirizzi, F.; Tuccillo, A. A. [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044-Frascati, Rome (Italy); Ceccuzzi, S. [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044-Frascati, Rome, Italy and Applied Electronics Department, Roma Tre University, Via della Vasca Navale, 84 00146, Roma (Italy); Eester, D. V.; Lerche, E. [Association EURATOM-Belgian State, LPP-ERM/KMS, TEC partner, Brussels (Belgium); Mayoral, M.-L. [EFDA Close Support Unit, Boltzmannstr. 2, D - 85748 Garching, Germany and Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Nightingale, M. [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Noterdaeme, J.-M.; Poli, E.; Zohm, H. [Max-Planck-Institut für Plasmaphysik, EURATOM Association, Boltzmannstr. 2, D - 85748 Garching (Germany)

    2014-02-12

    The aim of driving a sufficient amount of plasma current with an appropriate radial current density profile is considered as one of the key challenges for a tokamak fusion power plant in steady state operation. Furthermore, efficient heating to enable transition to regime of enhanced confinement and to achieve breakeven plasma temperatures as well as MHD control and plasma breakdown assistance are required. In the framework of the EFDA Power Plant Physics and Technology (PPPT) activities, the ability of the Electron cyclotron (EC), Ion Cyclotron (IC) and Lower Hybrid (LH) systems to fulfil these requirements, was studied for a demonstration fusion power plant (DEMO). As boundary condition, a 1D description of the plasma for a pulsed DEMO based on system code studies combined with transport analysis was developed. The predicted 1D plasma parameters were used to calculate the current drive (CD) efficiency of each system and eventually optimised it. As an example, the EC current drive efficiency could be increased strongly by top launch compared to equatorial launch at least by a factor of two. For the IC system, two possible windows of operation for standard and higher frequencies were highlighted, whereby again top launch leads to higher CD-efficiencies. The efficiencies predicted for DEMO for the RF current drive systems will be presented. Finally, gaps in the feasibility of RF systems under DEMO relevant conditions will be identified.

  16. Pulsed DEMO design assessment studies

    Todd, T N

    2013-01-01

    Now that ITER is under construction, interest is increasing in the specification and design of the successor machine, a Demonstration Power Plant (DEMO), which in Europe is coordinated by the EFDA Power Plant Physics and Technology programme. This paper summarises the work carried out for EFDA in 2011-2012 on design issues pertinent to a pulsed version of DEMO, intended to be implemented with little or no extrapolation of technology available today. The work was carried out by the Euratom Fusion Associations CCFE, CEA, CRPP, ENEA and KIT, and in addition to a review of recent relevant literature addressed systems code analyses (pulse length vs. size), erosion of plasma facing components, thermomechanical fatigue in the blanket and first wall, a range of energy storage issues, and fatigue life improvements in Nb3Sn CICC superconductors.

  17. PSO-Ensemble Demo Application

    2004-01-01

    Within the framework of the PSO-Ensemble project (FU2101) a demo application has been created. The application use ECMWF ensemble forecasts. Two instances of the application are running; one for Nysted Offshore and one for the total production (except Horns Rev) in the Eltra area. The output is a...... is available via two password-protected web-pages hosted at IMM and is used daily by Elsam and E2....

  18. Influence of the ac Stark effect on multiphoton transitions in molecules

    Meerts, W. Leo; Ozier, Irving; Hougen, Jon T.

    1989-05-01

    A multiphoton mechanism for molecular beam transitions is presented which relies on a large first-order ac Stark effect to modulate the energy separation of the initial and final states of the multiphoton transition, but which does not require the presence of any intermediate level(s). The theoretical formalism uses ideas from the laser multiphoton literature for a two-level system interacting with a monochromatic electromagnetic radiation field, together with a close analog of the rotating wave approximation. The diagonal matrix elements of the Hamiltonian operator corresponding to the large ac Stark effect are removed by a mathematical substitution which in effect transforms appropriate differences of these diagonal elements into transition moments involving higher harmonics of the frequency of the monochromatic radiation field. The electric field strength of the true monochromatic radiation field is ``distributed'' among the higher harmonics of the effective field according to an expression involving Bessel functions. Because these Bessel functions are bounded, there exists for a given time t of exposure to the radiation, a threshold for the magnitude of the transition dipole matrix element coupling the two levels: Below this threshold, the transition probability in a traditional one-photon molecular beam electric resonance experiment cannot be made unity simply by increasing the amplitude of the radiation field. In fact, if the coupling matrix element is small enough, the molecular beam electric resonance signal cannot be detected within exposure time t. The algebraic formalism described above is checked by computer solution of an initial value problem involving four real coupled linear differential equations. It is then used to explain the multiphoton transitions previously observed in molecular beam electric resonance studies on the two symmetric top molecules OPF3 and CH3 CF3, where the number of photons involved in a given transition varies from 1

  19. The ac Stark shifts of the terahertz clock transitions of barium

    余庚华; 耿鹰鸽; 李隆; 周超; 段丞博; 柴瑞鹏; 杨永明

    2015-01-01

    Wavelength-dependent AC Stark shifts and magic wavelengths of the terahertz clock transitions between the metastable triplet states 6s5d 3D1 and 6s5d 3D2 are investigated with considering the optical lattice trapping of barium atoms with the linearly polarized laser. The trap depths and the slopes of light shift difference with distinct magic wave-lengths of the optical lattices are also discussed in detail. Several potentially suitable working points for the optical lattice trapping laser are recommended and selected from these magic wavelengths.

  20. Investigation of the hydrogen release incident at the AC Transit Emeryville Facility.

    Harris, Aaron P.; San Marchi, Christopher W.; Levin, Jamie; Butler, Dennis

    2012-06-01

    This report summarizes the investigation of the release of approximately 300kg of hydrogen at the AC Transit Facility in Emeryville, CA. The hydrogen release was avoidable in both the root cause and contributing factors. The report highlights the need for communication in all phases of project planning and implementation. Apart from the failed valve, the hydrogen system functioned as designed, venting the hydrogen gas a safe distance above surrounding structures and keeping the subsequent fire away from personnel and equipment. The Emeryville Fire Department responded appropriately given the information provided to the Incident Commander. No injuries or fatalities resulted from the incident.

  1. Investigation of the Interfacial Transition Zone between Aggregate-Cement Paste by AC Impedance Spectroscopy

    KONG Lijuan; HOU Lirong; WANG Yuhua; SUN Guowen

    2016-01-01

    Three different types and sizes of coarse aggregate were chosen, and the alternating current (AC) impedance of cement paste samples with and without aggregate was measured at different curing ages. Based on Song’s equivalent circuit model, the electrical properties from the AC impedance results were obtained, and the resistance of connected pores RCCP was used to characterize the microstructure of the interfacial transition zone (ITZ). The results show that the RCCP of concrete sample with aggregate is lower than that of cement paste sample, which indicates that the introduction of aggregate in cement paste makes the ITZ porous. Furthermore, for the same type of aggregate, an increase in particle size leads to a more porous ITZ, which accounts for the “water effect” and a larger aggregate would accumulate a thicker water iflm around it. In addition, for the same size of aggregate, the physical interaction between aggregate and cement paste is dominant in early age, and the microstructure of the ITZ around limestone aggregate is denser, which mainly depends on its rough surface and high water absorption. However, the microstructures of the ITZ around granite and basalt aggregates are denser in later age, which may be due to their higher chemical activity, and the chemical interaction between them and cement paste resulting in the generation of more hydrates. AC impedance spectroscopy thus proves to be powerful for evaluation of the microstructure of the ITZ.

  2. AC-field-induced quantum phase transitions in density of states

    Yang, Kai-Hua; Liu, Kai-Di; Wang, Huai-Yu; Qin, Chang-Dong

    2016-02-01

    We investigate the joint effects of the intralead electron interaction and an external alternating gate voltage on the time-averaged local density of states (DOSs) of a quantum dot coupled to two Luttinger-liquid leads in the Kondo regime. A rich dependence of the DOSs on the driving amplitude and intralead interaction is demonstrated. We show that the feature is quite different for different interaction strengths in the presence of the ac field. It is shown that the photon-assisted transport processes cause an additional splitting of the Kondo peak or dip, which exhibits photon-assisted single-channel (1CK) or two-channel Kondo (2CK) physics behavior. The phase transition between photon-assisted 1CK and 2CK physics occurs when the interaction strength is moderately strong. The inelastic channels associated with photon-assisted electron tunneling can dominate electron transport for weak interaction when the ac amplitude is greater than the frequency by one order of magnitude. In the limit of strong interaction the DOSs scale as a power-law behavior which is strongly affected by the ac field.

  3. Compact Stellarator Path to DEMO

    Lyon, J. F.

    2007-11-01

    Issues for a DEMO reactor are sustaining an ignited/high-Q plasma in steady state, avoiding disruptions and large variations in power flux to the wall, adequate confinement of thermal plasma and alpha-particles, control of a burning plasma, particle and power handling, etc. Compact stellarators have key advantages -- steady-state high-plasma-density operation without external current drive or disruptions, stability without a close conducting wall or active feedback systems, and low recirculating power -- in addition to moderate plasma aspect ratio, good confinement, and high-beta potential. The ARIES-CS study established that compact stellarators can be competitive with tokamaks as reactors. Many of the issues for a compact stellarator DEMO can be answered using results from large tokamaks, ITER D-T experiments and fusion materials, technology and component development programs, in addition to stellarators in operation, under construction or in development. However, a large next-generation stellarator will be needed to address some physics issues: size scaling and confinement at higher parameters, burning plasma issues, and operation with a strongly radiative divertor. Technology issues include simpler coils, structure, and divertor fabrication, and better cost information.

  4. Beyond ITER: Neutral beams for DEMO

    McAdams, R

    2013-01-01

    In the development of magnetically confined fusion as an economically sustainable power source, ITER is currently under construction. Beyond ITER is the DEMO programme in which the physics and engineering aspects of a future fusion power plant will be demonstrated. DEMO will produce net electrical power. The DEMO programme will be outlined and the role of neutral beams for heating and current drive will be described. In particular, the importance of the efficiency of neutral beam systems in terms of injected neutral beam power compared to wallplug power will be discussed. Options for improving this efficiency including advanced neutralisers and energy recovery are discussed.

  5. Constructing a Tibetan Demos in Exile

    Brox, Trine

    2012-01-01

    homeland. Two specific instances of the construction of a transnational exile demos are investigated: citizenship and political representation. The Tibetan Government-in-Exile's formalized idea of citizenship builds upon ideals of equal and loyal members who form a single unit bounded by a common cause....... This also constitutes the foundation for Tibetan citizens' political representation in the Tibetan Parliament-in-Exile. The parliament's definition of the demos enhances regional and religious adherence as essentials for determining who the Tibetan people are. The article refers to problems regarding how...... this construct, which defines who is included into the demos, inevitably means that some are excluded as well....

  6. Stick-Slip to Sliding Transition of Dynamic Contact Lines under AC Electrowetting.

    't Mannetje, D J C M; Mugele, F; van den Ende, D

    2013-12-03

    We show that at low velocities the dynamics of a contact line of a water drop moving over a Teflon-like surface under ac electrowetting must be described as stick-slip motion, rather than one continuous movement. At high velocities we observe a transition to a slipping regime. In the slipping regime the observed dependence of the contact angle is well described by a linearization of both the hydrodynamic and the molecular-kinetic model for the dynamic contact line behavior. The overall geometry of the drop also has a strong influence on the contact angle: if the drop is confined to a disk-like shape with radius R, much larger than the capillary length, and height h, smaller than the capillary length, the advancing angle increases steeper with velocity as the aspect ratio h/R is smaller. Although influence of the flow field near a contact line on the contact angle behavior has also been observed in other experiments, these observations do not fit either model. Finally, in our ac experiments no sudden increase of the hysteresis beyond a certain voltage and velocity was observed, as reported by other authors for a dc voltage, but instead we find with increasing voltage a steady decrease of the hysteresis.

  7. Considerations on the DEMO pellet fuelling system

    Lang, P.T., E-mail: peter.lang@ipp.mpg.de [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Day, Ch. [Karlsruhe Institute of Technology, 76021 Karlsruhe (Germany); Fable, E. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Igitkhanov, Y. [Karlsruhe Institute of Technology, 76021 Karlsruhe (Germany); Köchl, F. [Association EURATOM-Ö AW/ATI, Atominstitut, TU Wien, 1020 Vienna (Austria); Mooney, R. [Culham Centre for Fusion Energy, Culham Science Centre, Oxfordshire OX14 3DB (United Kingdom); Pegourie, B. [CEA, IRFM, 13108 Saint-Paul-lez-Durance (France); Ploeckl, B. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); Wenninger, R. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany); EFDA, Garching (Germany); Zohm, H. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany)

    2015-10-15

    Graphical abstract: - Highlights: • Considerations are made for a core particle fuelling system covering all DEMO requirements. • Particle deposition beyond the pedestal top is needed to achieve efficient fuelling. • Conventional pellet technology enabling launching from the torus inboard side can be used. • Efforts have been taken for integrating a suitable pellet guiding system into the EU DEMO model. • In addition, further techniques bearing potential for advanced fuelling performance are considered. - Abstract: The Demonstration Fusion Power Reactor DEMO is the step foreseen to bridge the gap between ITER and the first commercial fusion power plant. One key element in the European work plan for DEMO is the elaboration of a conceptual design for a suitable core particle fuelling system. First considerations for such a system are presented in this contribution. Following the well-considered ITER solution, most analysis performed in this study assumes conventional pellet technology will be used for the fuelling system. However, taking advantage of the less compressed time frame for the DEMO project, several other techniques thought to bear potential for advanced fuelling performance are considered as well. In a first, basic analysis all actuation parameters at hand and their implications on the fuelling performance were considered. Tentative transport modeling of a reference scenario strongly indicates only particles deposited inside the plasma pedestal allow for efficient fuelling. Shallow edge fuelling results in an unbearable burden on the fuel cycle. Sufficiently deep particle deposition seems technically achievable, provided pellets are launched from the torus inboard at sufficient speed. All components required for a DEMO pellet system capable for high speed inboard pellet launch are already available or can be developed in due time with reasonable efforts. Furthermore, steps to integrate this solution into the EU DEMO model are taken.

  8. Initial DEMO tokamak design configuration studies

    Bachmann, Christian, E-mail: christian.bachmann@efda.org [EFDA, Boltzmannstraße 2, 85748 Garching (Germany); Aiello, G. [CEA-Saclay, DEN, DM2S, SEMT, F-91191 Gif-Sur-Yvette (France); Albanese, R.; Ambrosino, R. [ENEA/CREATE, Universita di Napoli Federico II, Naples (Italy); Arbeiter, F. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Aubert, J. [CEA-Saclay, DEN, DM2S, SEMT, F-91191 Gif-Sur-Yvette (France); Boccaccini, L.; Carloni, D. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Federici, G. [EFDA, Boltzmannstraße 2, 85748 Garching (Germany); Fischer, U. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Kovari, M. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Li Puma, A. [CEA-Saclay, DEN, DM2S, SEMT, F-91191 Gif-Sur-Yvette (France); Loving, A. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Maione, I. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Mattei, M. [ENEA/CREATE, Universita di Napoli Federico II, Naples (Italy); Mazzone, G. [ENEA C.R. Frascati, via E. Fermi 45, 00044 Frascati, Roma (Italy); Meszaros, B. [EFDA, Boltzmannstraße 2, 85748 Garching (Germany); Palermo, I. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (CIEMAT), Madrid (Spain); Pereslavtsev, P. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Riccardo, V. [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); and others

    2015-10-15

    Highlights: • A definition of main DEMO requirements. • A description of the DEMO tokamak design configuration. • A description of issues yet to be solved. - Abstract: To prepare the DEMO conceptual design phase a number of physics and engineering assessments were carried out in recent years in the frame of EFDA concluding in an initial design configuration of a DEMO tokamak. This paper gives an insight into the identified engineering requirements and constraints and describes their impact on the selection of the technologies and design principles of the main tokamak components. The EU DEMO program aims at making best use of the technologies developed for ITER (e.g., magnets, vessel, cryostat, and to some degree also the divertor). However, other systems in particular the breeding blanket require design solutions and advanced technologies that will only partially be tested in ITER. The main differences from ITER include the requirement to breed, to extract, to process and to recycle the tritium needed for plasma operation, the two orders of magnitude larger lifetime neutron fluence, the consequent radiation dose levels, which limit remote maintenance options, and the requirement to use low-activation steel for in-vessel components that also must operate at high temperature for efficient energy conversion.

  9. Diagnostic systems in DEMO: engineering design issues

    Todd, T N

    2014-01-01

    The diagnostic systems of DEMO that are mounted on or near the torus, whether intended for the monitoring and control functions of the engineering aspects or the physics behaviour of the machine, will have to be designed to suit the hostile nuclear environment. This will be necessary not just for their survival and correct functioning but also to satisfy the pertinent regulatory bodies, especially where any of them relate to machine protection or the prevention or mitigation of accidents foreseen in the safety case. This paper aims to indicate the more important of the reactor design considerations that are likely to apply to diagnostics for DEMO, drawn from experience on JET, the provisions in hand for ITER and modelling results for the wall erosion and neutron damage effects in DEMO.

  10. Versatile Desktop Experiment Module (DEMo) on Heat Transfer

    Minerick, Adrienne R.

    2010-01-01

    This paper outlines a new Desktop Experiment Module (DEMo) engineered for a chemical engineering junior-level Heat Transfer course. This new DEMo learning tool is versatile, fairly inexpensive, and portable such that it can be positioned on student desks throughout a classroom. The DEMo system can illustrate conduction of various materials,…

  11. Spin density wave (SDW) transition in Ru doped BaFeAs{sub 2} investigated by AC steady state calorimetry

    Vinod, K., E-mail: vinod@igcar.gov.in; Sharma, Shilpam; Sundar, C. S.; Bharathi, A. [Low Temperature Studies Section, Condensed Matter Physics Division, Materials Science Group, Indira Gandhi Centre for Atomic Research (IGCAR), Kalpakkam-603102 (India)

    2015-06-24

    Heat capacity measurements were done on sub-micron sized BaFe{sub 2−x}Ru{sub x}As{sub 2} single crystals using thin film membrane based the AC steady state calorimetry technique. Noticeable thermal hysteresis is observed in the heat capacity of the BaFe{sub 2−x}Ru{sub x}As{sub 2} during cooling and warming cycles, indicating first order nature of the SDW transition.

  12. The potential role of Neutral Beam Injection in EU DEMO

    Vincenzi, Pietro; Artaud, Jean-Francois; Bolzonella, Tommaso; Giruzzi, Gerardo

    2016-10-01

    EU DEMO studies for pulsed (DEMO1) and steady-state (DEMO2) concepts are currently in the pre-conceptual phase. Present DEMO1 design is based on ITER baseline H-mode scenario, while DEMO2 is based on advanced scenarios with moderate reversed q profile sustained by non-inductive currents. One of the possible flattop heating power systems currently considered is Neutral Beam Injection (NBI). In this work the role of NBI in DEMO1 and DEMO2 is investigated by means of integrated simulations of DEMO scenarios using METIS fast tokamak modelling tool. Limitations, requirements and benefits of the use of a NBI system are discussed. For DEMO1 pulsed concept, the role of NBI is mainly central plasma heating for scenario stability (high fusion power H-mode). As a by-product of the tangential injection, NBI is capable of current drive, which is favorable in order to extend the discharge duration. Regarding a steady-state DEMO2 concept, in addition to plasma heating, NBI becomes a direct actuator for the advanced scenario by driving a considerable part of the plasma current. This requires more than 100MW with off-axis injection. The effect of an increase of the injection energy on the driven current density profile is also presented for DEMO2.

  13. Contribution to DEMO reactor RH maintenance assessment

    Bonnemason, Julie [CEA, LIST, Service de Robotique Interactive 18 route du Panorama, BP6, FONTENAY AUX ROSES, F-92265 (France)], E-mail: julie.bonnemason@cea.fr; Friconneau, Jean-Pierre [CEA, LIST, Service de Robotique Interactive 18 route du Panorama, BP6, FONTENAY AUX ROSES, F-92265 (France); Maisonnier, David [EFDA, Boltzmannstrasse 2, 85748 Garching (Germany); Perrot, Yann [CEA, LIST, Service de Robotique Interactive 18 route du Panorama, BP6, FONTENAY AUX ROSES, F-92265 (France)

    2009-06-15

    The scope of this paper is a preliminary assessment of the maintenance scheme in support of the European study for the next generation of fusion reactor: DEMO. Despite other fusion machine requiring remote handling maintenance operations, DEMO is supposed to work under steady state operational conditions. Therefore, requirement on the maintenance scheme is stronger. To target a good availability of the machine along machine operation plan, it is necessary to draw an adequate maintenance scheme. Indeed, due to the high fluxes generated by the plasma in the vacuum vessel, the first wall lifetime is limited, so the frequent replacement is necessary. On current fusion experimental machine, as first wall load conditions are less severe, DEMO condition implies high level of requirement on maintenance time. During DEMO lifetime, several full first wall replacements are expected. To provide access to the vacuum vessel machine for first wall removal, preparatory work is required to set the machine to adequate maintenance conditions and to open the machine properly, the same situation at the end of the maintenance period. Shutdown duration for first wall replacement should be as short as possible to reach the availability target of the machine. From this statement, the maintenance duration should not exceed 20% of the total lifetime of the reactor operation. First wall segmentation (i.e. total number of component to replace) has a high impact onto the replacement time. Considering the number of feasible designs for the first wall segmentation, we concentrate remote handling concept assessments one type of segmentation, the one minimizing the numbers of modules to replace . Assumption on Divertor segmentation for these DEMO studies have similarities with Divertor ITER design; therefore ITER design output is relevant . We assume divertor removal performed in shadow time, while removing the other first wall modules.

  14. Modelling of pulsed and steady-state DEMO scenarios

    Giruzzi, G.; Artaud, J. F.; Baruzzo, M.; Bolzonella, T.; Fable, E.; Garzotti, L.; Ivanova-Stanik, I.; Kemp, R.; King, D. B.; Schneider, M.; Stankiewicz, R.; Stępniewski, W.; Vincenzi, P.; Ward, D.; Zagórski, R.

    2015-07-01

    Scenario modelling for the demonstration fusion reactor (DEMO) has been carried out using a variety of simulation codes. Two DEMO concepts have been analysed: a pulsed tokamak, characterized by rather conventional physics and technology assumptions (DEMO1) and a steady-state tokamak, with moderately advanced physics and technology assumptions (DEMO2). Sensitivity to impurity concentrations, radiation, and heat transport models has been investigated. For DEMO2, the impact of current driven non-inductively by neutral beams has been studied by full Monte Carlo simulations of the fast ion distribution. The results obtained are a part of a more extensive research and development (R&D) effort carried out in the EU in order to develop a viable option for a DEMO reactor, to be adopted after ITER for fusion energy research.

  15. ac hopping magnetotransport across the spin-flop transition in lightly doped La2CuO4

    Sushkov, Oleg P.; Kotov, Valeri N.

    2008-02-01

    The weak ferromagnetism present in insulating La2CuO4 at low doping leads to a spin flop transition, and to transverse (interplane) hopping of holes in a strong external magnetic field. This results in a dimensional crossover 2D→3D for the in-plane transport, which in turn leads to an increase of the hole’s localization length and increased conduction. We demonstrate theoretically that as a consequence of this mechanism, a frequency-dependent jump of the in-plane ac hopping conductivity occurs at the spin flop transition. We predict the value and the frequency dependence of the jump. Experimental studies of this effect would provide important confirmation of the emerging understanding of lightly doped insulating La2-xSrxCuO4 .

  16. Diagnostics for machine protection of DEMO

    Felton, R.

    2014-08-01

    DEMO aims to (i) integrate, demonstrate and validate all relevant technology necessary to convert fusion energy to electrical energy and (ii) that the machine and its operations are economically and environmentally acceptable. To maintain the efficiency and availability of the machine, there are several physics and combined physics/technology issues as well as the engineering issues. Machine Protection (also known as Protection of Investment) addresses both the risks to plant (to avoid costly repair or replacement) and the risks to normal operating time (to avoid loss of productivity and the return on investment). The plasma-related Machine Protection issues involve measurement and control of plasma stability, plasma purity, and plasma-wall interactions. Machine Protection aims to avoid hitting catastrophic limits by using early warning alarm systems, and controlled termination or avoidance, involving coordinated actions of the magnets, gas and auxiliary heating or current-drive systems. This article outlines the key processes, some of which are used in present-day tokamaks and some of which are new specifically for DEMO (e.g. First wall and divertor power handling) and reveals the need to research and develop new science and technology for Machine Protections in DEMO's high radiation and thermal fields. This work was funded by the RCUK Energy Programme under grant EP/I501045 and the European Communities under the contract of Association between EURATOM and CCFE and conducted partly under EFDA PPPT (WP13-DAS04). The views and opinions expressed herein do not necessarily reflect those of the European Commission.

  17. Diagnostics for plasma control on DEMO: challenges of implementation

    Donne, A. J. H.; Costley, A. E.; Morris, A. W.

    2012-01-01

    As a test fusion power plant, DEMO will have to demonstrate reliability and very long pulse/steady-state operation, which calls for unprecedented robustness and reliability of all diagnostic systems (also requiring adequate redundancy). But DEMO will have higher levels of neutron and gamma fluxes, a

  18. Photon trapping effects in DEMO divertor plasma

    Hoshino, K.; Tokunaga, S.; Asakura, N. [Japan Atomic Energy Agency, Rokkasho, Aomori (Japan); Sawada, K.; Idei, R. [Faculty of Engineering, Shinshu Univ., Nagano (Japan); Shimizu, K. [Japan Atomic Energy Agency, Naka, Ibaraki (Japan); Ohno, N. [Graduate School of Engineering, Nagoya Univ, Aichi (Japan)

    2016-08-15

    In the DEMO divertor, the neutral density becomes high to produce the full detachment and therefore the photon trapping can become important. In this paper, effects of the photon trapping on the DEMO divertor plasma has been studied. The pre-evaluation of the photon trapping effects on the fixed background plasma profile was carried out by using an iterative self-consistent collisional radiative model. The recombining plasma near the inner target and the private region changed to the ionizing plasma by the photon-excitation. Based on the preevaluation result, the database of the effective ionization rate coefficient including the photon transport inside a 2 mm sphere. Advantage of the 2 mm sphere approximation is that the extra calculation cost is not necessary. Iterative calculation of the SONIC including the photon trapping effects was carried out. While the electron density increased and the neutral density decreased in the wide region, the electron density decreases close to the inner strike point. This may be due to decrease in the ionization rate by decrease in the neutral density. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  19. Immune modelling and programming of a mobile robot demo

    GONG Tao; CAI Zi-xing; HE Han-gen

    2006-01-01

    An artificial immune system was modelled with self/non-self selection to overcome abnormity in a mobile robot demo. The immune modelling includes the innate immune modelling and the adaptive immune modelling. The self/non-self selection includes detection and recognition, and the self/non-self detection is based on the normal model of the demo. After the detection, the non-self recognition is based on learning unknown non-self for the adaptive immunization. The learning was designed on the neural network or on the learning mechanism from examples. The last step is elimination of all the non-self and failover of the demo. The immunization of the mobile robot demo is programmed with Java to test effectiveness of the approach. Some worms infected the mobile robot demo, and caused the abnormity. The results of the immunization simulations show that the immune program can detect 100% worms,recognize all known Worms and most unknown worms, and eliminate the worms. Moreover, the damaged files of the mobile robot demo can all be repaired through the normal model and immunization. Therefore, the immune modelling of the mobile robot demo is effective and programmable in some anti-worms and abnormity detection applications.

  20. Comparative evaluation of remote maintenance schemes for fusion DEMO reactor

    Utoh, Hiroyasu, E-mail: uto.hiroyasu@jaea.go.jp; Tobita, Kenji; Someya, Youji; Asakura, Nobuyuki; Sakamoto, Yoshiteru; Hoshino, Kazuo; Nakamura, Makoto

    2015-10-15

    Highlights: • Various remote maintenance schemes for DEMO were comparatively assessed based on requirements for DEMO remote maintenance. • The banana shape segment transport using all vertical maintenance ports would be more probable DEMO reactor maintenance scheme. • The key engineering issues are in-vessel transferring mechanism of segment, pipe connection and conducting shell design for plasma vertical stability. - Abstract: Maintenance schemes are one of the critical issues in DEMO design, significantly affecting the configuration of in-vessel components, the size of toroidal field (TF) coil, the arrangement of poloidal field (PF) coils, reactor building, hot cell and so forth. Therefore, the maintenance schemes should satisfy many design requirements and criteria to assure reliable and safe plant operation and to attain reasonable plant availability. The plant availability depends on reliability of remote maintenance scheme, inspection of pipe connection and plasma operation. In this paper, various remote maintenance schemes for DEMO were comparatively assessed based on requirements for DEMO remote maintenance. From the view points of the reliability of inspection on hot cell, TF coil size, stored energy of PF coil and portability of segment, the banana shape segment transport using all vertical maintenance ports would be more probable DEMO reactor maintenance scheme, and it has key engineering issues such as in-vessel transferring mechanism of segment, pipe connection and conducting shell design for plasma vertical stability.

  1. Overview of EU DEMO design and R and D activities

    Federici, G., E-mail: gianfranco.federici@efda.org [EFDA PPPT, Boltzmannstr. 2, Garching 85748 (Germany); Kemp, R.; Ward, D. [CCFE Culham, EURATOM Association, Oxfordshire OX14 3DB (United Kingdom); Bachmann, C.; Franke, T.; Gonzalez, S.; Lowry, C.; Gadomska, M.; Harman, J.; Meszaros, B.; Morlock, C.; Romanelli, F.; Wenninger, R. [EFDA PPPT, Boltzmannstr. 2, Garching 85748 (Germany)

    2014-10-15

    Highlights: • An important objective of the new EU fusion roadmap is to lay the foundation of a DEMO Fusion Power Reactor to follow ITER. • DEMO should be capable of generating several 100 MW of net electricity and operating with a closed fuel-cycle by 2050. • The paper outlines the DEMO design and R and D approach recently being undertaken in Europe. • The paper presents some preliminary design options that are under evaluation as well as the most urgent R and D work needed. • The R and D on materials for a near-term DEMO is discussed in detail elsewhere. - Abstract: One important objective of the EU fusion roadmap Horizon 2020 is to lay the foundation of a Demonstration Fusion Power Reactor (DEMO) to follow ITER, with the capability of generating several 100 MW of net electricity to the grid and operating with a closed fuel-cycle by 2050. This is currently viewed by many of the nations engaged in the construction of ITER as the remaining crucial step towards the exploitation of fusion power. This paper outlines the DEMO design and R and D approach that is being adopted in Europe and presents some of the preliminary design options that are under evaluation as well as the most urgent R and D work that is expected to be launched in the near-future. The R and D on materials for a near-term DEMO is discussed in detail elsewhere.

  2. Advances in the physics basis for the European DEMO design

    Wenninger, R.; Arbeiter, F.; Aubert, J.; Aho-Mantila, L.; Albanese, R.; Ambrosino, R.; Angioni, C.; Artaud, J.-F.; Bernert, M.; Fable, E.; Fasoli, A.; Federici, G.; Garcia, J.; Giruzzi, G.; Jenko, F.; Maget, P.; Mattei, M.; Maviglia, F.; Poli, E.; Ramogida, G.; Reux, C.; Schneider, M.; Sieglin, B.; Villone, F.; Wischmeier, M.; Zohm, H.

    2015-06-01

    In the European fusion roadmap, ITER is followed by a demonstration fusion power reactor (DEMO), for which a conceptual design is under development. This paper reports the first results of a coherent effort to develop the relevant physics knowledge for that (DEMO Physics Basis), carried out by European experts. The program currently includes investigations in the areas of scenario modeling, transport, MHD, heating & current drive, fast particles, plasma wall interaction and disruptions.

  3. Superconducting transition in ruthenocuprate RuSr2GdCu2O8 viewed from the studies of the imaginary part of ac susceptibility

    Zivkovic, I.; Drobac, D.; Ariosa, D.; Berger, H.; Pavuna, D.; Prester, M.

    2002-12-01

    We have measured two structurally similar superconducting systems, RuSr2GdCu2O8 and GdBa2Cu3O7 by means of high-resolution ac susceptibility. The real and the imaginary part of ac susceptibility of both bulk-ceramic and powdered samples have been studied down to the very small magnetic-field levels. We show that there are significant differences in the evolution of superconductivity in the two studied superconducting systems. In particular, we show that the superconducting transition in the grains in RuSr2GdCu2O8 system is masked with intrinsic magnetism of complex origin.

  4. Numerical analysis of divertor plasma for demo-CREST

    Ishida, M.; Maeki, K.; Hatayama, A. [Graduate School of Fundamental Science and Technology, Keio University, Yokohama (Japan); Hiwatari, R. [Central Research Institute of Electric Power Industry (CRIEPI), Tokyo (Japan); Bonnin, X. [LIMHP-CNRS, Universite Paris 13, Villetaneuse (France); Zhu, S. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Schneider, R. [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Greifswald (Germany); Coster, D. [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Garching (Germany)

    2010-05-15

    The numerical analysis of the demonstration fusion reactor Demo-CREST has been carried out; this analysis focuses on impurity seeding. Several design activities for DEMO have been carried out; however, its detailed divertor plasma analysis remains to be carried out. Therefore, in this study, we discuss the possibility of neon puffing in demo-CREST to decrease the power load to the divertor plate by using the B2-EIRENE code. It has been shown that the radiation power loss by neon increases with upstream plasma density and that the peak power load to the divertor plate comes close to the allowable level by using the preliminary divertor configuration (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  5. A preliminary systems assessment of the Starlite Demo candidates

    Bathke, C.G.

    1995-12-01

    The Starlite project has evaluated the following five tokamaks as candidates for the US Demo Power Plant: (1) steady state, first stability regime; (2) pulsed, first stability regime; (3) steady state, second stability regime; (4) steady state, reversed shear; and (5) steady state, low aspect ratio. Systems analysis of these candidates has played an important role in the selection of a reversed-shear tokamak for further conceptual design as a US Demo Power Plant. The cost-based systems analysis that led to the selection of a reversed-shear tokamak is described herein.

  6. Global shutdown dose rate maps for a DEMO conceptual design

    Leichtle, D., E-mail: dieter.leichtle@f4e.europa.eu [Karlsruhe Institute of Technology KIT, Institute for Neutron Physics and Reactor Technology, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Pereslavtsev, P. [Karlsruhe Institute of Technology KIT, Institute for Neutron Physics and Reactor Technology, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Sanz, J.; Catalan, J.P.; Juarez, R. [Universidad Nacional de Educación a Distancia(UNED), E.T.S. Ingenieros Industriales, C/ Juan del Rosal 12, 28040 Madrid (Spain)

    2015-10-15

    Highlights: • Application of R2S-method on high-resolution full torus sector mesh for DEMO. • Absorbed dose rates after shutdown for a variely of RH equipment at typical locations. • Idenification of radiation levels at several port based locations. - Abstract: For the calculations of highly reliable shutdown dose rate (SDR) maps in fusion devices like a DEMO plant, the Rigorous-2-step (R2S) method is nowadays routinely applied using high-resolution decay gamma sources from initial high-resolution neutron flux meshes activating all materials in the system. This approach has been utilized in the present paper with the objective to provide SDR results relevant for RH systems of a conceptual DEMO design developed in the EU. The primary objective was to assess specific locations of interest for RH equipment inside the vessel and along the extension of maintenance ports. To this end, a provisional DEMO MCNP model has been used, featuring HCLL-type blankets, tungsten/copper divertor, manifolds, vacuum vessel with ports and toroidal field coils. The operational scenario assumed 2.1 GW fusion power and a life-time of 20 years with plant availability of 30%, where removable parts will be extracted after 5.2 years. Results of absorbed dose rate distributions for several relevant materials are presented and discussed in terms of the different contributions from the various activated components.

  7. Demo: Using RapidMiner for Text Mining

    2013-01-01

    In this demo the basic text mining technologies by using RapidMining have been reviewed. RapidMining basic characteristics and operators of text mining have been described. Text mining example by using Navie Bayes algorithm and process modeling have been revealed.

  8. Scoping studies for NBI launch geometries on DEMO

    Jenkins, I., E-mail: ian.jenkins@ukaea.uk; Challis, C.D.; Keeling, D.L.; Surrey, E.

    2016-05-15

    Highlights: • NBCD scans are done for beam energies of 1.5 MeV and 1.0 MeV in two DEMO scenarios. • NBCD scan profiles are fed into genetic algorithm to fit a target current profile. • The result gives location and power of sources to give best fit to target profile. • This method can help provide requirements for DEMO beamline geometry. - Abstract: Engineering and technical constraints on Neutral Beam Injection (NBI) in DEMO may determine the available beam energy and may also strongly impact the Neutral Beam Current Drive (NBCD) efficiency by restricting available beam tangential radii. These latter are determined by factors such as the inter-TF coil spacing, as well as the degree of required shielding. In order to illustrate how these factors may affect the contribution of NBCD on DEMO operating scenarios, scans of NBI tangency radii and elevation on two possible DEMO scenarios have been performed with two beam energies, 1.5 MeV and 1.0 MeV, in order to determine the most favourable options for NBCD efficiency. In addition, a method using a genetic algorithm has been used to seek optimised solutions of NBI source locations and powers to attempt to synthesize a target total plasma driven-current profile. It is found that certain beam trajectories may be proscribed by limitations on shinethrough onto the vessel wall. This may affect the ability of NBCD to extend the duration of a pulse in a scenario where it must complement the induced plasma current. Operating at the lower beam energy reduces the restrictions due to shinethrough and is attractive for technical reasons as it will required less development, but in the scenarios examined here this results in a spatial broadening of the NBCD profile, which may make it more challenging to achieve desired total driven-current profiles.

  9. DEMO hot cell and ex-vessel remote handling

    Thomas, Justin, E-mail: justin.thomas@ccfe.ac.uk [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Loving, Antony [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Bachmann, Christian; Harman, Jon [EFDA, PPP and T, Boltzmannstraße 2, 85748 Garching (Germany)

    2013-10-15

    Highlights: ► Overview of current DEMO maintenance concepts. ► Comparison of current dextrous remote handling technologies and their rebalance to DEMO. ► Presentation of some ideas to improve the productivity and reliability of the DEMO ex-vessel transport system. ► A description of the size and type facilities that might be required in the DEMO hot cell. ► Identification of some areas that need to be developed further to meet the requirements of DEMO. -- Abstract: In Europe the work on the specification and design of a demonstration power plant (DEMO) is being carried out by EFDA in the power plant physics and technology (PPP and T) programme. DEMO will take fusion from experimental research into showing the potential for commercial power generation. During the fusion reaction, components in the tokamak become highly activated. The estimated dose rate levels after shutdown (zero decay time) due to 60 dpa accumulation in steel (blanket) and 30 dpa (divertor) are 13.1–17.4 kGy/h (blanket); 8.8–11.6 kGy/h (divertor) [1], much higher than those to be encountered at ITER. Upon removal from the tokamak, components would be transported to the hot cell facility with attention to minimizing the spread of activated dust and tritium contamination. It is proposed to use a sealed cask of ∼20 tonnes, running on air castors with 50% lifting capability redundancy. Due to the number and complexity of the routes taken by this transporter it would have to be an un-tethered semi-autonomous system. This poses some technical challenges, including providing sufficient battery capacity, reliable guidance and a fail safe un-tethered control system. The mass of the components being moved is assumed here to range from a few tonnes to in excess of one hundred tonnes. Before the removed in-vessel components can be processed in the hot cell, they would require a period of cooling, approximately 2.5 years, to allow dose rate and decay heating to reduce. This reduces the decay

  10. Reel success creating demo reels and animation portfolios

    Cabrera, Cheryl

    2013-01-01

    Are you an animator looking to get your foot in the door to the top studios?It's tough if you don't have a demo reel and portfolio that reflects your unique style and incredible talents.  The reception of that reel will make or break you; so it's no wonder that creating a demo reel can be such a daunting task.  Reel Success by Cheryl Cabrera can help.  This book guides you into putting the right content into your portfolio, how to cater to the right audience, and how to harness the power of social media and network effectively.  Accompanied by case studies of actual students

  11. Compact DEMO, SlimCS: design progress and issues

    Tobita, K.; Nishio, S.; Enoeda, M.; Kawashima, H.; Kurita, G.; Tanigawa, H.; Nakamura, H.; Honda, M.; Saito, A.; Sato, S.; Hayashi, T.; Asakura, N.; Sakurai, S.; Nishitani, T.; Ozeki, T.; Ando, M.; Ezato, K.; Hamamatsu, K.; Hirose, T.; Hoshino, T.; Ide, S.; Inoue, T.; Isono, T.; Liu, C.; Kakudate, S.; Kawamura, Y.; Mori, S.; Nakamichi, M.; Nishi, H.; Nozawa, T.; Ochiai, K.; Ogiwara, H.; Oyama, N.; Sakamoto, K.; Sakamoto, Y.; Seki, Y.; Shibama, Y.; Shimizu, K.; Suzuki, S.; Takahashi, K.; Tanigawa, H.; Tsuru, D.; Yamanishi, T.; Yoshida, T.

    2009-07-01

    The design progress in a compact low aspect ratio (low A) DEMO reactor, 'SlimCS', and its design issues are reported. The design study focused mainly on the torus configuration including the blanket, divertor, materials and maintenance scheme. For continuity with the Japanese ITER-TBM, the blanket is based on a water-cooled solid breeder blanket. For vertical stability of the elongated plasma and high beta access, the blanket is segmented into replaceable and permanent blankets and a sector-wide conducting shell is arranged inbetween these blankets. A numerical calculation indicates that fuel self-sufficiency can be satisfied when the blanket interior is ideally fabricated. An allowable heat load to the divertor plate should be 8 MW m-2 or lower, which can be a critical constraint for determining a handling power of DEMO.

  12. Design activities on helical DEMO reactor FFHR-d1

    Sagara, A., E-mail: sagara.akio@LHD.nifs.ac.jp [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Goto, T.; Miyazawa, J.; Yanagi, N.; Tanaka, T.; Tamura, H.; Sakamoto, R.; Tanaka, M.; Tsumori, K. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan); Mitarai, O. [Tokai University, 9-1-1 Toroku, Kumamoto 862-8652 (Japan); Imagawa, S.; Muroga, T. [National Institute for Fusion Science, Toki, Gifu 509-5292 (Japan)

    2012-08-15

    Highlights: Black-Right-Pointing-Pointer Conceptual design studies of the helical DEMO reactor FFHR-d1 have been conducted. Black-Right-Pointing-Pointer Design window analyses with core plasma and engineering designs have been carried out. Black-Right-Pointing-Pointer R and Ds on blanket, magnet, tritium control, fuelling and heating systems are discussed. - Abstract: Based on high-density and high-temperature plasma experiments in the large helical device (LHD), conceptual design studies of the LHD-type helical DEMO reactor FFHR-d1 have been conducted by integrating wide-ranged R and D activities on core plasmas and reactor technologies through cooperative researches under the fusion engineering research project, which has been launched newly in NIFS. Current activities for the FFHR-d1 in this project are presented on design window analyses with designs on core plasma, neutronics for liquid blankets, continuous helical magnets, pellet fueling, tritium systems and plasma heating devices.

  13. Conceptual design study of the K-DEMO magnet system

    Kim, Keeman, E-mail: kkeeman@nfri.re.kr [National Fusion Research Institute, 169-148 Gwahak-ro, Daejeon 305-806 (Korea, Republic of); Oh, Sangjun; Park, Jong Sung; Lee, Chulhee; Im, Kihak; Kim, Hyung Chan; Lee, Gyung-Su [National Fusion Research Institute, 169-148 Gwahak-ro, Daejeon 305-806 (Korea, Republic of); Neilson, George; Brown, Thomas; Kessel, Charles; Titus, Peter; Zhai, Yuhu [Princeton Plasma Physics Laboratory, Princeton, NJ 08543 (United States)

    2015-10-15

    Highlights: • Perform a preliminary conceptual study for a steady-state Korean DEMO reactor. • Present a preliminary design of TF (toroidal field) magnet. • Present a preliminary design of CS (central solenoid) magnet. • Present a preliminary design of PF (toroidal field) magnet. - Abstract: As the ITER is being constructed, there is a growing anticipation for an earlier realization of fusion energy. A major design philosophy for the initiated conceptual design study for a steady-state Korean fusion demonstration reactor (K-DEMO) is engineering feasibility. A two-staged development plan is envisaged. K-DEMO is designed not only to demonstrate a net electricity generation and a self-sustained tritium cycle, but also to be used, in its initial stage, as a component test facility. Then, in its second stage, a major upgrade is carried out by replacing in-vessel components in order to show a net electricity generation on the order of 500 MWe. After a thorough 0-D system analysis, the major radius and minor radius are chosen to be 6.8 m and 2.1 m, respectively. In order to minimize wave deflection, a top-launch high frequency (>200 GHz) electron cyclotron current drive (ECCD) system will be the key system for the current profile control. For matching the high frequency ECCD, a high toroidal field (TF) is required and can be achieved by using high current density Nb{sub 3}Sn superconducting conductor. The peak magnetic field reaches to 16 T with the magnetic field at the plasma center above 7 T. Key features of the K-DEMO magnet system include the use of two TF coil winding packs, each of a different conductor design, to reduce the construction cost and save the space for the magnet structure material.

  14. RAMI analysis for DEMO HCPB blanket concept cooling system

    Dongiovanni, Danilo N., E-mail: danilo.dongiovanni@enea.it [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati (Italy); Pinna, Tonio [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati (Italy); Carloni, Dario [KIT, Institute of Neutron Physics and Reactor Technology (INR) – KIT (Germany)

    2015-10-15

    Highlights: • RAMI (reliability, availability, maintainability and inspectability) preliminary assessment for HCPB blanket concept cooling system. • Reliability block diagram (RBD) modeling and analysis for HCPB primary heat transfer system (PHTS), coolant purification system (CPS), pressure control system (PCS), and secondary cooling system. • Sensitivity analysis on system availability performance. • Failure models and repair models estimated on the base of data from the ENEA fusion component failure rate database (FCFRDB). - Abstract: A preliminary RAMI (reliability, availability, maintainability and inspectability) assessment for the HCPB (helium cooled pebble bed) blanket cooling system based on currently available design for DEMO fusion power plant is presented. The following sub-systems were considered in the analysis: blanket modules, primary cooling loop including pipework and steam generators lines, pressure control system (PCS), coolant purification system (CPS) and secondary cooling system. For PCS and CPS systems an extrapolation from ITER Test Blanket Module corresponding systems was used as reference design in the analysis. Helium cooled pebble bed (HCPB) system reliability block diagrams (RBD) models were implemented taking into account: system reliability-wise configuration, operating schedule currently foreseen for DEMO, maintenance schedule and plant evolution schedule as well as failure and corrective maintenance models. A simulation of plant activity was then performed on implemented RBDs to estimate plant availability performance on a mission time of 30 calendar years. The resulting availability performance was finally compared to availability goals previously proposed for DEMO plant by a panel of experts. The study suggests that inherent availability goals proposed for DEMO PHTS system and Tokamak auxiliaries are potentially achievable for the primary loop of the HCPB concept cooling system, but not for the secondary loop. A

  15. Model improvements for tritium transport in DEMO fuel cycle

    Santucci, Alessia, E-mail: alessia.santucci@enea.it [Unità Tecnica Fusione – ENEA C. R. Frascati, Via E. Fermi 45, 00044 Frascati (Roma) (Italy); Tosti, Silvano [Unità Tecnica Fusione – ENEA C. R. Frascati, Via E. Fermi 45, 00044 Frascati (Roma) (Italy); Franza, Fabrizio [Karlsruhe Institute of Technology (KIT), Hermann-von-Helmholtz-Platz 1, D-76344 Eggenstein-Leopoldshafen (Germany)

    2015-10-15

    Highlights: • T inventory and permeation of DEMO blankets have been assessed under pulsed operation. • 1-D model for T transport has been developed for the HCLL DEMO blanket. • The 1-D model evaluated T partial pressure and T permeation rate radial profiles. - Abstract: DEMO operation requires a large amount of tritium, which is directly produced inside the reactor by means of Li-based breeders. During its production, recovering and purification, tritium comes in contact with large surfaces of hot metallic walls, therefore it can permeate through the blanket cooling structure, reach the steam generator and finally the environment. The development of dedicated simulation tools able to predict tritium losses and inventories is necessary to verify the accomplishment of the accepted tritium environmental releases as well as to guarantee a correct machine operation. In this work, the FUS-TPC code is improved by including the possibility to operate in pulsed regime: results in terms of tritium inventory and losses for three pulsed scenarios are shown. Moreover, the development of a 1-D model considering the radial profile of the tritium generation is described. By referring to the inboard segment on the equatorial axis of the helium-cooled lithium–lead (HCLL) blanket, preliminary results of the 1-D model are illustrated: tritium partial pressure in Li–Pb and tritium permeation in the cooling and stiffening plates by assuming several permeation reduction factor (PRF) values. Future improvements will consider the application of the model to all segments of different blanket concepts.

  16. Development of the Helium Cooled Lithium Lead blanket for DEMO

    Aiello, G., E-mail: giacomo.aiello@cea.fr [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Aubert, J.; Jonquères, N. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Li Puma, A. [CEA-Saclay, DEN/DANS/DM2S/SERMA/LPEC, 91191 Gif Sur Yvette Cedex (France); Morin, A.; Rampal, G. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France)

    2014-10-15

    Highlights: • The HCLL blanket design has been modified to adapt it to the 2012 EFDA DEMO specifications. • The new design has been developed with the aim to capitalize on TBM experience in ITER. • A new attachment system for the modules has been proposed. - Abstract: The Helium Cooled Lithium Lead (HCLL) blanket is one of the candidate European blanket concepts selected for the DEMOnstration fusion power plant that should follow ITER. In a fusion power plant, the blanket is one of the key components because of its impact on the plant performance, availability, safety and economics. In 2012, the European Fusion Development Agreement (EFDA) agency issued new specifications for DEMO: this paper describes the work performed to adapt the previous 2007 HCLL-DEMO blanket design to those specifications. A new segmentation has been defined assuming straight surfaces for all blanket modules. Following the Multi Module Segment (MMS) option, all modules are attached to a common back supporting structure which also serves as manifold for Helium and PbLi distribution. A detailed CAD design of the central outboard module has been defined. Thermo-hydraulic and thermo-mechanical analyses on of the First Wall and Breeder Zone have been carried out. For the attachment of the modules to the common backplate, a new solution based on the use of Tie Rods, derived from the design of the corresponding HCLL Test Blanket Module for ITER, has been proposed. This paper also identifies the priorities for further development of the HCLL blanket design.

  17. Study of safety features and accident scenarios in a fusion DEMO reactor

    Nakamura, M., E-mail: nakamura.makoto@jaea.go.jp [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Tobita, K. [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Gulden, W. [Fusion for Energy, c/o EFDA Garching and Max-Plank-Institut fuer Plasmaphysik, Garching D-85748 (Germany); Watanabe, K. [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Toshiba Corporation, Yokohama, Kanagawa 235-8523 (Japan); Someya, Y. [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Tanigawa, H. [Japan Atomic Energy Agency, Naka, Ibaraki 311-0193 (Japan); Sakamoto, Y. [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Araki, T.; Matsumiya, H.; Ishii, K. [Toshiba Corporation, Yokohama, Kanagawa 235-8523 (Japan); Utoh, H. [Japan Atomic Energy Agency, Rokkasho, Aomori 039-3212 (Japan); Takase, H. [IFERC Project Team, Rokkasho, Aomori 039-3212 (Japan); Hayashi, T. [Japan Atomic Energy Agency, Naka, Ibaraki 311-0193 (Japan); Satou, A.; Yonomoto, T. [Japan Atomic Energy Agency, Tokai, Ibaraki 319-1195 (Japan); Federici, G. [Fusion for Energy, c/o EFDA Garching and Max-Plank-Institut fuer Plasmaphysik, Garching D-85748 (Germany); Okano, K. [IFERC Project Team, Rokkasho, Aomori 039-3212 (Japan)

    2014-10-15

    Highlights: This paper reports progress in the fusion DEMO safety research conducted under the Broader Approach DEMO Design Activities; Hazards of a reference DEMO concept have been assessed; Reference accident event sequences in the reference DEMO in this study have been analyzed based on the master logic diagram (MLD) and the functional failure mode and effect analysis (FFMEA) techniques; Accident events of particular concern in the DEMO have been selected based on the MLD and FFMEA analysis. Abstract: After the Fukushima Dai-ichi nuclear accident, a need for assuring safety of fusion energy has grown in the Japanese (JA) fusion research community. DEMO safety research has been launched as a part of Broader Approach DEMO Design Activities (BA-DDA). This paper reports progress in the fusion DEMO safety research conducted under BA-DDA. Safety requirements and evaluation guidelines have been, first of all, established based on those established in the Japanese ITER site invitation activities. The radioactive source terms and energies that can mobilize such source terms have been assessed for a reference DEMO concept. This concept employs in-vessel components that are cooled by pressurized water and built of a low activation ferritic steel (F82H), contains solid pebble beds made of lithium-titanate (Li{sub 2}TiO{sub 3}) and beryllium–titanium (Be{sub 12}Ti) for tritium breeding and neutron multiplication, respectively. It is shown that unlike the energies expected in ITER, the enthalpy in the first wall/blanket cooling loops is large compared to the other energies expected in the reference DEMO concept. Reference accident event sequences in the reference DEMO in this study have been analyzed based on the Master Logic Diagram and Functional Failure Mode and Effect Analysis techniques. Accident events of particular concern in the DEMO have been selected based on the event sequence analysis and the hazard assessment.

  18. Metal-insulator transition in AC{sub 60}:RbC{sub 60} and KC{sub 60}

    Khazeni, K.; Crespi, V.H.; Hone, J.; Zettl, A.; Cohen, M.L. [Department of Physics, University of California at Berkeley, Berkeley, California 94720 (United States)]|[Materials Sciences Division, Lawrence Berkeley Laboratory, Berkeley, California 94720 (United States)

    1997-09-01

    At zero pressure polymerized RbC{sub 60} is an insulator, whereas polymerized KC{sub 60} is a metal with a slight low-temperature resistive upturn. We report measurements of the resistivity of RbC{sub 60} under pressure, finding a hysteretic resistive transition in RbC{sub 60} near 200 K at 5 kbar, at which point the material transforms from insulator to metal. Correcting the resistivity to constant volume, both materials are metallic below the transition with a common low-temperature resistive upturn which is suppressed under compression. {copyright} {ital 1997} {ital The American Physical Society}

  19. Design study of ITER-like divertor target for DEMO

    Crescenzi, Fabio, E-mail: fabio.crescenzi@enea.it [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); Bachmann, C. [EFDA, Power Plant Physics and Technology, Boltzmannstraße 2, 85748 Garching (Germany); Richou, M. [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Roccella, S.; Visca, E. [ENEA, Unità Tecnica Fusione, ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); You, J.-H. [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany)

    2015-10-15

    Highlights: • ‘DEMO’ is a near-term Power Plant Conceptual Study (PPCS). • The ITER-like design concept represents a promising solution also for DEMO plasma facing units. • The optimization of PFUs aims to enhance the thermo-mechanical behaviour of the component. • The optimized geometry was evaluated by ITER SDC-IC criteria and in terms of low cycle fatigue (LCF). - Abstract: A near-term water-cooled target solution has to be evaluated together with the required technologies and its power exhaust limit under ‘DEMO’ conditions. The ITER-like design concept based on the mono-block technology using W as armour material and the CuCrZr-IG as structural material with an interlayer of pure copper represents a promising solution also for DEMO. This work reports the design study of an “optimized” ITER-like Water Cooled Divertor able to withstand a heat flux of 10 MW m{sup −2}, as requested for DEMO operating conditions. The optimization of plasma facing unit (PFU) aims to enhance the thermo-mechanical behaviour of the component by varying some geometrical parameters (monoblock size, interlayer thickness and, tube diameter and thickness). The optimization was performed by means of the multi-variable optimization algorithms using the FEM code ANSYS. The coolant hydraulic conditions (inlet pressure, temperature and velocity) were fixed for simplicity. This study is based on elastic analysis and 3 dimensional modelling. The resulting optimized geometry was evaluated on the basis of the ITER SDC-IC criteria and in terms of low cycle fatigue (LCF). The margin to the critical heat flux (CHF) was also estimated. Further design study (taking into account the effect of neutron radiation on the material properties) together with mock-up fabrication and high-heat-flux (HHF) tests are foreseen in next work programmes.

  20. Development of the water cooled lithium lead blanket for DEMO

    Aubert, J., E-mail: julien.aubert@cea.fr [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Aiello, G.; Jonquères, N. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Li Puma, A. [CEA-Saclay, DEN/DANS/DM2S/SERMA/LPEC, 91191 Gif Sur Yvette Cedex (France); Morin, A.; Rampal, G. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France)

    2014-10-15

    Highlights: • The WCLL blanket design has been modified to adapt it to the 2012 EFDA DEMO specifications. • Preliminary CAD design of the equatorial outboard module of the WCLL blanket has been developed for DEMO. • Finite elements analyses have been carried out in order to assess the module thermal behavior in the straight part of the module. - Abstract: The water cooled lithium lead (WCLL) blanket, based on near-future technology requiring small extrapolation from present-day knowledge both on physical and technological aspect, is one of the breeding blanket concepts considered as possible candidates for the EU DEMOnstration power plant. In 2012, the EFDA agency issued new specifications for DEMO: this paper describes the work performed to adapt the WCLL blanket design to those specifications. Relatively small modules with straight surfaces are attached to a common Back Supporting Structure housing feeding pipes. Each module features reduced activation ferritic-martensitic steel as structural material, liquid Lithium-Lead as breeder, neutron multiplier and carrier. Water at typical Pressurized Water Reactors (PWR) conditions is chosen as coolant. A preliminary design of the equatorial outboard module has been achieved. Finite elements analyses have been carried out in order to assess the module thermal behavior. Two First Wall (FW) concepts have been proposed, one favoring the thermal efficiency, the other favoring the manufacturability. The Breeding Zone has been designed with C-shaped Double-Walled Tubes in order to minimize the Water/Pb-15.7Li interaction likelihood. The priorities for further development of the WCLL blanket concept are identified in the paper.

  1. Demos – Brandenburgisches Institut für Gemeinwesenberatung

    2010-01-01

    Mit Einblicke III setzt Demos – Mobiles Beratungsteam Tolerantes Brandenburg (MBT) seine Reihe von Selbstreflexionen und Fallberichten aus dem Land Brandenburg fort. „Demokratie heißt Einmischung in die eigenen Angelegenheiten“. Das MBT nimmt den Impuls von Max Frisch auf und unterstützt alle, die Werte und Verfahren der Demokratie ernst nehmen; das MBT versucht jene zu gewinnen, die der Demokratie indifferent und skpetisch gegenüberstehen; und schließlich fördert es die kritische Auseinander...

  2. The Role of Community Colleges in Advancing Upward Mobility: A Demos Perspective

    Huelsman, Mark

    2015-01-01

    This article provides a short background on Demos, a public policy organization that works on issues of political and economic inequality. Demos views community colleges as a linchpin in the American higher education system, and it has worked over several years to research ways to increase state support for higher education and direct support…

  3. Demos as an Explanatory Lens in Teacher Educators' Elusive Search for Social Justice

    Oikonomidoy, Eleni M.; Brock, Cynthia H.; Obenchain, Kathryn M.; Pennington, Julie L.

    2013-01-01

    Borrowing insights from the Ancient Greek ideal conceptions of a democratic civic space (demos), this article examines the applicability of this framework to four teacher educators' journey to implement social justice in their programs. It is proposed that the three constitutive dimensions of demos (freedom of speech, equality to vote and…

  4. An FPGA computing demo core for space charge simulation

    Wu, Jinyuan; Huang, Yifei; /Fermilab

    2009-01-01

    In accelerator physics, space charge simulation requires large amount of computing power. In a particle system, each calculation requires time/resource consuming operations such as multiplications, divisions, and square roots. Because of the flexibility of field programmable gate arrays (FPGAs), we implemented this task with efficient use of the available computing resources and completely eliminated non-calculating operations that are indispensable in regular micro-processors (e.g. instruction fetch, instruction decoding, etc.). We designed and tested a 16-bit demo core for computing Coulomb's force in an Altera Cyclone II FPGA device. To save resources, the inverse square-root cube operation in our design is computed using a memory look-up table addressed with nine to ten most significant non-zero bits. At 200 MHz internal clock, our demo core reaches a throughput of 200 M pairs/s/core, faster than a typical 2 GHz micro-processor by about a factor of 10. Temperature and power consumption of FPGAs were also lower than those of micro-processors. Fast and convenient, FPGAs can serve as alternatives to time-consuming micro-processors for space charge simulation.

  5. The development of ferritic steels for DEMO blanket

    Kohyama, A. [Kyoto Univ. (Japan). Inst. of Advanced Energy; Hishinuma, A.; Shiba, K. [Tokai Establishment, JAERI, Tokai, Ibaraki (Japan); Kohno, Y. [Department of Materials Science, University of Tokyo, Hongo, Tokyo 113 (Japan); Sagara, A. [National Institute for Fusion Science, Toki, Gifu (Japan)

    1998-09-01

    The development of low-activation ferritic/martensitic steels is a key to the achievement of nuclear fusion as a safe, environmentally attractive and economically competitive energy source. The Japanese and the European Fusion Materials programs have put low-activation ferritic and martensitic steels R and D at the highest priority for a demonstration reactor (DEMO) and the beyond. An international collaborative test program on low-activation ferritic/martensitic steels for fusion is in progress as an activity of the International Energy Agency (IEA) fusion materials working group to verify the feasibility of using ferritic/martensitic steels for fusion by an extensive test program covering the most relevant technical issues for the qualification of a material for a nuclear application. The development of a comprehensive data base on the representative industrially processed reduced-activation steels of type 8-9Cr-2WVTa is underway for providing designers a preliminary set of material data for the mechanical design of components, e.g. for DEMO relevant blanket modules. The current design status of FFHR and SSTR utilizing low-activation ferritic steels is reviewed and future prospects are defined. (orig.) 12 refs.

  6. Neutronic analyses and tools development efforts in the European DEMO programme

    Fischer, U., E-mail: ulrich.fischer@kit.edu [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Bachmann, C. [European Fusion Development Agreement (EFDA), Garching (Germany); Bienkowska, B. [Association IPPLM-Euratom, IPPLM Warsaw/INP Krakow (Poland); Catalan, J.P. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Drozdowicz, K.; Dworak, D. [Association IPPLM-Euratom, IPPLM Warsaw/INP Krakow (Poland); Leichtle, D. [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Fusion for Energy (F4E), Barcelona (Spain); Lengar, I. [MESCS-JSI, Ljubljana (Slovenia); Jaboulay, J.-C. [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Lu, L. [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Moro, F. [Associazione ENEA-Euratom, ENEA Fusion Division, Frascati (Italy); Mota, F. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (CIEMAT), Madrid (Spain); Sanz, J. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Szieberth, M. [Budapest University of Technology and Economics (BME), Budapest (Hungary); Palermo, I. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (CIEMAT), Madrid (Spain); Pampin, R. [Fusion for Energy (F4E), Barcelona (Spain); Porton, M. [Euratom/CCFE Fusion Association, Culham Science Centre for Fusion Energy (CCFE), Culham (United Kingdom); Pereslavtsev, P. [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Ogando, F. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Rovni, I. [Budapest University of Technology and Economics (BME), Budapest (Hungary); and others

    2014-10-15

    Highlights: •Evaluation of neutronic tools for application to DEMO nuclear analyses. •Generation of a DEMO model for nuclear analyses based on MC calculations. •Nuclear analyses of the DEMO reactor equipped with a HCLL-type blanket. -- Abstract: The European Fusion Development Agreement (EFDA) recently launched a programme on Power Plant Physics and Technology (PPPT) with the aim to develop a conceptual design of a fusion demonstration reactor (DEMO) addressing key technology and physics issues. A dedicated part of the PPPT programme is devoted to the neutronics which, among others, has to define and verify requirements and boundary conditions for the DEMO systems. The quality of the provided data depends on the capabilities and the reliability of the computational tools. Accordingly, the PPPT activities in the area of neutronics include both DEMO nuclear analyses and development efforts on neutronic tools including their verification and validation. This paper reports on first neutronics studies performed for DEMO, and on the evaluation and further development of neutronic tools.

  7. Safety studies on Korean fusion DEMO plant using Integrated Safety Assessment Methodology: Part 2

    Oh, Kyemin; Kang, Myoung-suk [Kyung Hee University, Yongin-si, Gyeonggi-do 446-701 (Korea, Republic of); Heo, Gyunyoung, E-mail: gheo@khu.ac.kr [Kyung Hee University, Yongin-si, Gyeonggi-do 446-701 (Korea, Republic of); Kim, Hyoung-chan [National Fusion Research Institute, Daejeon-si 305-333 (Korea, Republic of)

    2015-10-15

    Highlights: • The purpose of this paper is to suggest methodology that can investigate safety issues and provides a case study for Korean fusion DEMO plant. • The concepts of Integrated Safety Assessment Methodology (ISAM) that can be applied in addressing regulatory requirements and recognizing safety issues for K-DEMO were emphasized. • Phenomena Identification Ranking Table (PIRT) and Objective Provision Tree (OPT) were performed and updated. • This work is expected to contribute on the conceptual design of safety features for K-DEMO to design engineers and the guidance for regulatory requirements to licensers. - Abstract: The purpose of this paper is to investigate safety issues using Integrated Safety Assessment Methodology (ISAM) proposed by Generation IV Forum Risk and Safety Working Group (RSWG) for Korean fusion DEMO plant (K-DEMO). In ongoing nuclear energy research such as Generation IV fission power plant (GEN-IV), new methodology based on Technology-Neutral Framework (TNF) has been applied for safety assessment. In this methodology, design and regulatory requirements for safety of nuclear power plants are considered simultaneously. The design based on regulatory requirements can save resource, time, and manpower while maintaining high level safety. ISAM is one of the options to apply TNF in K-DEMO. We have performed safety studies for K-DEMO using Phenomena Identification and Ranking Table (PIRT) and Objective Provision Tree (OPT) which are constitutive part of ISAM. Considering the design phase of K-DEMO, the current study focused on PIRT and OPT for K-DEMO. Results have been reviewed and updated by Korean fusion advisory group after considering the views of specialists from domestic universities, industries, and national institutes in South Korea.

  8. Beyond ITER: Neutral beams for a demonstration fusion reactor (DEMO) (invited)

    McAdams, R., E-mail: roy.mcadams@ccfe.ac.uk [EURATOM/CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom)

    2014-02-15

    In the development of magnetically confined fusion as an economically sustainable power source, International Tokamak Experimental Reactor (ITER) is currently under construction. Beyond ITER is the demonstration fusion reactor (DEMO) programme in which the physics and engineering aspects of a future fusion power plant will be demonstrated. DEMO will produce net electrical power. The DEMO programme will be outlined and the role of neutral beams for heating and current drive will be described. In particular, the importance of the efficiency of neutral beam systems in terms of injected neutral beam power compared to wallplug power will be discussed. Options for improving this efficiency including advanced neutralisers and energy recovery are discussed.

  9. Beyond ITER: neutral beams for a demonstration fusion reactor (DEMO) (invited).

    McAdams, R

    2014-02-01

    In the development of magnetically confined fusion as an economically sustainable power source, International Tokamak Experimental Reactor (ITER) is currently under construction. Beyond ITER is the demonstration fusion reactor (DEMO) programme in which the physics and engineering aspects of a future fusion power plant will be demonstrated. DEMO will produce net electrical power. The DEMO programme will be outlined and the role of neutral beams for heating and current drive will be described. In particular, the importance of the efficiency of neutral beam systems in terms of injected neutral beam power compared to wallplug power will be discussed. Options for improving this efficiency including advanced neutralisers and energy recovery are discussed.

  10. Pre-conceptual Design Assessment of DEMO Remote Maintenance

    Loving, A; Sykes, N; Iglesias, D; Coleman, M; Thomas, J; Harman, J; Fischer, U; Sanz, J; Siuko, M; Mittwollen, M; others,

    2013-01-01

    EDFA, as part of the Power Plant Physics and Technology programme, has been working on the pre-conceptual design of a Demonstration Power Plant (DEMO). As part of this programme, a review of the remote maintenance strategy considered maintenance solutions compatible with expected environmental conditions, whilst showing potential for meeting the plant availability targets. A key finding was that, for practical purposes, the expected radiation levels prohibit the use of complex remote handling operations to replace the first wall. In 2012/13, these remote maintenance activities were further extended, providing an insight into the requirements, constraints and challenges. In particular, the assessment of blanket and divertor maintenance, in light of the expected radiation conditions and availability, has elaborated the need for a very different approach from that of ITER. This activity has produced some very informative virtual reality simulations of the blanket segments and pipe removal that are exceptionally ...

  11. TECXY study of a liquid lithium divertor for DEMO

    Pelka, G.; Chmielewski, P.; Zagorski, R. [Institute of Plasma Physics and Laser Microfusion, Warsaw (Poland); Pericoli-Ridolfini, V.; Viola, B. [ENEA C.R. Frascati, Roma (Italy)

    2016-08-15

    Divertor targets made out of a capillary porous system (CPS) filled with liquid lithium, have been proposed as an alternative to standard, solid state plates. In the current work we simulate the DEMO edge plasma in either a standard single-null or snowflake divertor configuration. Our tool is the 2D code TECXY. Lithium ablated from the target plate surface and released into the plasma is shown here to partially screen the incoming heat flux. Lithium's moderate SOL radiation levels suggest additional seeding to be beneficial. Very high heat fluxes to the divertor need to be avoided, as intensive lithium evaporation might unacceptably pollute the plasma. (copyright 2016 The Authors. Contributions to Plasma Physics published by Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  12. Demo III: Department of Defense testbed for unmanned ground mobility

    Shoemaker, Chuck M.; Bornstein, Jonathan A.; Myers, Scott D.; Brendle, Bruce E., Jr.

    1999-07-01

    Robotics has been identified by numerous recent Department of Defense (DOD) studies as a key enabling technology for future military operational concepts. The Demo III Program is a multiyear effort encompassing technology development and demonstration on testbed platforms, together with modeling simulation and experimentation directed toward optimization of operational concepts to employ this technology. Primary program focus is the advancement of capabilities for autonomous mobility through unstructured environments, concentrating on both perception and intelligent control technology. The scout mission will provide the military operational context for demonstration of this technology, although a significant emphasis is being placed upon both hardware and software modularity to permit rapid extension to other military missions. The Experimental Unmanned Vehicle (XUV) is a small (approximately 1150 kg, V-22 transportable) technology testbed vehicle designed for experimentation with multiple military operational concepts. Currently under development, the XUV is scheduled for roll-out in Summer 1999, with an initial troop experimentation to be conducted in September 1999. Though small, and relatively lightweight, modeling has shown the chassis capable of automotive mobility comparable to the current Army lightweight high-mobility, multipurpose, wheeled vehicle (HMMWV). The XUV design couples multisensor perception with intelligent control to permit autonomous cross-country navigation at speeds of up to 32 kph during daylight and 16 kph during hours of darkness. A small, lightweight, highly capable user interface will permit intuitive control of the XUV by troops from current-generation tactical vehicles. When it concludes in 2002, Demo III will provide the military with both the technology and the initial experience required to develop and field the first generation of semi-autonomous tactical ground vehicles for combat, combat support, and logistics applications.

  13. DEMO design activities in the broader approach under Japan/EU collaboration

    Okano, Kunihiko, E-mail: okano-k@z2.keio.jp [International Fusion Energy Research Centre (IFERC) for Broader Approach, Rokkasho (Japan); Federici, Gianfranco [Power Plant Physics and Technology, European Fusion Development Agreement (EFDA), Garching (Germany); Tobita, Kenji [Fusion Research and Development Directorate, Japan Atomic Energy Agency (JAEA), Rokkasho (Japan)

    2014-10-15

    The DEMO design studies in the BA (broader approach in the field of fusion energy) are being conducted by the DEMO Design Activity unit of International Fusion Energy Research Centre for the broader approach (BA) and the Home Teams in EU and Japan since 2011. The activity covers most of the critical issues on the DEMO design. Emphasis during the last two years was on studies to develop the best embodiment of a tokamak as a power reactor consistent with credible operating scenarios and feasible engineering solutions to critical design issues. The technical activities have focused on, for example, plasma physics for DEMO plants, divertor physics and technology, in-vessel components, maintenance schemes and safety research.

  14. Selected transport studies of a tokamak-based DEMO fusion reactor

    Fable, E.; Wenninger, R.; Kemp, R.

    2017-02-01

    As a next-step in the tokamak-based fusion programme, the DEMO fusion reactor is foreseen to produce relevant output electricity, in the order of  ∼500 MW delivered to the network. The scenarios that are being presently investigated consist of a pulsed device, called DEMO1, and a steady-state device, called DEMO2. In this work, which is focused on the pulsed device DEMO1, scenarios are studied from the point of view of core transport, to assess plasma performance and limitations due to core microinstabilities. The role of radiated power, aspect ratio, and height of temperature pedestal are assessed as they impact both core energy and particle transport. Open issues in this framework are also discussed.

  15. A new meshless approach to map electromagnetic loads for FEM analysis on DEMO TF coil system

    Biancolini, Marco Evangelos, E-mail: biancolini@ing.uniroma2.it [Università di Roma Tor Vergata, Dip. Ingegneria dell’Impresa “Mario Lucertini”, Via del Politecnico 1, 00133 Roma (Italy); Brutti, Carlo, E-mail: brutti@uniroma2.it [Università di Roma Tor Vergata, Dip. Ingegneria dell’Impresa “Mario Lucertini”, Via del Politecnico 1, 00133 Roma (Italy); Giorgetti, Francesco, E-mail: francesco.giorgetti@uniroma2.it [Università di Roma Tor Vergata, Dip. Ingegneria dell’Impresa “Mario Lucertini”, Via del Politecnico 1, 00133 Roma (Italy); Muzzi, Luigi, E-mail: luigi.muzzi@enea.it [ENEA, Laboratorio Superconduttività, Unità Tecnica Fusione, Via E. Fermi 45, 00044 Frascati (RM) (Italy); Turtù, Simonetta, E-mail: simonetta.turtu@enea.it [ENEA, Laboratorio Superconduttività, Unità Tecnica Fusione, Via E. Fermi 45, 00044 Frascati (RM) (Italy); Anemona, Alessandro, E-mail: alessandro.anemona@enea.it [ENEA, Laboratorio Superconduttività, Unità Tecnica Fusione, Via E. Fermi 45, 00044 Frascati (RM) (Italy)

    2015-11-15

    Graphical abstract: - Highlights: • Generation and mapping of magnetic load on DEMO using radial basis function. • Good agreement between RBF interpolation and EM TOSCA computations. • Resultant forces are stable with respect to the target mesh used. • Stress results are robust and accurate even if a coarse cloud is used for RBF interpolation. - Abstract: Demonstration fusion reactors (DEMO) are being envisaged to be able to produce commercial electrical power. The design of the DEMO magnets and of the constituting conductors is a crucial issue in the overall engineering design of such a large fusion machine. In the frame of the EU roadmap of the so-called fast track approach, mechanical studies of preliminary DEMO toroidal field (TF) coil system conceptual designs are being enforced. The magnetic field load acting on the DEMO TF coil conductor has to be evaluated as input in the FEM model mesh, in order to evaluate the stresses on the mechanical structure. To gain flexibility, a novel approach based on the meshless method of radial basis functions (RBF) has been implemented. The present paper describes this original and flexible approach for the generation and mapping of magnetic load on DEMO TF coil system.

  16. Recent ASDEX Upgrade research in support of ITER and DEMO

    H. Zohmthe ASDEX Upgrade Team; the EUROfusion MST1 Team

    2015-10-01

    Recent experiments on the ASDEX Upgrade tokamak aim at improving the physics base for ITER and DEMO to aid the machine design and prepare efficient operation. Type I edge localized mode (ELM) mitigation using resonant magnetic perturbations (RMPs) has been shown at low pedestal collisionality (νped\\ast PLH occurs indicates that ITER could take advantage of it to initiate H-mode at lower density than that of the final Q = 10 operational point. Core density fluctuation measurements resolved in radius and wave number show that an increase of R/LTe introduced by off-axis electron cyclotron resonance heating (ECRH) mainly increases the large scale fluctuations. The radial variation of the fluctuation level is in agreement with simulations using the GENE code. Fast particles are shown to undergo classical slowing down in the absence of large scale magnetohydrodynamic (MHD) events and for low heating power, but show signs of anomalous radial redistribution at large heating power, consistent with a broadened off-axis neutral beam current drive current profile under these conditions. Neoclassical tearing mode (NTM) suppression experiments using electron cyclotron current drive (ECCD) with feedback controlled deposition have allowed to test several control strategies for ITER, including automated control of (3,2) and (2,1) NTMs during a single discharge. Disruption mitigation studies using massive gas injection (MGI) can show an increased fuelling efficiency with high field side injection, but a saturation of the fuelling efficiency is observed at high injected mass as needed for runaway electron suppression. Large locked modes can significantly decrease the fuelling efficiency and increase the asymmetry of radiated power during MGI mitigation. Concerning power exhaust, the partially detached ITER divertor scenario has been demonstrated at Psep/R = 10 MW m-1 in ASDEX Upgrade, with a peak time averaged target load around 5 MW m-2, well consistent with the component limits

  17. Tritium production assessment for the DCLL EUROfusion DEMO

    Palermo, Iole; Rapisarda, David; Fernández-Berceruelo, Iván; Ibarra, Angel

    2016-10-01

    The viability of a fusion reactor is preeminently conditioned by the tritium self-sufficiency. An assessment of different parameters representing the tritium production, as the tritium breeding ratio (TBR), the tritium production rate (TPR) density and their poloidal and radial variations along the PbLi breeder zones has been performed for the last DCLL DEMO designs developed in the frame of the EUROfusion Programme. The final overall value of 1.104 obtained allows accomplishing the fuel self-sufficiency requirement. This TBR value includes not only the contribution of the breeding blanket (BB) modules but also of the back supporting structure (BSS). The BSS design resulted fundamental to reach the 1.1 criterion. Lastly, the influence of the integration in the reactor of the heating and current drive (H&CD) systems that will penetrate the breeder volume has been evaluated. Assuming different configurations for them, the TBR loss has been determined. All the calculations have entailed the use of the particle transport Monte Carlo code MCNP5.

  18. Scoping Studies for NBI Launch Geometries on DEMO

    Jenkins, I; Keeling, D L; Surrey, E

    2014-01-01

    Scans of Neutral Beam Injection (NBI) tangency radii and elevation on two possible DEMO scenarios have been performed with two beam energies, 1.5MeV and 1.0MeV, in order to determine the most favourable options for Neutral Beam Current Drive (NBCD) efficiency. In addition, a method using a genetic algorithm has been used to seek optimised solutions of NBI source locations and powers to synthesize a target total plasma driven-current profile. It is found that certain beam trajectories may be proscribed by limitations on shinethrough onto the vessel wall. This may affect the ability of NBCD to extend the duration of a pulse in a scenario where it must complement the induced plasma current. Operating at the lower beam energy reduces the restrictions due to shinethrough and is attractive for technical reasons, but in the scenarios examined here this results in a spatial broadening of the NBCD profile, which may make it more challenging to achieve desired total driven-current profiles.

  19. Pre-conceptual design assessment of DEMO remote maintenance

    Loving, A., E-mail: antony.loving@ccfe.ac.uk [EURATOM/Culham Center Fusion Energy, Culham Science Centre, OX14 3DB, Abingdon (United Kingdom); Crofts, O.; Sykes, N.; Iglesias, D.; Coleman, M.; Thomas, J. [EURATOM/Culham Center Fusion Energy, Culham Science Centre, OX14 3DB, Abingdon (United Kingdom); Harman, J. [EFDA Close Support Unit Garching, Boltzmannstaße 2, D-85748 Garching Bei München (Germany); Fischer, U. [Karlsruhe Institute of Technology, Institute for Neutron Physics and Reactor Technology, Hermann-von-Helmholtz-Platz 1, D-76344 Eggenstein-Leopoldshafen (Germany); Sanz, J. [Instituto de Fusión Nuclear/UPM, Madrid (Spain); Siuko, M. [VTT Technical Research Centre of Finland, P.O. Box 1000, FI-02044 VTT (Finland); Mittwollen, M. [Karlsruhe Institute of Technology, Institut für Fördertechnik und Logistiksysteme, Gotthard-Franz-Straße 8, Geb.50.38, 76131 Karlsruhe (Germany)

    2014-10-15

    EDFA, as part of the Power Plant Physics and Technology programme, has been working on the pre-conceptual design of a Demonstration Power Plant (DEMO). As part of this programme, a review of the remote maintenance strategy considered maintenance solutions compatible with expected environmental conditions, whilst showing potential for meeting the plant availability targets. A key finding was that, for practical purposes, the expected radiation levels prohibit the use of complex remote handling operations to replace the first wall. In 2012/2013, these remote maintenance activities were further extended, providing an insight into the requirements, constraints and challenges. In particular, the assessment of blanket and divertor maintenance, in light of the expected radiation conditions and availability, has elaborated the need for a very different approach from that of ITER. This activity has produced some very informative virtual reality simulations of the blanket segments and pipe removal that are exceptionally valuable in communicating the complexity and scale of the required operations. Through these simulations, estimates of the maintenance task durations have been possible demonstrating that a full replacement of the blankets within 6 months could be achieved. The design of the first wall, including the need to use sacrificial limiters must still be investigated. In support of the maintenance operations, a first indication of the requirements of an Active Maintenance Facility (AMF) has been elaborated.

  20. UAS-NAS Project Demo - Mini HITL Week 2 Stats

    Murphy, James R.; Fern, Lisa C.; Rorie, Robert C.; Shively, Robert; Jovic, Srboljub

    2016-01-01

    The UAS-NAS Project demo will showcase recent research efforts to ensure the interoperability between proposed UAS detect and avoid (DAA) human machine interface requirements (developed within RTCA SC-228) and existing collision avoidance displays. Attendees will be able to view the current state of the art of the DAA pilot traffic, alerting and guidance displays integrated with Traffic advisory and Collision Avoidance (TCAS) II in the UAS-NAS Project's research UAS ground control station (developed in partnership with the Air Force Research Laboratory). In addition, attendees will have the opportunity to interact with the research UAS ground control station and "fly" encounters, using the DAA and TCAS II displays to avoid simulated aircraft. The display of the advisories will be hosted on a laptop with an external 30" monitor, running the Vigilant Spirit system. DAA advisories will be generated by the JADEM software tool, connected to the system via the LVC Gateway. A repeater of the primary flight display will be shown on a 55" monitor mounted on a stand at the back of the booth to show the pilot interaction to the passersby.

  1. Conceptual design of the beam source for the DEMO Neutral Beam Injectors

    Sonato, P.; Agostinetti, P.; Fantz, U.; Franke, T.; Furno, I.; Simonin, A.; Tran, M. Q.

    2016-12-01

    DEMO (DEMOnstration Fusion Power Plant) is a proposed nuclear fusion power plant that is intended to follow the ITER experimental reactor. The main goal of DEMO will be to demonstrate the possibility to produce electric energy from the fusion reaction. The injection of high energy neutral beams is one of the main tools to heat the plasma up to fusion conditions. A conceptual design of the Neutral Beam Injector (NBI) for the DEMO fusion reactor, is currently being developed by Consorzio RFX in collaboration with other European research institutes. High efficiency and low recirculating power, which are fundamental requirements for the success of DEMO, have been taken into special consideration for the DEMO NBI. Moreover, particular attention has been paid to the issues related to reliability, availability, maintainability and inspectability. A conceptual design of the beam source for the DEMO NBI is here presented featuring 20 sub-sources (two adjacent columns of 10 sub-sources each), following a modular design concept, with each sub-source featuring its radio frequency driver, capable of increasing the reliability and availability of the DEMO NBI. Copper grids with increasing size of the apertures have been adopted in the accelerator, with three main layouts of the apertures (circular apertures, slotted apertures and frame-like apertures for each sub-source). This design, permitting to significantly decrease the stripping losses in the accelerator without spoiling the beam optics, has been investigated with a self-consistent model able to study at the same time the magnetic field, the electrostatic field and the trajectory of the negative ions. Moreover, the status on the R&D carried out in Europe on the ion sources is presented.

  2. Safety studies on Korean fusion DEMO plant using integrated safety assessment methodology

    Oh, Kyemin; Kang, Myoung-suk [Kyung Hee University, Youngin-si, Gyeonggi-do 446-701 (Korea, Republic of); Heo, Gyunyoung, E-mail: gheo@khu.ac.kr [Kyung Hee University, Youngin-si, Gyeonggi-do 446-701 (Korea, Republic of); Kim, Hyoung-chan [National Fusion Research Institute, Daejeon-si 305-333 (Korea, Republic of)

    2014-10-15

    Highlights: •The purpose of this paper is to suggest methodology that can investigate safety issues and provides a case study for Korean fusion DEMO plant. •The concepts of integrated safety assessment methodology (ISAM) that can be applied in addressing regulatory requirements and recognizing safety issues for K-DEMO were emphasized. •Phenomena identification and ranking table (PIRT) was proposed. It can recognize vulnerabilities of systems and identify the gaps in technical areas requiring additional researches. •This work is expected to contribute on the conceptual design of safety features for K-DEMO to design engineers and the guidance for regulatory requirements to licensers. -- Abstract: The purpose of this paper is to suggest methodology that can investigate safety issues and provides a case study for Korean fusion DEMO plant (K-DEMO) as a part of R and D program through the National Fusion Research Institute of Korea. Even though nuclear regulation and licensing framework is well setup due to the operating and design experience of Pressurized Water Reactors (PWRs) since 1970s, the regulatory authority of South Korea has concerns on the challenge of facing new nuclear facilities including K-DEMO due to the differences in systems, materials, and inherent safety feature from conventional PWRs. Even though the follow-up of the ITER license process facilitates to deal with significant safety issues of fusion facilities, a licensee as well as a licenser should identify the gaps between ITER and DEMO in terms of safety issues. First we reviewed the methods of conducting safety analysis for unprecedented nuclear facilities such as Generation IV reactors, particularly very high temperature reactor (VHTR), which is called as integrated safety assessment methodology (ISAM). Second, the analysis for the conceptual design of K-DEMO on the basis of ISAM was conducted. The ISAM consists of five analytical tools to develop the safety requirements from licensee

  3. Proposal of the confinement strategy of radioactive and hazardous materials for the European DEMO

    Jin, X. Z.; Carloni, D.; Stieglitz, R.; Ciattaglia, S.; Johnston, J.; Taylor, N.

    2017-04-01

    Confinement of radioactive and hazardous materials is one of the fundamental safety functions in a nuclear fusion facility, which has to limit the mobilisation and dispersion of sources and hazards during normal, abnormal and accidental situations. In a first step energy sources and radioactive source have been assessed for a conceptual DEMO configuration. The confinement study for the European DEMO has been investigated for the main systems at the plant breakdown structure (PBS) level 1 taking a bottom-up approach. Based on the identification of the systems possessing a confinement function, a confinement strategy has been proposed, in which DEMO confinement systems and barriers have been defined. In addition, confinement for the maintenance has been issued as well. The assignment of confinement barriers to the identified sources under abnormal and accidental conditions has been performed, and the DEMO main safety systems have been proposed as well. Finally, confinement related open issues have been pointed out, which need to be resolved in parallel with DEMO development.

  4. Design concept of K-DEMO for near-term implementation

    Kim, K.; Im, K.; Kim, H. C.; Oh, S.; Park, J. S.; Kwon, S.; Lee, Y. S.; Yeom, J. H.; Lee, C.; Lee, G.-S.; Neilson, G.; Kessel, C.; Brown, T.; Titus, P.; Mikkelsen, D.; Zhai, Y.

    2015-05-01

    A Korean fusion energy development promotion law (FEDPL) was enacted in 2007. As a following step, a conceptual design study for a steady-state Korean fusion demonstration reactor (K-DEMO) was initiated in 2012. After the thorough 0D system analysis, the parameters of the main machine characterized by the major and minor radii of 6.8 and 2.1 m, respectively, were chosen for further study. The analyses of heating and current drives were performed for the development of the plasma operation scenarios. Preliminary results on lower hybrid and neutral beam current drive are included herein. A high performance Nb3Sn-based superconducting conductor is adopted, providing a peak magnetic field approaching 16 T with the magnetic field at the plasma centre above 7 T. Pressurized water is the prominent choice for the main coolant of K-DEMO when the balance of plant development details is considered. The blanket system adopts a ceramic pebble type breeder. Considering plasma performance, a double-null divertor is the reference configuration choice of K-DEMO. For a high availability operation, K-DEMO incorporates a design with vertical maintenance. A design concept for K-DEMO is presented together with the preliminary design parameters.

  5. Remote handling assessment of attachment concepts for DEMO blanket segments

    Iglesias, Daniel, E-mail: daniel.iglesias@ccfe.ac.uk [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Bastow, Roger; Cooper, Dave; Crowe, Robert; Middleton-Gear, Dave [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Sibois, Romain [VTT, Technical Research Centre of Finland, Industrial Systems, ROViR, Tampere (Finland); Carloni, Dario [Institute of Neutron Physics and Reactor Technology, Karlsruhe Institute of Technology (KIT) (Germany); Vizvary, Zsolt; Crofts, Oliver [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom); Harman, Jon [EFDA Close Support Unit Garching, Boltzmannstaße 2, D-85748 Garching bei München (Germany); Loving, Antony [CCFE, Culham Science Centre, Abingdon, Oxon OX14 3DB (United Kingdom)

    2015-10-15

    Highlights: • Challenges are identified for the remote handling of blanket segments’ attachments. • Two attachment design approaches are assessed for remote handling (RH) feasibility. • An alternative is proposed, which potentially simplifies and speeds-up RH operations. • Up to three different assemblies are proposed for the remote handling of the attachments. • Proposed integrated design of upper port is compatible with the attachment systems. - Abstract: The replacement strategy of the massive Multi-Module Blanket Segments (MMS) is a key driver in the design of several DEMO systems. These include the blankets themselves, the vacuum vessel (VV) and its ports and the Remote Maintenance System (RMS). Common challenges to any blanket attachment system have been identified, such as the need for applying a preload to the MMS manifold, the effects of the decay heat and several uncertainties related to permanent deformations when removing the blanket segments after service. The WP12 kinematics of the MMS in-vessel transportation was adapted to the requirements of each of the supports during 2013 and 2014 design activities. The RM equipment envisaged for handling attachments and earth connections may be composed of up to three different assemblies. An In-Vessel Mover at the divertor level handles the lower support and earth bonding, and could stabilize the MMS during transportation. A Shield Plug crane with a 6 DoF manipulator operates the upper attachment and earth straps. And a Vertical Maintenance Crane is responsible for the in-vessel MMS transportation and can handle the removable upper support pins. A final proposal is presented which can potentially reduce the number of required systems, at the same time that speeds-up the RMS global operations.

  6. Tritium Cycle Design for He-cooled Blankets for Demo

    Sedano, L. A.

    2007-09-27

    Final goal of COMPU task is to develop a reliable tritium Process Flow Diagram (PFD) modelling tool for DEMO tritium cycle. With this aim, the COMPU task is devoted to: (1) Review of existing available documentation related on configuration layouts, and systems and tritium control process key technologies. (2) To select those validated and considered relevant as basis for code development. (3) Implement results from (1), and (2) in the PFD TRICICLO. This fi rst deliverable focuses on item (1) and is conceived as a managerial tool to: (1) establish and discuss the correct inputs, (2) to identify existing lack of basic information and (3) to establish the general demands and characteristics for the development of an advanced PFD model. Thus, in order to discuss and determine the basic information required for future new developments of the task, this report presents a review of the documentation of: (1) The outline of total cycle and system configuration with the main tritium system design specifications. (2) The ultimate processing technologies with the associated design of their implementing units. (3) Key parameters needed to describe processes and modes of operation of the system units. (4) An overview of the existing models for cycle and units with a general analysis of their performances and limitations. Thus, this report is a direct review of the base information generated previously in the context of tasks of the EU FT Programmers (reported in EFDA Green Books) and available results in open fields literature provided by parallel Programmes abroad (JP, US, RF). (Author) 102 refs.

  7. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  8. Research at ITER towards DEMO: Specific reactor diagnostic studies to be carried out on ITER

    Krasilnikov, A. V.; Kaschuck, Y. A.; Vershkov, V. A.; Petrov, A. A.; Petrov, V. G.; Tugarinov, S. N.

    2014-08-01

    In ITER diagnostics will operate in the very hard radiation environment of fusion reactor. Extensive technology studies are carried out during development of the ITER diagnostics and procedures of their calibration and remote handling. Results of these studies and practical application of the developed diagnostics on ITER will provide the direct input to DEMO diagnostic development. The list of DEMO measurement requirements and diagnostics will be determined during ITER experiments on the bases of ITER plasma physics results and success of particular diagnostic application in reactor-like ITER plasma. Majority of ITER diagnostic already passed the conceptual design phase and represent the state of the art in fusion plasma diagnostic development. The number of related to DEMO results of ITER diagnostic studies such as design and prototype manufacture of: neutron and γ-ray diagnostics, neutral particle analyzers, optical spectroscopy including first mirror protection and cleaning technics, reflectometry, refractometry, tritium retention measurements etc. are discussed.

  9. Research at ITER towards DEMO: Specific reactor diagnostic studies to be carried out on ITER

    Krasilnikov, A. V.; Kaschuck, Y. A.; Vershkov, V. A.; Petrov, A. A.; Petrov, V. G.; Tugarinov, S. N. [Institution Project center ITER, Moscow (Russian Federation)

    2014-08-21

    In ITER diagnostics will operate in the very hard radiation environment of fusion reactor. Extensive technology studies are carried out during development of the ITER diagnostics and procedures of their calibration and remote handling. Results of these studies and practical application of the developed diagnostics on ITER will provide the direct input to DEMO diagnostic development. The list of DEMO measurement requirements and diagnostics will be determined during ITER experiments on the bases of ITER plasma physics results and success of particular diagnostic application in reactor-like ITER plasma. Majority of ITER diagnostic already passed the conceptual design phase and represent the state of the art in fusion plasma diagnostic development. The number of related to DEMO results of ITER diagnostic studies such as design and prototype manufacture of: neutron and γ–ray diagnostics, neutral particle analyzers, optical spectroscopy including first mirror protection and cleaning technics, reflectometry, refractometry, tritium retention measurements etc. are discussed.

  10. Progress in the RAMI analysis of a conceptual LHCD system for DEMO

    Mirizzi, F. [Associazione EURATOM-ENEA sulla Fusione, Consorzio CREATE, Università degli Studi di Napoli Federico II, Via Claudio 21, 80125, Napoli (Italy)

    2014-02-12

    Reliability, Availability, Maintainability and Inspectability (RAMI) concepts and techniques, that acquired great importance during the first manned space missions, have been progressively extended to industrial, scientific and consumer equipments to assure them satisfactory performances and lifetimes. In the design of experimental facilities, like tokamaks, mainly aimed at demonstrating validity and feasibility of scientific theories, RAMI analysis has been often left aside. DEMO, the future prototype fusion reactors, will be instead designed for steadily delivering electrical energy to commercial grids, so that the RAMI aspects will assume an absolute relevance since their initial design phases. A preliminary RAMI analysis of the LHCD system for the conceptual EU DEMO reactor is given in the paper.

  11. Progress in the RAMI analysis of a conceptual LHCD system for DEMO

    Mirizzi, F.

    2014-02-01

    Reliability, Availability, Maintainability and Inspectability (RAMI) concepts and techniques, that acquired great importance during the first manned space missions, have been progressively extended to industrial, scientific and consumer equipments to assure them satisfactory performances and lifetimes. In the design of experimental facilities, like tokamaks, mainly aimed at demonstrating validity and feasibility of scientific theories, RAMI analysis has been often left aside. DEMO, the future prototype fusion reactors, will be instead designed for steadily delivering electrical energy to commercial grids, so that the RAMI aspects will assume an absolute relevance since their initial design phases. A preliminary RAMI analysis of the LHCD system for the conceptual EU DEMO reactor is given in the paper.

  12. Breeding blanket design for ITER and prototype (DEMO) fusion reactors and breeding materials issues

    Takatsu, H.; Enoeda, M. [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1998-03-01

    Current status of the designs of the ITER breeding blanket and DEMO blankets is introduced placing emphasis on the breeding materials selection and related issues. The former design is based on the up-to-date design activities, as of October 1997, being performed jointly by Joint Central Team (JCT) and Home Teams (HT`s), while the latter is based on the DEMO blanket test module designs being proposed by each Party at the TBWG (Test Blanket Working Group) meetings. (J.P.N.)

  13. Divertor remote handling for DEMO: Concept design and preliminary FMECA studies

    Carfora, D., E-mail: dario.carfora@gmail.com [VTT Technical Research Centre of Finland, P.O. Box 1300, FI-33101 Tampere (Finland); Tampere University of Technology, Korkeakoulunkatu 6, 33720 Tampere (Finland); ENEA/CREATE/Università degli studi Napoli Federico II, 80125 Napoli (Italy); Di Gironimo, G. [ENEA/CREATE/Università degli studi Napoli Federico II, 80125 Napoli (Italy); Järvenpää, J. [VTT Technical Research Centre of Finland, P.O. Box 1300, FI-33101 Tampere (Finland); Huhtala, K. [Tampere University of Technology, Korkeakoulunkatu 6, 33720 Tampere (Finland); Määttä, T.; Siuko, M. [VTT Technical Research Centre of Finland, P.O. Box 1300, FI-33101 Tampere (Finland)

    2015-10-15

    Highlights: • Concept design of the RH system for the DEMO fusion power plant. • Divertor mover: hydraulic telescopic boom concept design. • An alternative solution to ITER rack and pinion divertor mover (CMM). • Divertor cassettes end effector studies. • FMECA studies started on the DEMO divertor mover. - Abstract: The paper describes a concept design of a remote handling (RH) system for replacing divertor cassettes and cooling pipes in future DEMO fusion power plant. In DEMO reactor design important considerations are the reactor availability and reliable maintenance operations. The proposed divertor mover is a hydraulic telescopic boom driven from the transportation cask through the maintenance tunnel of the reactor. The boom is divided in three sections and it is driving an end-effector in order to perform the scheduled operations of maintenance inside the vacuum vessel. Two alternative designs of the end effector to grip and manipulate the divertor cassette are presented in this work. Both concepts are hydraulically actuated, based on ITER previous studies. The divertor cassette end-effector consists of a lifting arm linked to the divertor mover, a tilting plate, a cantilever arm and a hook-plate. Taking advantage of the ITER RH background and experience, the proposed hydraulic RH system is compared with the rack and pinion system currently designed for ITER and is an object of simulations at Divertor Test Platform (DTP2) in VTT's Labs of Tampere, Finland. Pros and cons will be put in evidence.

  14. Attachment system for helium-cooled blanket of RF DEMO fusion reactor

    Leshukov, A. E-mail: leshu@entek.ru; Blinov, Y.; Kovalenko, V.; Shatalov, G.; Strebkov, Y.; Strizhov, A

    2002-11-01

    The development of DEMO thermonuclear reactor is a part of Russian national program on the fusion process mastering. The DEMO-S (stationary thermonuclear reactor) should be the logic continuation of the ITER-type projects (pulse thermonuclear reactors) and the prototype for commercial power plants. DEMO reactor layout suggests to use the segmented blanket with mounting/dismounting procedure through the vacuum vessel vertical ports. Taking into account this layout the blanket attachment system has been developed and the present paper is devoted to this subject. The considered attachment system includes the lower and upper toroidal support assemblies which connect all the blanket segments in the enclosed ring. In it's turn the lower support assemblies attached to the vacuum vessel through the system of hinged support pillars. The heights of support pillars for inboard and outboard blankets are selected so that to indemnify the blanket massif thermal expansions in vertical and radial directions. The support pillars have been calculated on strength taking into account the electromagnetic loads from the plasma disruptions and blanket mass. The selection of high-strength chromium steel as a structural material for the support pillars could be considered as the results of strength analysis. The conclusions on the possibility to apply this attachment system for fusion reactor blanket and the critical issues are contained in this paper too.

  15. Overview of physics results from MAST towards ITER/DEMO and the MAST Upgrade

    Meyer, H.; Abel, I. G.; Akers, R. J.; Allan, A.; Allan, S. Y.; Appel, L. C.; Asunta, O.; Barnes, M.; Barratt, N. C.; N. Ben Ayed,; Bradley, J. W.; Canik, J.; Cahyna, P.; Cecconello, M.; Challis, C. D.; Chapman, I.T.; Ciric, D.; Colyer, G.; Conway, N. J.; Cox, M.; Crowley, B. J.; Cowley, S. C.; Cunningham, G.; Danilov, A.; Darke, A.; de Bock, M. F. M.; De Temmerman, G.; Dendy, R. O.; Denner, P.; Dickinson, D.; Dnestrovskij, A. Y.; Dnestrovsky, Y.; Driscoll, M. D.; Dudson, B.; Dunai, D.; Dunstan, M.; Dura, P.; Elmore, S.; Field, A. R.; Fishpool, G.; Freethy, S.; Fundamenski, W.; Garzotti, L.; Ghim, Y. C.; Gibson, K. J.; Gryaznevich, M. P.; Harrison, J.; E. Havlíčková,; Hawkes, N. C.; Heidbrink, W. W.; Hender, T. C.; Highcock, E.; Higgins, D.; Hill, P.; Hnat, B.; Hole, M. J.; J. Horáček,; Howell, D. F.; Imada, K.; Jones, O.; Kaveeva, E.; Keeling, D.; Kirk, A.; M. Kočan,; Lake, R. J.; Lehnen, M.; Leggate, H. J.; Liang, Y.; Lilley, M. K.; Lisgo, S. W.; Liu, Y. Q.; Lloyd, B.; Maddison, G. P.; Mailloux, J.; Martin, R.; McArdle, G. J.; McClements, K. G.; McMillan, B.; Michael, C.; Militello, F.; Molchanov, P.; Mordijck, S.; Morgan, T.; Morris, A. W.; Muir, D. G.; Nardon, E.; Naulin, V.; Naylor, G.; Nielsen, A. H.; O' Brien, M. R.; O' Gorman, T.; Pamela, S.; Parra, F. I.; Patel, A.; Pinches, S. D.; Price, M. N.; Roach, C. M.; Robinson, J. R.; Romanelli, M.; Rozhansky, V.; Saarelma, S.; Sangaroon, S.; Saveliev, A.; Scannell, R.; Seidl, J.; Sharapov, S. E.; Schekochihin, A. A.; Shevchenko, V.; Shibaev, S.; Stork, D.; Storrs, J.; Sykes, A.; Tallents, G. J.; Tamain, P.; Taylor, D.; Temple, D.; Thomas-Davies, N.; Thornton, A.; Turnyanskiy, M. R.; M. Valovič,; Vann, R. G. L.; Verwichte, E.; Voskoboynikov, P.; Voss, G.; Warder, S. E. V.; Wilson, H. R.; Wodniak, I.; Zoletnik, S.; Zagorski, R.; MAST Team,; NBI Team,

    2013-01-01

    New diagnostic, modelling and plant capability on the Mega Ampère Spherical Tokamak (MAST) have delivered important results in key areas for ITER/DEMO and the upcoming MAST Upgrade, a step towards future ST devices on the path to fusion currently under procurement. Micro-stability analysis of the pe

  16. Overview of physics results from MAST towards ITER/DEMO and the MAST Upgrade

    Meyer, H.; Abel, I.G.; Akers, R.J.

    2013-01-01

    New diagnostic, modelling and plant capability on the Mega Ampère Spherical Tokamak (MAST) have delivered important results in key areas for ITER/DEMO and the upcoming MAST Upgrade, a step towards future ST devices on the path to fusion currently under procurement. Micro-stability analysis of the...

  17. The three-dimensional easy morphological (3-DEMO classification of scoliosis, part II: repeatability

    Negrini Stefano

    2006-12-01

    Full Text Available Abstract Background In the first part of this study we proposed a new classification approach for spinal deformities (3-DEMO. To be valid, a classification needs to overcome the repeatability issue which is inherent both in the used classificatory system and in the measured object. Aim The aim of this study is to present procedures and results obtained within the repeatability of 3-DEMO classification for scoliosis analysis. Method We acquired the data of 100 pathological and 20 normal spines with an optoelectronic system (AUSCAN and of two dummies with simulated spine deformity. On the obtained 3D reconstruction of the spine, we considered the coronal view with a spinal reference system (Top View and its three related parameters, defined in part I, constituting the 3-DEMO classification. We calculated the repeatability coefficient for the subjects (two acquisitions for each subject with a time interval of 26 ± 12 sec, whereas we evaluated the system measurement error calculating the standard deviation of 50 consecutive acquisitions for each dummy. Results Comparing the results of the two types of acquisition, it emerged that the main part of parameters variability was due to postural adjustments The proportion of agreement for the 3-DEMO parameters gives a k value above 0.8; almost 10% of patients changed classification because of postural adjustments, but none had a "mirror-like" variation nor a change in more of one parameter at a time Repeatability coefficient is lower than the previously calculated normative limits. Discussion The 3-DEMO classification has a high repeatability when evaluated with an optoelectronic system such as the AUSCAN System, whose systematic error is very low. This means that the implied physiological phenomenon is consistent and overcomes the postural variability inherent in the measured object (normal or pathological subject.

  18. Design of the helium cooled lithium lead breeding blanket in CEA: from TBM to DEMO

    Aiello, G.; Aubert, J.; Forest, L.; Jaboulay, J.-C.; Li Puma, A.; Boccaccini, L. V.

    2017-04-01

    The helium cooled lithium lead (HCLL) blanket concept was originally developed in CEA at the beginning of 2000: it is one of the two European blanket concepts to be tested in ITER in the form of a test blanket module (TBM) and one of the four blanket concepts currently being considered for the DEMOnstration reactor that will follow ITER. The TBM is a highly optimized component for the ITER environment that will provide crucial information for the development of the DEMO blanket, but its design needs to be adapted to the DEMO reactor. With respect to the TBM design, reduction of the steel content in the breeding zone (BZ) is sought in order to maximize tritium breeding reactions. Different options are being studied, with the potential of reaching tritium breeding ratio (TBR) values up to 1.21. At the same time, the design of the back supporting structure (BSS), which is a DEMO specific component that has to support the blanket modules inside the vacuum vessel (VV), is ongoing with the aim of maximizing the shielding power and minimizing pumping power. This implies a re-engineering of the modules’ attachment system. Design changes however, will have an impact on the manufacturing and assembly sequences that are being developed for the HCLL-TBM. Due to the differences in joint configurations, thicknesses to be welded, heat dissipation and the various technical constraints related to the accessibility of the welding tools and implementation of non-destructive examination (NDE), the manufacturing procedure should be adapted and optimized for DEMO design. Laser welding instead of TIG could be an option to reduce distortions. The time-of-flight diffraction (TOFD) technique is being investigated for NDE. Finally, essential information expected from the HCLL-TBM program that will be needed to finalize the DEMO design is discussed.

  19. Use of the Research Vessel Savannah in Support of 2015 ONR S and T Demo, Project ID: 104458

    2016-07-26

    2015 ONR S& T Demo. Project ID: 104458 Sb. GRANT NUMBER N00014-15-1-2116 Sc. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Sd. PROJECT NUMBER Sanders...Std Z39. 18 Use of the resea rch vessel Savannah in support of 2015 ONR S& T Demo, Project ID: 104458 James G. Sanders and John B. B ichy The...following project: 1. 2015 ONR S & T Demo- Demonstrating mine warfare and airborne projects at Naval Air Station Patuxent River, Md., Dr. Robert Gibson

  20. ACS from development to operations

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  1. The RAFMS RUSFER-EK-181 as structural material for the test module DEMO

    Leonteva-Smirnova, M.V.; Chernov, V.M.; Ioltukhovsky, A.G.; Mozhanov, E.M. [Bochvar Institute of Inorganic Materials, Moscow (Russian Federation); Potapenko, M.M. [Tomsk State Univ., Institute of Strength Physics and Materials Science, SB, RAS (Russian Federation); Bulanova, T.M.; Golovanov, N. [Research Institute for Atomic Reactors, Dimitrovgrad (Russian Federation); Strebkov, Y.S. [Research and Development Institute of Power Engineering (RDIPE), Moscow (Russian Federation); Kalashnikov, A.N. [Rosatom, Moscow (Russian Federation); Kuteev, B.V. [Russian Science Center, Moscow (Russian Federation)

    2007-07-01

    Full text of publication follows: In the framework of the RF R and D activity for fusion power energy mastering and manufacturing of the test ceramic module DEMO, reduced activation ferritic-martensitic steel (RAFMS) based on Fe-12Cr-2W-V-Ta-B system (RUSFER-EK-181) is obtained. Industrial ingots of RUSFER-EK-181 steel and its modifications, articles of which (plates, rods, tube stocks, others) posses the necessary complex of physical, mechanical (short-term and long-term) and technological (welding) characteristics in a wide temperature range, have been manufactured. The factor determining high heat resistance of the steel is its structural-phase state and precipitation hardening regulated by the chemical composition and the developed regimes of thermo-mechanical treatments of the steel. Structural-phase state of the steel provides the required level of the operating characteristic of goods under the established regimes of radiation and temperature loads. Good results of heat resistance tests of the steel under the stress 80 MPa at 650 deg. C during 25000 hours have been obtained. The technologies of welding of the articles have been developed, examples of argon-arc welding joints and their structural states are given. The results on the effect of different regimes of heat treatment on the radiation properties of RUSFER-EK-181 at low irradiation temperature (fast reactor BOR-60) have been obtained. The gradient structural-phase state changing along the length of the steel article has been suggested. High level of heat resistance in the high temperature application zone of the articles is developed with use of the traditional heat treatment for ferritic-martensitic steels (normalization and tempering). New combined heat treatment including additional heat cycling of the steel near its critical point is applied for the low temperature part of the article. The structure obtained by the combined heat treatment of the steel provides higher level of its resistance to

  2. DEVELOPMENT AND ASSESSMENT OF A SCORE™ DEMO2.1 THERMO-ACOUSTIC ENGINE

    BAIMAN CHEN

    2013-04-01

    Full Text Available The early low-cost, wood burning Thermo-Acoustic Engine (TAE known as Demo2.0-build-1 was developed by SCORE™ at the UK Centre and was capable of achieving 22.7 Watts of electricity. This prototype was limited to an operating temperature of about 300oC and due to excessive leaks could not operate continuously above ambient pressure. To absorb a thermal heat input of 4.4 kW from the burning wood so as to fulfil the required acoustic power, the Hot Heat Exchanger (HHX requires heating to the highest possible temperature. Therefore, a corrugated stainless steel plate HHX design that maximises heating surface area was adopted to the current Demo2 TAE design. In addition, the system is often pressurised to achieve higher acoustic intensity. Rigorous sealing of the system at high temperature is also required. A Demo2.1 TAE design based on the Demo2 TAE design and its prototype which is developed recently by the SCORE™ Centre in Malaysia was successfully constructed and well integrated with the stove. During the early construction and assembly process, fabrication difficulties and serious leak problems around the HHX’s edges were found when the apparatus operated at high temperatures. This is because the uneven geometrical HHX (convolution profile makes it difficult and relatively costly to be sealed. The Demo2.1 TAE is focused on the sealing efficiency and effective manufacturing cost by meantime to allow further modification variation. The design was made to adopt the local manufacturing technologies and materials available or easy to access in Malaysia. It also aims to minimise the parasitic heat losses to lower the system onset temperature. By removing the Linear Alternator and Tuning Volume from the system, preliminary measurements shown that the apparatus was oscillating at the frequency of 70 Hz. A much lower onset temperature was observed at around 144oC for the new configuration when the apparatus was oscillating at approximately 200 Pa

  3. DemoEnvironment国际合作项目的实践经验与思考%Practice and thinking of DemoEnvironment international cooperation project

    李兵; 李超; 程言君

    2013-01-01

    @@%通过对Biogas Optimizer in China项目管理模式、运行方式和执行经验进行分析,系统总结了瑞典国际开发署(Sida)发起的DemoEnvironment计划的项目管理特点,以期对我国技术示范项目的管理和国际合作项目的申请和执行有所帮助.

  4. Overview on ITER and DEMO blanket fabrication activities of the KIT INR and related frameworks

    Neuberger, Heiko, E-mail: heiko.neuberger@kit.edu [Karlsruhe Institute of Technology (KIT), Institute for Neutron Physics and Reactor Technology, Karlsruhe (Germany); Rey, Joerg; Weth, Axel von der; Hernandez, Francisco [Karlsruhe Institute of Technology (KIT), Institute for Neutron Physics and Reactor Technology, Karlsruhe (Germany); Martin, Tatiana [Karlsruhe Institute of Technology (KIT), Institute for Applied materials, Karlsruhe (Germany); Zmitko, Milan [Fusion for energy, ITER Department, Test Blanket Modules and Materials Development Project Team, Barcelona (Spain); Felde, Alexander [Institut für Umformtechnik (IFU), Universität Stuttgart (Germany); Niewöhner, Reinhard [Forschungsgesellschaft Umformtechnik (FGU), Stuttgart (Germany); Krüger, Friedhelm [Krüger Erodiertechnik, Biedenkopf (Germany)

    2015-10-15

    Highlights: • Recent achievements in fabricaition within different frameworks. • First Wall mockup with erosion technology. • Manufacturing of a HCPB TBM Cooling Plate Mockup (F4E) - Abstract: Fabrication experiments have been carried out in the KIT with the goal to qualify manufacturing technologies for the realization of fusion reactor components. The main focus of the activities managed by the fabrication team in the Institute of Neutron Physics and reactor technologies (INR) has been on the Test Blanket Module for ITER. Sets of fabrication and welding procedure specifications have been demonstrated and qualified in relevant scale for TBM structural and functional components. This paper presents interactions in between the different frameworks on domestic and European level to underline backgrounds of developments. It also summarizes results of development and their relevancy for DEMO and gives an outlook on the future development strategy for the DEMO blanket fabrication.

  5. Effect on the tritium breeding ratio for a distributed ICRF antenna in a DEMO reactor

    Garcia, A.; Noterdaeme, J.-M.; Fischer, U.; Dies, J.

    2015-12-01

    The paper reports results of MCNP-5 calculations to assess the effect on the Tritium Breeding Ratio (TBR) when integrating a distributed Ion Cyclotron Range of Frequencies (ICRF) antenna in the blanket of DEMO fusion power reactor. The calculations consider different parameters such as the ICRF covering ratio and the type of breeding blanket including the Helium Cooled Pebble Bed (HCPB) and the Helium Cooled Lithium Lead (HCLL) concepts. For an antenna with a full toroidal circumference of 360°, located poloidally at 40° with a poloidal extension of 1 m, the reduction of the TBR is -0.349% for the HCPB blanket and -0.532% for the HCLL blanket. The distributed ICRF antenna is thus shown to have only a marginal effect on the TBR of the DEMO reactor.

  6. A high frequency, high power CARM proposal for the DEMO ECRH system

    Mirizzi, Francesco, E-mail: francesco.mirizzi@enea.it [Consorzio CREATE, Via Claudio 21, I-80125 Napoli (Italy); Spassovsky, Ivan [Unità Tecnica Applicazioni delle Radiazioni – ENEA, C.R. Frascati, via E. Fermi 45, I-00044 Frascati (Italy); Ceccuzzi, Silvio [Unità Tecnica Fusione – ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati, Roma (Italy); Dattoli, Giuseppe; Di Palma, Emanuele; Doria, Andrea; Gallerano, Gianpiero [Unità Tecnica Applicazioni delle Radiazioni – ENEA, C.R. Frascati, via E. Fermi 45, I-00044 Frascati (Italy); Lampasi, Alessandro; Maffia, Giuseppe; Ravera, GianLuca [Unità Tecnica Fusione – ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati, Roma (Italy); Sabia, Elio [Unità Tecnica Applicazioni delle Radiazioni – ENEA, C.R. Frascati, via E. Fermi 45, I-00044 Frascati (Italy); Tuccillo, Angelo Antonio; Zito, Pietro [Unità Tecnica Fusione – ENEA C. R. Frascati, via E. Fermi 45, 00044 Frascati, Roma (Italy)

    2015-10-15

    Highlights: • ECRH system for DEMO. • Cyclotron Auto-Resonance Maser (CARM) devices. • Relativistic electron beams. • Bragg reflectors. • High voltage pulse modulators. - Abstract: ECRH&CD systems are extensively used on tokamak plasmas due to their capability of highly tailored power deposition, allowing very localised heating and non-inductive current drive, useful for MHD and profiles control. The high electron temperatures expected in DEMO will require ECRH systems with operating frequency in the 200–300 GHz range, equipped with a reasonable number of high power (P ≥ 1 MW) CW RF sources, for allowing central RF power deposition. In this frame the ENEA Fusion Department (Frascati) is coordinating a task force aimed at the study and realisation of a suitable high power, high frequency reliable source.

  7. Potential of ion cyclotron resonance frequency current drive via fast waves in DEMO

    Kazakov, Ye O.; Van Eester, D.; Wauters, T.; Lerche, E.; Ongena, J.

    2015-02-01

    For the continuous operation of future tokamak-reactors like DEMO, non-inductively driven toroidal plasma current is needed. Bootstrap current, due to the pressure gradient, and current driven by auxiliary heating systems are currently considered as the two main options. This paper addresses the current drive (CD) potential of the ion cyclotron resonance frequency (ICRF) heating system in DEMO-like plasmas. Fast wave CD scenarios are evaluated for both the standard midplane launch and an alternative case of exciting the waves from the top of the machine. Optimal ICRF frequencies and parallel wave numbers are identified to maximize the CD efficiency. Limitations of the high frequency ICRF CD operation are discussed. A simplified analytical method to estimate the fast wave CD efficiency is presented, complemented with the discussion of its dependencies on plasma parameters. The calculated CD efficiency for the ICRF system is shown to be similar to those for the negative neutral beam injection and electron cyclotron resonance heating.

  8. Effect on the tritium breeding ratio for a distributed ICRF antenna in a DEMO reactor

    Garcia, A., E-mail: albert.garcia.hp@gmail.com [Max-Planck-Institut für Plasmaphysik (IPP), Garching (Germany); Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Polytechnic University of Catalonia (UPC), Barcelona (Spain); Department of Applied Physics, Ghent University, Ghent (Belgium); Noterdaeme, J.-M. [Max-Planck-Institut für Plasmaphysik (IPP), Garching (Germany); Department of Applied Physics, Ghent University, Ghent (Belgium); Fischer, U. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Dies, J. [Polytechnic University of Catalonia (UPC), Barcelona (Spain)

    2015-12-10

    The paper reports results of MCNP-5 calculations to assess the effect on the Tritium Breeding Ratio (TBR) when integrating a distributed Ion Cyclotron Range of Frequencies (ICRF) antenna in the blanket of DEMO fusion power reactor. The calculations consider different parameters such as the ICRF covering ratio and the type of breeding blanket including the Helium Cooled Pebble Bed (HCPB) and the Helium Cooled Lithium Lead (HCLL) concepts. For an antenna with a full toroidal circumference of 360°, located poloidally at 40° with a poloidal extension of 1 m, the reduction of the TBR is −0.349% for the HCPB blanket and −0.532% for the HCLL blanket. The distributed ICRF antenna is thus shown to have only a marginal effect on the TBR of the DEMO reactor.

  9. Assessment of the LH wave for demo in pulsed and steady state scenario

    Cardinali, A.; Barbato, E.; Castaldo, C.; Cesario, R.; Marinucci, M.; Ravera, G. L.; Tuccillo, A. A. [Associazione Euratom-ENEA sulla Fusione, C.R. Frascati, Via Enrico Fermi, 45 00044, Frascati, Roma (Italy); Ceccuzzi, S. [Associazione Euratom-ENEA sulla Fusione, C.R. Frascati, Via Enrico Fermi, 45 00044, Frascati, Roma, Italy and Department of Engineering, Roma Tre University, Via Vito Volterra, 62, 00146, Roma (Italy); Mirizzi, F.; Panaccione, L. [Consorzio CREATE, Universita degli Studi di Napoli Federico II, Via Claudio 21, 80125, Napoli (Italy); Santini, F.; Schettini, G. [Department of Engineering, Roma Tre University, Via Vito Volterra, 62, 00146, Roma (Italy)

    2014-02-12

    The Lower Hybrid Current Drive (LHCD) has been analysed in DEMO tokamak plasma in the 'pulsed and steady state regime' considering two plasma scenarios characterized, respectively, by flat density profile and peaked density profiles. We have obtained LH deposition profiles in cases of neglecting the effect of spectral broadening produced by PI at the edge. By comparing the Power Deposition Profiles for both DEMO scenarios ('flat' and 'peaked'), the SOL of DEMO does not play any role in the absorption of the LH wave. In all cases the deposition is localized inside the separatrix layer r/a≤1. By lowering the parallel wave-number peak of the power spectrum from 1.8 to 1.5, the accessibility condition in both case prevents the power from reaching the deposition layer apart from a small fraction which pertains to the higher n∥ of the power spectrum. The spectrum centred at 1.8 is suggested to be useful in DEMO. More realistically, as supported by available data of LHCD in a wide range of operating densities, the effect of parametric decay instability (PDI) can produce a spectral broadening which should be included in the simulations. Further studies would be necessary for assessing the temperature profiles in the SOL at reactor-graded conditions. This is because, if the SOL temperature is at least of the order of 50 to 100 eV, the effect of PDI broads the spectrum up to n∥≤10, and the deposition profile is slightly wider but not much shifted outwards.

  10. Technological and physics assessments on heating and current drive systems for DEMO

    Franke, Thomas, E-mail: thomas.franke@efda.org [EFDA Close Support Unit, Boltzmannstr. 2, D-85748 Garching (Germany); Max Planck Institute for Plasma Physics, Boltzmannstr. 2, D-85748 Garching (Germany); Barbato, E. [Unità Tecnica Fusione ENEA, C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); Bosia, G. [Department of Physics, University of Turin, Via P. Giuria 1, 10125 Turin (Italy); Cardinali, A.; Ceccuzzi, S.; Cesario, R. [Unità Tecnica Fusione ENEA, C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); Van Eester, D. [Laboratory for Plasma Physics, LPP-ERM/KMS, TEC & Belgian EUROfusion Consortium Partner, Brussels (Belgium); Federici, G. [EFDA Close Support Unit, Boltzmannstr. 2, D-85748 Garching (Germany); Gantenbein, G. [Karlsruhe Institute of Technology (KIT), Association EURATOM-KIT, Kaiserstrasse 12, 76131 Karlsruhe (Germany); Helou, W.; Hillairet, J. [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Jenkins, I. [CCFE, Culham Science Centre, Abingdon OX143DB (United Kingdom); Kazakov, Ye.O. [Laboratory for Plasma Physics, LPP-ERM/KMS, TEC & Belgian EUROfusion Consortium Partner, Brussels (Belgium); Kemp, R. [CCFE, Culham Science Centre, Abingdon OX143DB (United Kingdom); Lerche, E. [Laboratory for Plasma Physics, LPP-ERM/KMS, TEC & Belgian EUROfusion Consortium Partner, Brussels (Belgium); Mirizzi, F. [Unità Tecnica Fusione ENEA, C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); Noterdaeme, J.-M.; Poli, E. [Max Planck Institute for Plasma Physics, Boltzmannstr. 2, D-85748 Garching (Germany); Porte, L. [Centre de Recherches en Physique des Plasmas, Ecole Polytechnique Fédérale de Lausanne (EPFL), Station 13, CH-1015 Lausanne (Switzerland); Ravera, G.L. [Unità Tecnica Fusione ENEA, C. R. Frascati, via E. Fermi 45, 00044 Frascati (Roma) (Italy); and others

    2015-10-15

    Highlights: • Basic physics requirements of H&CD systems in DEMO have been captured. • The four H&CD systems NBI, EC, IC and LH were analysed to optimize performance. • Novel solutions were studied to overcome the limitations of the present H&CD systems. • RAMI as well as efficiency and optimized design of H&CD systems have been assessed. • Further constraints by remote maintenance or breeding blanket interactions were considered. - Abstract: The physics requirements of the heating and current (H&CD) systems in a Demonstration Fusion Power Plant (DEMO) are often beyond the actual level of design maturity and technology readiness required. The recent EU fusion roadmap advocates a pragmatic approach and favours, for the initial design integration studies, systems to be as much as possible, extrapolated from the ITER experience. To reach the goal of demonstrating the production of electricity in DEMO with a closed fuel cycle by 2050, one must ensure reliability, availability, maintainability, inspectability (RAMI) as well as performance, efficiency and optimized design for the H&CD systems. In the recent Power Plant Physics & Technology (PPP&T) Work Programme, a number of H&CD studies were performed. The four H&CD systems Neutral Beam (NB) Injection, Electron Cyclotron (EC), Ion Cyclotron (IC) and Lower Hybrid (LH) were considered. First, a physics optimization study was made assuming all technologies are available and identifying which parameters are needed to optimize the performance for given plasma parameters. Separately, the (i) technological maturity was considered (e.g. 240 GHz gyrotrons for EC) and (ii) technologies were adapted (e.g. multi-stage depressed collector for EC) or (iii) novel solutions (e.g. photo-neutralization for NB or new antennae concepts for IC) were studied to overcome the limitations of the present H&CD systems with respect to DEMO requirements. Further constraints imposed by remote maintenance or breeding blanket interactions

  11. Physics and Engineering Assessmetns of the K-DEMO Magnet Configuration

    Neilson, George H. [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States); Brown, Thomas [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States)

    2014-09-01

    Increased attention is being given now to studies of next-step fusion facilities with nuclear missions. Among these, South Korea's K DEMO is unique in its focus on a high toroidal magnetic field, large major radius, steady-state tokamak design for the core of a facility to test fusion nuclear components in Phase I and, after upgrades, produce 500 MW of electricity in a Phase II. Innovative features of the K DEMO magnet set include the use of two toroidal field (TF) coil winding packs with conductor grading and a machine configuration designed for vertical maintenance. The magnet arrangement features large TF coils and widely spaced poloidal field (PF) coils to accommodate removal of in-vessel components as large modules. Physics and engineering assessments of the pre-conceptual K-DEMO magnet configuration are reported, including: 1) design point and operating space assessment, 2) conductor assessment, and 3) structural assessment. It is found that a reference design point at 6.8 m major radius and 7.4 T toroidal field provides sufficient operating margins for the 500 MWe Phase II mission. Analyses of candidate cable-in-conduit conductors provide predictions of critical current degradation, both in the initial load cycle and an additionally with cyclic loading. A first-pass global analysis of the magnet system found minimal out-of-plane deformations of the TF coil, but an overstress condition in the inner leg of the TF coil. However an analysis taking into account elastic-plastic behavior, frictional sliding, and displacement shows that the structure can safely carry the load. Although the design evolution is still at an early stage, these assessments support the design point choices to date and the expectation that a feasible solution for the high-field K DEMO magnet system can be found.

  12. Initial results of NEXT-DEMO, a large-scale prototype of the NEXT-100 experiment

    Álvarez, V; Cárcel, S; Castel, J; Cebrián, S; Cervera, A; Conde, C A N; Dafni, T; Dias, T H V T; Díaz, J; Egorov, M; Esteve, R; Evtoukhovitch, P; Fernandes, L M P; Ferrario, P; Ferreira, A L; Freitas, E D C; Gehman, V M; Gil, A; Goldschmidt, A; Gómez, H; Gómez-Cadenas, J J; González-Díaz, D; Gutiérrez, R M; Hauptman, J; Morata, J A Hernando; Herrera, D C; Iguaz, F J; Irastorza, I G; Jinete, M A; Labarga, L; Laing, A; Liubarsky, I; Lopes, J A M; Lorca, D; Losada, M; Luzón, G; Marí, A; Martín-Albo, J; Martínez, A; Miller, T; Moiseenko, A; Monrabal, F; Monteiro, C M B; Mora, F J; Moutinho, L M; Vidal, J Muñoz; da Luz, H Natal; Navarro, G; Nebot, M; Nygren, D; Oliveira, C A B; Palma, R; Pérez, J; Aparicio, J L Pérez; Renner, J; Ripoll, L; Rodríguez, A; Rodríguez, J; Santos, F P; Santos, J M F dos; Segui, L; Serra, L; Shuman, D; Simón, A; Sofka, C; Sorel, M; Toledo, J F; Tomás, A; Torrent, J; Tsamalaidze, Z; Vázquez, D; Veloso, J F C A; Villar, J A; Webb, R; White, J T; Yahlali, N

    2012-01-01

    NEXT-DEMO is a large scale prototype and demonstrator of the NEXT-100 High Pressure Xenon Gas TPC, which will search for the neutrinoless double beta decay of Xe-136 using 100-150 kg of enriched xenon gas. The apparatus was built to prove the expected performance of NEXT-100, namely, energy resolution better than 1% FWHM at 2.5 MeV and event topological reconstruction. In this paper we describe the operation and initial results of the detector.

  13. AC 410 AC410 AC410 Unit 7 Homework Assignment

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  14. Diseño acústico y electroacústico de Waipahu Transit Center en Honolulú, Hawái

    Sierra Carballo, Christian

    2014-01-01

    El objetivo de este Proyecto Fin de Grado es el diseño de megafonía y PAGA (Public Address /General Alarm) de la estación de tren Waipahu Transit Center en la ciudad de Honolulú, Hawái. Esta estación forma parte de una nueva línea de tren que está en proceso de construcción actualmente llamada Honolulu Rail Transit. Inicialmente la línea de tren constará de 21 estaciones, en las que prácticamente todas están diseñadas como pasos elevados usando como referencia las autopistas que cruzan la isl...

  15. Pre-conceptual design study on K-DEMO ceramic breeder blanket

    Park, Jong Sung, E-mail: jspark@nfri.re.kr [National Fusion Research Institute, Daejeon 305-333 (Korea, Republic of); Kwon, Sungjin; Im, Kihak; Kim, Keeman [National Fusion Research Institute, Daejeon 305-333 (Korea, Republic of); Brown, Thomas; Neilson, George [Princeton Plasma Physics Laboratory, Princeton, NJ 08543 (United States)

    2015-11-15

    A pre-conceptual design study has been carried out for the Korean fusion demonstration reactor (K-DEMO) tokamak featured by high magnetic field (B{sub T0} = 7.4 T), R = 6.8 m, a = 2.1 m, and a steady-state operation. The design concepts of the K-DEMO blanket system considering the cooling in-vessel components with pressurized water and a solid pebble breeder are described herein. The structure of the K-DEMO blanket is toroidally subdivided into 16 inboard and 32 outboard sectors, in order to allow the vertical maintenance. Each blanket module is composed of plasma-facing first wall, layers of breeding parts, shielding and manifolds. A ceramic breeder using Li{sub 4}SiO{sub 4} pebbles with Be{sub 12}Ti as neuron multiplier is employed for study. MCNP neutronic simulations and thermo-hydraulic analyses are interactively performed in order to satisfy two key aspects: achieving a global Tritium Breeding Ratio (TBR) >1.05 and operating within the maximum allowable temperature ranges of materials.

  16. The physics and technology basis entering European system code studies for DEMO

    Wenninger, R.; Kembleton, R.; Bachmann, C.; Biel, W.; Bolzonella, T.; Ciattaglia, S.; Cismondi, F.; Coleman, M.; Donné, A. J. H.; Eich, T.; Fable, E.; Federici, G.; Franke, T.; Lux, H.; Maviglia, F.; Meszaros, B.; Pütterich, T.; Saarelma, S.; Snickers, A.; Villone, F.; Vincenzi, P.; Wolff, D.; Zohm, H.

    2017-01-01

    A large scale program to develop a conceptual design for a demonstration fusion power plant (DEMO) has been initiated in Europe. Central elements are the baseline design points, which are developed by system codes. The assessment of the credibility of these design points is often hampered by missing information. The main physics and technology content of the central European system codes have been published (Kovari et al 2014 Fusion Eng. Des. 89 3054-69, 2016 Fusion Eng. Des. 104 9-20, Reux et al 2015 Nucl. Fusion 55 073011). In addition, this publication discusses key input parameters for the pulsed and conservative design option \\tt{EU DEMO1 2015} and provides justifications for the parameter choices. In this context several DEMO physics gaps are identified, which need to be addressed in the future to reduce the uncertainty in predicting the performance of the device. Also the sensitivities of net electric power and pulse duration to variations of the input parameters are investigated. The most extreme sensitivity is found for the elongation ( Δ {κ95}=10 % corresponds to Δ {{P}\\text{el,\\text{net}}}=125 % ).

  17. A Fusion Nuclear Science Facility for a fast-track path to DEMO

    Garofalo, A.M., E-mail: garofalo@fusion.gat.com [General Atomics, San Diego, CA (United States); Abdou, M.A. [University of California, Los Angeles, Los Angeles, CA (United States); Canik, J.M. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Chan, V.S.; Hyatt, A.W. [General Atomics, San Diego, CA (United States); Hill, D.N. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Morley, N.B. [University of California, Los Angeles, Los Angeles, CA (United States); Navratil, G.A. [Columbia University, New York, NY (United States); Sawan, M.E. [University of Wisconsin Madison, Madison, WI (United States); Taylor, T.S.; Wong, C.P.C.; Wu, W. [General Atomics, San Diego, CA (United States); Ying, A. [University of California, Los Angeles, Los Angeles, CA (United States)

    2014-10-15

    Highlights: • A FNSF is needed to reduce the knowledge gaps to a fusion DEMO and accelerate progress toward fusion energy. • FNSF will test and qualify first-wall/blanket components and materials in a DEMO-relevant fusion environment. • The Advanced Tokamak approach enables reduced size and risks, and is on a direct path to an attractive target power plant. • Near term research focus on specific tasks can enable starting FNSF construction within the next ten years. - Abstract: An accelerated fusion energy development program, a “fast-track” approach, requires proceeding with a nuclear and materials testing program in parallel with research on burning plasmas, ITER. A Fusion Nuclear Science Facility (FNSF) would address many of the key issues that need to be addressed prior to DEMO, including breeding tritium and completing the fuel cycle, qualifying nuclear materials for high fluence, developing suitable materials for the plasma-boundary interface, and demonstrating power extraction. The Advanced Tokamak (AT) is a strong candidate for an FNSF as a consequence of its mature physics base, capability to address the key issues, and the direct relevance to an attractive target power plant. The standard aspect ratio provides space for a solenoid, assuring robust plasma current initiation, and for an inboard blanket, assuring robust tritium breeding ratio (TBR) >1 for FNSF tritium self-sufficiency and building of inventory needed to start up DEMO. An example design point gives a moderate sized Cu-coil device with R/a = 2.7 m/0.77 m, κ = 2.3, B{sub T} = 5.4 T, I{sub P} = 6.6 MA, β{sub N} = 2.75, P{sub fus} = 127 MW. The modest bootstrap fraction of ƒ{sub BS} = 0.55 provides an opportunity to develop steady state with sufficient current drive for adequate control. Proceeding with a FNSF in parallel with ITER provides a strong basis to begin construction of DEMO upon the achievement of Q ∼ 10 in ITER.

  18. Materials R and D for a timely DEMO: Key findings and recommendations of the EU Roadmap Materials Assessment Group

    Stork, Derek, E-mail: derek.stork@ccfe.ac.uk [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching, 85748 Germany (Germany); Agostini, Pietro [ENEA, Brasimone Research Centre, 40032, Camugnano, Bologna (Italy); Boutard, Jean-Louis [CEA, cab HC, Saclay, F-91191, Gif-sur-Yvette (France); Buckthorpe, Derek [AMEC, Booths Park, Chelford Road, Knutsford, Cheshire, WA16 8QZ (United Kingdom); Diegele, Eberhard [Karlsruhe Institute for Technology, IMF-I, D-7602, Karlsruhe (Germany); Dudarev, Sergei L. [Euratom-CCFE Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); English, Colin [National Nuclear Laboratory, 5th Floor, Chadwick House, Warrington Road, Birchwood Park, WA3 6AE (United Kingdom); Federici, Gianfranco [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching, 85748 Germany (Germany); Gilbert, Mark R. [Euratom-CCFE Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Gonzalez, Sehila [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching, 85748 Germany (Germany); Ibarra, Angel [CIEMAT, Avda. Complutense 40, Madrid (Spain); Linsmeier, Christian [Forschungszentrum Jülich GmbH, Institut für Energie- und Klimaforschung–Plasmaphysik, EURATOM Association, 52425 Jülich (Germany); Puma, Antonella Li [CEA, DEN, Saclay, DM2S, SERMA, F-91191, Gif-sur-Yvette (France); Marbach, Gabriel [CEA, cab HC, Saclay, F-91191, Gif-sur-Yvette (France); Packer, Lee W. [Euratom-CCFE Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Raj, Baldev [Indian National Academy of Engineering, Shaheed Jeet Singh Marg, New Delhi 110016 (India); Rieth, Michael [Karlsruhe Institute for Technology, IMF-I, D-7602, Karlsruhe (Germany); Tran, Min Quang [Ecole Polytechnique Federale de Lausanne—CRPP, Association Euratom-Switzerland, 1015 Lausanne (Switzerland); and others

    2014-10-15

    The findings of the EU Fusion Programme's ‘Materials Assessment Group’ (MAG), assessing readiness of Structural, Plasma Facing (PF) and High Heat Flux (HHF) materials for DEMO, are discussed. These are incorporated into the EU Fusion Power Roadmap [1], with a decision to construct DEMO in the early 2030s. The methodology uses project-based and systems-engineering approaches, the concept of Technology Readiness Levels, and considers lessons learned from Fission reactor material development. ‘Baseline’ materials are identified for each DEMO role, and the DEMO mission risks analysed from the known limitations, or unknown properties, associated with each baseline material. R and D programmes to address these risks are developed. The DEMO assessed has a phase I with a ‘starter blanket’: the blanket must withstand ≥2 MW yr m{sup −2} fusion neutron flux (equivalent to ∼20 dpa front-wall steel damage). The baseline materials all have significant associated risks, so development of ‘Risk Mitigation Materials’ (RMM) is recommended. The R and D programme has parallel development of the baseline and RMM, up to ‘down-selection’ points to align with decisions on the DEMO blanket and divertor engineering definition. ITER licensing experience is used to refine the issues for materials nuclear testing, and arguments are developed to optimise scope of materials tests with fusion neutron (‘14 MeV’) spectra before DEMO design finalisation. Some 14 MeV testing is still essential, and the Roadmap requires deployment of a ≥30 dpa (steels) testing capability by 2026. Programme optimisation by the pre-testing with fission neutrons on isotopically- or chemically-doped steels and with ion-beams is discussed along with the minimum 14 MeV testing programme, and the key role which fundamental and mission-oriented modelling can play in orienting the research.

  19. DEMO_REP: A LABS TOOL FOR TEACHING DATA REPLICATION / DEMO_REP: HERRAMIENTA PARA LABORATORIOS EN LA ENSEÑANZA DE RÉPLICA DE DATOS

    Ileane Martí Pérez

    2013-02-01

    Full Text Available The process of training professionals in information technologies is a key aspect in the development of the country. University Informatics Science is one of the main centers dedicated to this process, also has postgraduate training programs to further advanced topics not mentioned in the pregraduate. One such program is the "DIPLOMADO EN TECNOLOGÍAS DE BASES DE DATOS POSTGRESQL," which has a number of courses to obtain expertise in the subject of databases in PostgreSQL Manager. In this paper show how affects in the understanding of the process of data replication, the use of the software tool "Demo_rep" for laboratory exercises replication. It also describes the main features of software tool.RESUMENEl proceso de formación de los profesionales en tecnologías de la informática es un aspecto clave en el desarrollo del país. La Universidad de las Ciencias Informáticas es uno de los principales centros que se dedica a este proceso, la misma consta de programas de formación postgraduada para profundizar en temas que no aparecen incluidos en los programas analíticos de las asignaturas de pregrado. Uno de estos programas es el “DIPLOMADO EN TECNOLOGÍAS DE BASES DE DATOS POSTGRESQL”, el cual cuenta con una serie de cursos para lograr experticia en la temática de las bases de datos en el gestor PostgreSQL. En el presente trabajo se muestra cómo incide en la comprensión del proceso de la replicación de datos, la utilización de una herramienta informática “Demo_rep” para realizar los ejercicios de laboratorio de réplica. Se describe además las principales funcionalidades de la misma.

  20. Optimization of the first wall for the DEMO water cooled lithium lead blanket

    Aubert, Julien, E-mail: julien.aubert@cea.fr [CEA Saclay, F-91191 Gif-Sur-Yvette (France); Aiello, Giacomo [CEA Saclay, F-91191 Gif-Sur-Yvette (France); Bachmann, Christian [EFDA, Boltzmannstraße 2, 85748 Garching (Germany); Di Maio, Pietro Alessandro [Università di Palermo, Viale delle Scienze, 90128 Palermo (Italy); Giammusso, Rosario [ENEA C.R. Brasimone, 40032 Camugnano, Bologna (Italy); Li Puma, Antonella; Morin, Alexandre [CEA Saclay, F-91191 Gif-Sur-Yvette (France); Tincani, Amelia [ENEA C.R. Brasimone, 40032 Camugnano, Bologna (Italy)

    2015-10-15

    Highlights: • This paper presents the optimization of the first wall of the water cooled lithium lead DEMO blanket with pressurized water reactor condition and circular channels in order to find the best geometry that can allow the maximum heat flux considering design criteria since an estimate of the engineering limit of the first wall heat load capacity is an essential input for the decision to implement limiters in DEMO. • An optimization study was carried out for the flat first wall design of the DEMO Water-Cooled Lithium Lead considering thermal and mechanical constraint functions, assuming T{sub inlet}/T{sub outlet} equal to 285 °C/325 °C, based on geometric design parameters. • It became clear that through the optimization the advantages of a waved First Wall are diminished. • The analysis shows that the maximum heat load could achieve 2.53 MW m{sup −2}, but considering assumptions such as a coolant velocity ≤8 m/s, pipe diameter ≥5 mm and a total first wall thickness ≤22 mm, heat flux is limited to 1.57 MW m{sup −2}. - Abstract: The maximum heat load capacity of a DEMO First Wall (FW) of reasonable cost may impact the decision of the implementation of limiters in DEMO. An estimate of the engineering limit of the FW heat load capacity is an essential input for this decision. This paper describes the work performed to optimize the FW of the Water Cooled Lithium-Lead (WCLL) blanket concept for DEMO fusion reactor in order to increase its maximum heat load capacity. The optimization is based on the use of water at typical Pressurised Water Reactors conditions as coolant. The present WCLL FW with a waved plasma-faced surface and with circular channels was studied and the heat load limit has been predicted with FEM analysis equal to 1.0 MW m{sup −2} with respect to the Eurofer temperature limit. An optimization study was then carried out for a flat FW design considering thermal and mechanical constraints assuming inlet and outlet

  1. Self-consistent modeling of DEMOs with 1.5D BALDUR integrated predictive modeling code

    Wisitsorasak, A.; Somjinda, B.; Promping, J.; Onjun, T.

    2017-02-01

    Self-consistent simulations of four DEMO designs proposed by teams from China, Europe, India, and Korea are carried out using the BALDUR integrated predictive modeling code in which theory-based models are used, for both core transport and boundary conditions. In these simulations, a combination of the NCLASS neoclassical transport and multimode (MMM95) anomalous transport model is used to compute a core transport. The boundary is taken to be at the top of the pedestal, where the pedestal values are described using a pedestal temperature model based on a combination of magnetic and flow shear stabilization, pedestal width scaling and an infinite- n ballooning pressure gradient model and a pedestal density model based on a line average density. Even though an optimistic scenario is considered, the simulation results suggest that, with the exclusion of ELMs, the fusion gain Q obtained for these reactors is pessimistic compared to their original designs, i.e. 52% for the Chinese design, 63% for the European design, 22% for the Korean design, and 26% for the Indian design. In addition, the predicted bootstrap current fractions are also found to be lower than their original designs, as fractions of their original designs, i.e. 0.49 (China), 0.66 (Europe), and 0.58 (India). Furthermore, in relation to sensitivity, it is found that increasing values of the auxiliary heating power and the electron line average density from their design values yield an enhancement of fusion performance. In addition, inclusion of sawtooth oscillation effects demonstrate positive impacts on the plasma and fusion performance in European, Indian and Korean DEMOs, but degrade the performance in the Chinese DEMO.

  2. Helical reactor design FFHR-d1 and c1 for steady-state DEMO

    Sagara, A., E-mail: sagara.akio@LHD.nifs.ac.jp; Tamura, H.; Tanaka, T.; Yanagi, N.; Miyazawa, J.; Goto, T.; Sakamoto, R.; Yagi, J.; Watanabe, T.; Takayama, S.

    2014-10-15

    Highlights: •More than 10 years’ operation is feasible using the inboard WC shield, where the total TBR is 1.18 with 90% 6Li. •The divertor targets can be efficiently shielded, expanding the range of material choice (e.g., Cu alloys). •Flinabe blanket mixed with metal powder is proposed to increase hydrogen solubility and thermal efficiency. •Helical coils by connecting segments of 100 kA-class YBCO high-temperature superconductors is proposed. •A multi-path strategy on FFHR-d1 is introduced with sub-ignition options for “before demo, compact and component-test”. -- Abstract: NIFS launched the Fusion Engineering Research Project (FERP) in preparation for DEMO by starting the redesign of the LHD-type helical reactor FFHR-d1. In the first round, the main parameters were selected. The second round is preparing detailed three-dimensional (3D) design of the superconducting magnet support structures, and 3D neutronics analyses, where the diverter targets can be efficiently shielded from fast neutrons. A new Flinabe blanket mixed with metal powder was proposed. Fabrication of helical coils by connecting half-helical-pitch segments of 100 kA-class YBCO high-temperature superconductors is proposed as a promising method. Also in progress is improvement of the first round of the core plasma design, ignition start-up analyses, and fueling scenario. As a consequence, a multi-path strategy on FFHR-d1 has been introduced with versions of -d1A, -d1B, and -d1C, where design flexibility is expanded to include subignition with options FFHR-c1 for “before demo, compact, and component-test.”.

  3. Conceptual design for the superconducting magnet system of a pulsed DEMO reactor

    Duchateau, J.-L., E-mail: jean-luc.duchateau@cea.fr [CEA/IRFM, 13108 St. Paul lez Durance Cedex (France); Hertout, P.; Saoutic, B.; Magaud, P.; Artaud, J.-F.; Giruzzi, G.; Bucalossi, J.; Johner, J.; Sardain, P.; Imbeaux, F.; Ané, J.-M.; Li-Puma, A. [CEA/IRFM, 13108 St. Paul lez Durance Cedex (France)

    2013-10-15

    Highlights: ► A 1D design approach of a pulsed DEMO reactor is presented. ► The main CS and TF conductor design criteria are presented. ► A typical major radius for a 2 GW DEMO is 9 m. ► A typical plasma magnetic field is 4.9 T. ► The pulse duration is 1.85 h for an aspect ratio of 3. -- Abstract: A methodology has been developed to consistently investigate, taking into account main reactor components, possible magnet solutions for a pulsed fusion reactor aiming at a large solenoid flux swing duration within the 2–3 h range. In a conceptual approach, investigations are carried out in the equatorial plane, taking into account the radial extension of the blanket-shielding zone, of the toroidal field magnet system inner leg and of the central solenoid for estimation of the pulsed swing. Design criteria are presented for the radial extension of the superconducting magnets, which is mostly driven by the structures (casings and conductor jacket). Typical available cable current densities are presented as a function of the magnetic field and of the temperature margin. The magnet design criteria have been integrated into SYCOMORE, a code for reactor modeling presently in development at CEA/IRFM in Cadarache, using the tools of the EFDA Integrated Tokamak Modeling task force. Possible solutions are investigated for a 2 GW fusion power reactor with different aspect ratios. The final adjustment of the DEMO pulsed reactor parameters will have to be consistently done, considering all reactor components, when the final goals of the machine will be completely clarified.

  4. Assembling a game development scene? Uncovering Finland’s largest demo party

    Heikki Tyni

    2014-03-01

    Full Text Available The study takes look at Assembly, a large-scale LAN and demo party founded in 1992 and organized annually in Helsinki, Finland. Assembly is used as a case study to explore the relationship between computer hobbyism – including gaming, demoscene and other related activities – and professional game development. Drawing from expert interviews, a visitor query and news coverage we ask what kind of functions Assembly has played for the scene in general, and on the formation and fostering of the Finnish game industry in particular. The conceptual contribution of the paper is constructed around the interrelated concepts of scene, technicity and gaming capital.

  5. Demos Center, Militsiia mezhdu Rossiei i Chechnei. Veterany konflikta v rossiiskom obshchestve

    Elisabeth Sieca-Kozlowski

    2009-03-01

    Full Text Available The Demos study on policemen who are veterans of the Chechen war is the Centre’s second in-depth study. The first dealt with the phenomenon of arbitrariness (“proizvol” in the police force. This new study focuses on one of the contributing factors of this arbitrariness, the fact of having gone through the Chechen war. Although the two Chechen conflicts (1994-1996 and 1999 to the present involved the dispatch of tens of thousands of military and members of “power” ministries to the combat zo...

  6. Peltier ac calorimeter

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  7. First Observations of GNSS Ionospheric Scintillations From DemoGRAPE Project

    Alfonsi, L.; Cilliers, P. J.; Romano, V.; Hunstad, I.; Correia, E.; Linty, N.; Dovis, F.; Terzo, O.; Ruiu, P.; Ward, J.; Riley, P.

    2016-10-01

    The Istituto Nazionale di Geofisica e Vulcanologia leads an international project funded by the Italian National Program for Antarctic Research, called Demonstrator of Global Navigation Satellite System (GNSS) Research and Application for Polar Environment (DemoGRAPE), in partnership with Politecnico di Torino, Istituto Superiore Mario Boella, and with South African National Space Agency and the Brazilian National Institute of Space Physics, as key collaborators. DemoGRAPE is a new prototype of support for the satellite navigation in Antarctica. Besides the scientific interest, the accuracy of satellite navigation in Antarctica is of paramount importance since there is always the danger that people and vehicles can fall into a crevasse during a snowstorm, when visibility is limited and travel is restricted to following specified routes using satellite navigation systems. The variability of ionospheric delay and ionospheric scintillation are two of the primary factors which affect the accuracy of satellite navigation. The project will provide a demonstrator of cutting edge technology for the empirical assessment of the ionospheric delay and ionospheric scintillations in the polar regions. The scope of the project includes new equipment for the recording and dissemination of GNSS data and products installed at the South African and Brazilian bases in Antarctica. The new equipment will facilitate the exchange of software and derived products via the Cloud computing technology infrastructure. The project portal is accessible at www.demogrape.net. We report the first Global Navigation Satellite System (GNSS) signal scintillations observed in Antarctica.

  8. Materials for DEMO and reactor applications—boundary conditions and new concepts

    Coenen, J. W.; Antusch, S.; Aumann, M.; Biel, W.; Du, J.; Engels, J.; Heuer, S.; Houben, A.; Hoeschen, T.; Jasper, B.; Koch, F.; Linke, J.; Litnovsky, A.; Mao, Y.; Neu, R.; Pintsuk, G.; Riesch, J.; Rasinski, M.; Reiser, J.; Rieth, M.; Terra, A.; Unterberg, B.; Weber, Th; Wegener, T.; You, J.-H.; Linsmeier, Ch

    2016-02-01

    DEMO is the name for the first stage prototype fusion reactor considered to be the next step after ITER towards realizing fusion. For the realization of fusion energy especially, materials questions pose a significant challenge already today. Heat, particle and neutron loads are a significant problem to material lifetime when extrapolating to DEMO. For many of the issues faced, advanced materials solutions are under discussion or already under development. In particular, components such as the first wall and the divertor of the reactor can benefit from introducing new approaches such as composites or new alloys into the discussion. Cracking, oxidation as well as fuel management are driving issues when deciding for new materials. Here {{{W}}}{{f}}/{{W}} composites as well as strengthened CuCrZr components together with oxidation resilient tungsten alloys allow the step towards a fusion reactor. In addition, neutron induced effects such as transmutation, embrittlement and after-heat and activation are essential. Therefore, when designing a component an approach taking into account all aspects is required.

  9. Endogenising demographic variables in demo-economic models: the Bachue experience.

    Wery, R; Rodgers, G

    1980-01-01

    The attempt is made in this discussion to describe and draw lessons from the treatment of behavioral demographic variables in the Bachue demo-economic models constructed for the Philippines, Kenya, Brazil and Yugoslavia. Focus is on certain theoretical, technical and practical problems encountered in inserting demographic variables in the system as a whole; how they have been measured in the various applications of the Bachue models, how they are behaviorally explained and linked to the other elements in the system, the data sources used, and some issues of econometric estimates and modelling. 8 issues are dealt with: population accounting and lag structure; fertility; mortality; migration; nuptiality; household formation; schooling; and labor force participation. In each case model structure, dependent and explanatory variables, and empirical strategy are discussed. Summary tables compare the approaches of the different models. The specifics of each country situation rule out the identification of the best solution. Some suggestions regarding more promising approaches are included with respect to choice of variables and the estimation of behavioral models. The endogenous nature of certain demographic elements of a demo-economic model are clear, but construction of the Bachue models has shown that there are no exact rules valid for all cases. There is considerable variety in the way characteristics of the population have been represented in the various applications.

  10. Lessons learnt from ITER safety & licensing for DEMO and future nuclear fusion facilities

    Taylor, Neill

    2013-01-01

    One of the strong motivations for pursuing the development of fusion energy is its potentially low environmental impact and very good safety performance. But this safety and environmental potential can only be fully realized by careful design choices. For DEMO and other fusion facilities that will require nuclear licensing, S&E objectives and criteria should be set at an early stage and taken into account when choosing basic design options and throughout the design process. Studies in recent decades of the safety of fusion power plant concepts give a useful basis on which to build the S&E approach and to assess the impact of design choices. The experience of licensing ITER is of particular value, even though there are some important differences between ITER and DEMO. The ITER project has developed a safety case, produced a preliminary safety report and had it examined by the French nuclear safety authorities, leading to the licence to construct the facility. The key technical issues that arose during ...

  11. A DEMO relevant fast wave current drive high harmonic antenna exploiting the high impedance technique

    Milanesio, D.; Maggiora, R.

    2015-12-01

    Ion Cyclotron (IC) antennas are routinely adopted in most of the existing nuclear fusion experiments, even though their main goal, i.e. to couple high power to the plasma (MW), is often limited by rather severe drawbacks due to high fields on the antenna itself and on the unmatched part of the feeding lines. In addition to the well exploited auxiliary ion heating during the start-up phase, some non-ohmic current drive (CD) at the IC range of frequencies may be explored in view of the DEMO reactor. In this work, we suggest and describe a compact high frequency DEMO relevant antenna, based on the high impedance surfaces concept. High-impedance surfaces are periodic metallic structures (patches) usually displaced on top of a dielectric substrate and grounded by means of vertical posts embedded inside the dielectric, in a mushroom-like shape. These structures present a high impedance, within a given frequency band, such that the image currents are in-phase with the currents of the antenna itself, thus determining a significant efficiency increase. After a general introduction on the properties of high impedance surfaces, we analyze, by means of numerical codes, a dielectric based and a full metal solution optimized to be tested and benchmarked on the FTU experiment fed with generators at 433MHz.

  12. Experimental study on the CFB-FGD of semi-dry process in a demo plant

    Tong, H.; Wang, X.; Liu, Q. (and others) [Tsinghua University, Beijing (China). State Key Laboratory of Clean Combustion of Coal

    2003-07-01

    A CFB-FGD demo-plant was established near the pilot power plant of Tsinghua University, with a flue gas capacity of 20,000 Nm{sup 3}/h. The detailed structure and characteristics of the absorber are described in the paper. A series of experiments about how the desulfurization efficiency was influenced by various factors were conducted on this facility, such as sorbent properties, ratio of Ca/S, solids concentration, Approach to Saturation Temperature (ASAT) and CaCl{sub 2} additives. In the meantime the practical problems to be considered in the commercial design were studied too. The experiments shows that 85% desulfurization efficiency is achieved while the ratio of Ca/S is 1.3 and the ASAT is 7{sup o}C. Under the condition that the additive is added in the slurry the ASAT is reduced slightly and the desulfurization efficiency can reach 90%. This demo-plant established the strong base for the commercial use of the technology. 5 refs., 7 figs.

  13. Archimede solar energy molten salt parabolic trough demo plant: Improvements and second year of operation

    Maccari, Augusto; Donnola, Sandro; Matino, Francesca; Tamano, Shiro

    2016-05-01

    Since July 2013, the first stand-alone Molten Salt Parabolic Trough (MSPT) demo plant, which was built in collaboration with Archimede Solar Energy and Chiyoda Corporation, is in operation, located adjacent to the Archimede Solar Energy (ASE) manufacturing plant in Massa Martana (Italy). During the two year's operating time frame, the management of the demo plant has shown that MSPT technology is a suitable and reliable option. Several O&M procedures and tests have been performed, as Heat Loss and Minimum Flow Test, with remarkable results confirming that this technology is ready to be extended to standard size CSP plant, if the plant design takes into account molten salt peculiarities. Additionally, the plant has been equipped on fall 2014 with a Steam Generator system by Chiyoda Corporation, in order to test even this important MSPT plant subsystem and to extend the solar field active time, overcoming the previous lack of an adequate thermal load. Here, a description of the plant improvements and the overall plant operation figures will be presented.

  14. Effects of magnetic ripple on 3D equilibrium and alpha particle confinement in the European DEMO

    Pfefferlé, D.; Cooper, W. A.; Fasoli, A.; Graves, J. P.

    2016-11-01

    An assessment of alpha particle confinement is performed in the European DEMO reference design. 3D MHD equilibria with nested flux-surfaces and single magnetic axis are obtained with the VMEC free-boundary code, thereby including the plasma response to the magnetic ripple created by the finite number of TF coils. Populations of fusion alphas that are consistent with the equilibrium profiles are evolved until slowing-down with the VENUS-LEVIS orbit code in the guiding-centre approximation. Fast ion losses through the last-closed flux-surface are numerically evaluated with two ripple models: (1) using the 3D equilibrium and (2) algebraically adding the non-axisymmetric ripple perturbation to the 2D equilibrium. By virtue of the small ripple field and its non-resonant nature, both models quantitatively agree. Differences are however noted in the toroidal location of particles losses on the last-closed flux-surface, which in the first case is 3D and in the second not. Superbanana transport, i.e. ripple-well trapping and separatrix crossing, is expected to be the dominant loss mechanism, the strongest effect on alphas being between 100-200 KeV. Above this, stochastic ripple diffusion is responsible for a rather weak loss rate, as the stochastisation threshold is observed numerically to be higher than analytic estimates. The level of ripple in the current 18 TF coil design of the European DEMO is not found to be detrimental to fusion alpha confinement.

  15. A DEMO relevant fast wave current drive high harmonic antenna exploiting the high impedance technique

    Milanesio, D., E-mail: daniele.milanesio@polito.it; Maggiora, R. [Politecnico di Torino, Dipartimento di Elettronica e Telecomunicazioni (DET), Torino (Italy)

    2015-12-10

    Ion Cyclotron (IC) antennas are routinely adopted in most of the existing nuclear fusion experiments, even though their main goal, i.e. to couple high power to the plasma (MW), is often limited by rather severe drawbacks due to high fields on the antenna itself and on the unmatched part of the feeding lines. In addition to the well exploited auxiliary ion heating during the start-up phase, some non-ohmic current drive (CD) at the IC range of frequencies may be explored in view of the DEMO reactor. In this work, we suggest and describe a compact high frequency DEMO relevant antenna, based on the high impedance surfaces concept. High-impedance surfaces are periodic metallic structures (patches) usually displaced on top of a dielectric substrate and grounded by means of vertical posts embedded inside the dielectric, in a mushroom-like shape. These structures present a high impedance, within a given frequency band, such that the image currents are in-phase with the currents of the antenna itself, thus determining a significant efficiency increase. After a general introduction on the properties of high impedance surfaces, we analyze, by means of numerical codes, a dielectric based and a full metal solution optimized to be tested and benchmarked on the FTU experiment fed with generators at 433MHz.

  16. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  17. ACS: ALMA Common Software

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  18. Transient Mirror Heating Theory and Experiment in the Jefferson Lab IR Demo FEL

    Benson, S.; Michelle D. Shinn.; Neil, G.R.

    2001-01-01

    During commissioning of the IR Demo FEL at Jefferson Lab, we noticed that the FEL exhibited a rapid power drop with time when the first set of 3 mu-m mirrors was used. Thought the rate of power drop was unexpected, it was thought that it could be due to a distortion of the mirrors during a time short compared to a the thermal diffusion time. This transient distortion might affect the laser more than the steady state distortion. This paper presents some analysis of the transient mirror heating problem and some recent experimental results using different mirror substrates and coatings. It is found that the behavior of the first mirror set cannot be reconciled with the observed power fall-off if a linear absorption is assumed. The power drop in more recent experiments is consistent with linear thermal analysis. No anomalous transient effects are seen.

  19. Assembly and test of the W7-X demo-cryostat

    Schauer, F. E-mail: schauer@ipp.mpg.de; Bau, H.; Bojko, I.; Brockmann, R.; Feist, J.-H.; Hein, B.; Pieger-Frey, M.; Pirsch, H.; Sapper, J.; Sombach, B.; Stadlbauer, J.; Volzke, O.; Wald, I.; Wanner, M

    2001-10-01

    An overview is given on the status of the demo-cryostat project for the WENDELSTEIN 7-X stellarator. Construction and assembly of the prototype are finished, and the test period is near completion. The intention of this project was to get experience with design and construction of W7-X-components, as well as with assembly of this complex system. The goal is now practically achieved, and it could be demonstrated that the W7-X cryostat can be built with reasonable effort. Many of the solutions found can be adopted directly for W7-X, or are starting points for further improvements. A short description is given of the cryostat, its assembly, and of the most important tests which were performed so far.

  20. Evaluation of Demo 1C composite flywheel rotor burst test and containment design

    Kass, M.D.; McKeever, J.W.; Akerman, M.A.; Goranson, P.L.; Litherland, P.S.; O`Kain, D.U.

    1998-07-01

    Laboratory-Directed funds were provided in FY 1995 for research to develop flywheel containment specifications and to consider concepts that could satisfy these specifications and produce a prototype small, lightweight, inexpensive, mobile flywheel containment. Research activities have included an analytical and pictorial review of the Demo 1C flywheel failure test, which provided significant insight about radial and axial failure modes; calculations of the thickness of ultra-conservative pressure vessel containment; entertainment of advanced containment concepts using lightweight materials and armor literature; consideration of fabrication assembly procedures; and participation in a Flywheel Energy Storage Workshop during which additional flywheel failure experiences were discussed. Based on these activities, calculations, and results, a list of conclusions concerning flywheel containment and its relation to the flywheel are presented followed by recommendations for further research.

  1. Operation and first results of the NEXT-DEMO prototype using a silicon photomultiplier tracking array

    Álvarez, V; Cárcel, S; Castel, J; Cebrián, S; Cervera, A; Conde, C A N; Dafni, T; Dias, T H V T; Díaz, J; Egorov, M; Esteve, R; Evtoukhovitch, P; Fernandes, L M P; Ferrario, P; Ferreira, A L; Freitas, E D C; Gehman, V M; Gil, A; Goldschmidt, A; Gómez, H; Gómez-Cadenas, J J; González-Díaz, D; Gutiérrez, R M; Hauptman, J; Morata, J A Hernando; Herrera, D C; Iguaz, F J; Irastorza, I G; Jinete, M A; Labarga, L; Laing, A; Liubarsky, I; Lopes, J A M; Lorca, D; Losada, M; Luzón, G; Marí, A; Martín-Albo, J; Martínez, A; Martínez, G; Miller, T; Moiseenko, A; Monrabal, F; Monteiro, C M B; Mora, F J; Moutinho, L M; Vidal, J Muñoz; da Luz, H Natal; Navarro, G; Nebot-Guinot, M; Nygren, D; Oliveira, C A B; Palma, R; Pérez, J; Aparicio, J L Pérez; Renner, J; Ripoll, L; Rodríguez, A; Rodríguez, J; Santos, F P; Santos, J M F dos; Seguí, L; Serra, L; Shuman, D; Simón, A; Sofka, C; Sorel, M; Toledo, J F; Tomás, A; Torrent, J; Tsamalaidze, Z; Veloso, J F C A; Villar, J A; Webb, R; White, J T; Yahlali, N

    2013-01-01

    NEXT-DEMO is a high-pressure xenon gas TPC which acts as a technological test-bed and demonstrator for the NEXT-100 neutrinoless double beta decay experiment. In its current configuration the apparatus fully implements the NEXT-100 design concept. This is an asymmetric TPC, with an energy plane made of photomultipliers and a tracking plane made of silicon photomultipliers (SiPM) coated with TPB. The detector in this new configuration has been used to reconstruct the characteristic signature of electrons in dense gas. Demonstrating the ability to identify the MIP and ``blob'' regions. Moreover, the SiPM tracking plane allows for the definition of a large fiducial region in which an excellent energy resolution of 1.82% FWHM at 511 keV has been measured (a value which extrapolates to 0.83% at the xenon Qbetabeta).

  2. Latest results of NEXT-DEMO, the prototype of the NEXT 100 double beta decay experiment

    Serra, L; Martin-Albo, J; Sorel, M; Gomez-Cadenas, J J

    2014-01-01

    NEXT-DEMO is a 1:4.5 scale prototype of the NEXT100 detector, a high-pressure xenon gas TPC that will search for the neutrinoless double beta decay of $^{136}$Xe. X-ray energy depositions produced by the de-excitation of Xenon atoms after the interaction of gamma rays from radioactive sources have been used to characterize the response of the detector obtaining the spatial calibration needed for close-to-optimal energy resolution. Our result, 5.5% FWHM at 30 keV, extrapolates to 0.6% FWHM at the Q value of $^{136}$Xe. Additionally, alpha decays from radon have been used to measure several detection properties and parameters of xenon gas such as electron-ion recombination, electron drift velocity, diffusion and primary scintillation light yield. Alpha spectroscopy is also used to quantify the activity of radon inside the detector, a potential source of background for most double beta decay experiments.

  3. Activation, decay heat, and waste classification studies of the European DEMO concept

    Gilbert, M. R.; Eade, T.; Bachmann, C.; Fischer, U.; Taylor, N. P.

    2017-04-01

    Inventory calculations have a key role to play in designing future fusion power plants because, for a given irradiation field and material, they can predict the time evolution in chemical composition, activation, decay heat, gamma-dose, gas production, and even damage (dpa) dose. For conceptual designs of the European DEMO fusion reactor such calculations provide information about the neutron shielding requirements, maintenance schedules, and waste disposal prospects; thereby guiding future development. Extensive neutron-transport and inventory calculations have been performed for a reference DEMO reactor model with four different tritium-breeding blanket concepts. The results have been used to chart the post-operation variation in activity and decay heat from different vessel components, demonstrating that the shielding performance of the different blanket concepts—for a given blanket thickness—varies significantly. Detailed analyses of the simulated nuclide inventories for the vacuum vessel (VV) and divertor highlight the most dominant radionuclides, potentially suggesting how changes in material composition could help to reduce activity. Minor impurities in the raw composition of W used in divertor tiles, for example, are shown to produce undesirable long-lived radionuclides. Finally, waste classifications, based on UK regulations, and a recycling potential limit, have been applied to estimate the time-evolution in waste masses for both the entire vessel (including blanket modules, VV, divertor, and some ex-vessel components) and individual components, and also to suggest when a particular component might be suitable for recycling. The results indicate that the large mass of the VV will not be classifiable as low level waste on the 100 year timescale, but the majority of the divertor will be, and that both components will be potentially recyclable within that time.

  4. Tokamak DEMO-FNS: Concept of magnet system and vacuum chamber

    Azizov, E. A.; Ananyev, S. S.; Belyakov, V. A.; Bondarchuk, E. N.; Voronova, A. A.; Golikov, A. A.; Goncharov, P. R.; Dnestrovskij, A. Yu.; Zapretilina, E. R.; Ivanov, D. P.; Kavin, A. A.; Kedrov, I. V.; Klischenko, A. V.; Kolbasov, B. N.; Krasnov, S. V.; Krylov, A. I.; Krylov, V. A.; Kuzmin, E. G.; Kuteev, B. V.; Labusov, A. N.; Lukash, V. E.; Maximova, I. I.; Medvedev, S. Yu.; Mineev, A. B.; Muratov, V. P.; Petrov, V. S.; Rodin, I. Yu.; Sergeev, V. Yu.; Spitsyn, A. V.; Tanchuk, V. N.; Trofimov, V. A.; Khayrutdinov, R. R.; Khokhlov, M. V.; Shpanskiy, Yu. S.

    2016-12-01

    The level of knowledge accumulated to date in the physics and technologies of controlled thermonuclear fusion (CTF) makes it possible to begin designing fusion—fission hybrid systems that would involve a fusion neutron source (FNS) and which would admit employment for the production of fissile materials and for the transmutation of spent nuclear fuel. Modern Russian strategies for CTF development plan the construction to 2023 of tokamak-based demonstration hybrid FNS for implementing steady-state plasma burning, testing hybrid blankets, and evolving nuclear technologies. Work on designing the DEMO-FNS facility is still in its infancy. The Efremov Institute began designing its magnet system and vacuum chamber, while the Kurchatov Institute developed plasma-physics design aspects and determined basic parameters of the facility. The major radius of the plasma in the DEMO-FNS facility is R = 2.75 m, while its minor radius is a = 1 m; the plasma elongation is k 95 = 2. The fusion power is P FUS = 40 MW. The toroidal magnetic field on the plasma-filament axis is B t0 = 5 T. The plasma current is I p = 5 MA. The application of superconductors in the magnet system permits drastically reducing the power consumed by its magnets but requires arranging a thick radiation shield between the plasma and magnet system. The central solenoid, toroidal-field coils, and poloidal-field coils are manufactured from, respectively, Nb3Sn, NbTi and Nb3Sn, and NbTi. The vacuum chamber is a double-wall vessel. The space between the walls manufactured from 316L austenitic steel is filled with an iron—water radiation shield (70% of stainless steel and 30% of water).

  5. Gyrotron development at KIT: FULGOR test facility and gyrotron concepts for DEMO

    Schmid, M., E-mail: martin.schmid@kit.edu [Institute for Pulsed Power and Microwave Technology (IHM), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Franck, J.; Kalaria, P.; Avramidis, K.A.; Gantenbein, G.; Illy, S. [Institute for Pulsed Power and Microwave Technology (IHM), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Jelonnek, J. [Institute for Pulsed Power and Microwave Technology (IHM), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Institute of High Frequency Techniques and Electronics (IHE), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Pagonakis, I. Gr.; Rzesnicki, T. [Institute for Pulsed Power and Microwave Technology (IHM), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Thumm, M. [Institute for Pulsed Power and Microwave Technology (IHM), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany); Institute of High Frequency Techniques and Electronics (IHE), Karlsruhe Institute of Technology, Association EURATOM-KIT, Karlsruhe (Germany)

    2015-10-15

    Highlights: • Substantial extension of the KIT gyrotron test facility FULGOR has started. • FULGOR will be able to test gyrotrons with continuous RF output power up to 4 MW. • Design of 240 GHz gyrotrons for efficient electron cyclotron current drive is progressing. • Output power of 240 GHz gyrotrons with conventional cavity up to 830 kW, with coaxial cavity up to 2 MW is feasible. • Multi-frequency operation with gyrotrons is also possible (170–267 GHz). - Abstract: At the Karlsruhe Institute of Technology (KIT), theoretical and experimental foundations for the development of future gyrotrons for fusion applications are being laid down. This includes the construction of the new Fusion Long Pulse Gyrotron Laboratory (FULGOR) test facility as well as physical design studies towards DEMO-compatible gyrotrons. Initially FULGOR will comprise of a 10 MW CW power supply, a 5 MW water cooling system (upgradeable to 10 MW), a superconducting 10 T magnet, one or two 2 MW ECRH test loads and a new control and data acquisition system for all these elements. The test facility will then be equipped to test the conventional 1 MW or coaxial 2 MW gyrotrons for DEMO, currently under design, as well as possible upgraded gyrotrons for W7-X and ITER. The design of the new high voltage DC power supply (HVDCPS) is flexible enough to handle gyrotrons with 4 MW CW output power (conceivably up to 170 GHz), but also test gyrotrons with higher frequencies (>250 GHz) which, due to physical limitations in the gyrotron design, will require less power but have more stringent demands on voltage stability.

  6. Quasi-linear modeling of lower hybrid current drive in ITER and DEMO

    Cardinali, A., E-mail: alessandro.cardinali@enea.it; Cesario, R.; Panaccione, L.; Santini, F.; Amicucci, L.; Castaldo, C.; Ceccuzzi, S.; Mirizzi, F.; Tuccillo, A. A. [ENEA, Unità Tecnica Fusione, Via E Fermi 45 Rome (Italy)

    2015-12-10

    First pass absorption of the Lower Hybrid waves in thermonuclear devices like ITER and DEMO is modeled by coupling the ray tracing equations with the quasi-linear evolution of the electron distribution function in 2D velocity space. As usually assumed, the Lower Hybrid Current Drive is not effective in a plasma of a tokamak fusion reactor, owing to the accessibility condition which, depending on the density, restricts the parallel wavenumber to values greater than n{sub ∥crit} and, at the same time, to the high electron temperature that would enhance the wave absorption and then restricts the RF power deposition to the very periphery of the plasma column (near the separatrix). In this work, by extensively using the “ray{sup star}” code, a parametric study of the propagation and absorption of the LH wave as function of the coupled wave spectrum (as its width, and peak value), has been performed very accurately. Such a careful investigation aims at controlling the power deposition layer possibly in the external half radius of the plasma, thus providing a valuable aid to the solution of how to control the plasma current profile in a toroidal magnetic configuration, and how to help the suppression of MHD mode that can develop in the outer part of the plasma. This analysis is useful not only for exploring the possibility of profile control of a pulsed operation reactor as well as the tearing mode stabilization, but also in order to reconsider the feasibility of steady state regime for DEMO.

  7. Find the weakest link. A comparison between demographic, genetic and demo-genetic metapopulation extinction times

    Robert Alexandre

    2011-09-01

    Full Text Available Abstract Background While the ultimate causes of most species extinctions are environmental, environmental constraints have various secondary consequences on evolutionary and ecological processes. The roles of demographic, genetic mechanisms and their interactions in limiting the viabilities of species or populations have stirred much debate and remain difficult to evaluate in the absence of demography-genetics conceptual and technical framework. Here, I computed projected times to metapopulation extinction using (1 a model focusing on the effects of species properties, habitat quality, quantity and temporal variability on the time to demographic extinction; (2 a genetic model focusing on the dynamics of the drift and inbreeding loads under the same species and habitat constraints; (3 a demo-genetic model accounting for demographic-genetic processes and feedbacks. Results Results indicate that a given population may have a high demographic, but low genetic viability or vice versa; and whether genetic or demographic aspects will be the most limiting to overall viability depends on the constraints faced by the species (e.g., reduction of habitat quantity or quality. As a consequence, depending on metapopulation or species characteristics, incorporating genetic considerations to demographically-based viability assessments may either moderately or severely reduce the persistence time. On the other hand, purely genetically-based estimates of species viability may either underestimate (by neglecting demo-genetic interactions or overestimate (by neglecting the demographic resilience true viability. Conclusion Unbiased assessments of the viabilities of species may only be obtained by identifying and considering the most limiting processes (i.e., demography or genetics, or, preferentially, by integrating them.

  8. Three-dimensional easy morphological (3-DEMO classification of scoliosis, part I

    Negrini Alberto

    2006-12-01

    Full Text Available Abstract Background While scoliosis has, for a long time, been defined as a three-dimensional (3D deformity, morphological classifications are confined to the two dimensions of radiographic assessments. The actually existing 3-D classification proposals have been developed in research laboratories and appear difficult to be understood by clinicians. Aim of the study The aim of this study was to use the results of a 3D evaluation to obtain a simple and clinically oriented morphological classification (3-DEMO that might make it possible to distinguish among different populations of scoliotic patients. Method We used a large database of evaluations obtained through an optoelectronic system (AUSCAN that gives a 3D reconstruction of the spine. The horizontal view was used, with a spinal reference system (Top View. An expert clinician evaluated the morphological reconstruction of 149 pathological spines in order to find parameters that could be used for classificatory ends. These were verified in a mathematical way and through computer simulations: some parameters had to be excluded. Pathological data were compared with those of 20 normal volunteers. Results We found three classificatory parameters, which are fully described and discussed in this paper: Direction, the angle between spinal pathological and normal AP axis; Shift, the co-ordinates of the barycentre of the Top View ; Phase, the parameter describing the spatial evolution of the curve. Using these parameters it was possible to distinguish normal and pathological spines, to classify our population and to differentiate scoliotic patients with identical AP classification but different 3D behaviors. Conclusion The 3-DEMO classification offers a new and simple way of viewing the spine through an auxiliary plane using a spinal reference system. Further studies are currently under way to compare this new system with the existing 3-D classifications, to obtain it using everyday clinical and x

  9. Integration of Communication Analysis and the OO Method: Manual derivation of the Conceptual Model. The SuperStationery Co. lab demo

    España, Sergio; Pastor, Óscar; Ruiz, Marcela

    2011-01-01

    This document presents a lab demo that exemplifies the manual derivation of an OO Method conceptual model, taking as input a Communication Analysis requirements model. In addition, it is described how the conceptual model is created in the OLIVANOVA Modeler tool. The lab demo corresponds to part of the business processes of a fictional small and medium enterprise named SuperStationery Co. This company provides stationery and office material to its clients. The company acts as a as intermediary: the company has a catalogue of products that are bought from suppliers and sold to clients. This lab demo, besides illustrating the derivation technique, demonstrates that the technique is feasible in practice. Also, the results of this lab demo provide a valuable feedback in order to improve the derivation technique.

  10. AC susceptibilities of grain-textured superconductors

    Sakamoto, N.; Fukuda, Y.; Koga, M.; Akune, T.; Khan, H. R.; Lüders, K.

    2008-09-01

    In-phase χ n‧ and out-phase χ n″ components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field Bdc, an amplitude Ba and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low- Tc metallic superconductors, χ1‧ shows smooth transition and χ1″ does single peak. High- Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in χ1″ and shoulders in χ1‧ appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  11. Systematic cavity design approach for a multi-frequency gyrotron for DEMO and study of its RF behavior

    Kalaria, P. C.; Avramidis, K. A.; Franck, J.; Gantenbein, G.; Illy, S.; Pagonakis, I. Gr.; Thumm, M.; Jelonnek, J.

    2016-09-01

    High frequency (>230 GHz) megawatt-class gyrotrons are planned as RF sources for electron cyclotron resonance heating and current drive in DEMOnstration fusion power plants (DEMOs). In this paper, for the first time, a feasibility study of a 236 GHz DEMO gyrotron is presented by considering all relevant design goals and the possible technical limitations. A mode-selection procedure is proposed in order to satisfy the multi-frequency and frequency-step tunability requirements. An effective systematic design approach for the optimal design of a gradually tapered cavity is presented. The RF-behavior of the proposed cavity is verified rigorously, supporting 920 kW of stable output power with an interaction efficiency of 36% including the considerations of realistic beam parameters.

  12. GENDER EQUALITY IN POLITICS IN NEPAL : the Role of Demo Finland to Promote Gender Equality in Nepalese Politics

    2015-01-01

    The research aims to focus on unequal gender power relation and women’s role in decision-making process in the politics in Nepal. This study also evaluates the role of Demo Finland, a Non-Governmental Organization to politically empower women through its project called Mobilizing Youth for Gender Equality in Politics. The study is based on the qualitative research method. A thematic data analysis is used to analyze the data collected from field. The unstructured interview was conducted w...

  13. DTT: a divertor tokamak test facility for the study of the power exhaust issues in view of DEMO

    Albanese, R.; WPDTT2 Team; DTT Project Proposal Contributors, the

    2017-01-01

    In parallel with the programme to optimize the operation with a conventional divertor based on detached conditions to be tested on the ITER device, a project has been launched to investigate alternative power exhaust solutions for DEMO, aimed at the definition and the design of a divertor tokamak test facility (DTT). The DTT project proposal refers to a set of parameters selected so as to have edge conditions as close as possible to DEMO, while remaining compatible with DEMO bulk plasma performance in terms of dimensionless parameters and given constraints. The paper illustrates the DTT project proposal, referring to a 6 MA plasma with a major radius of 2.15 m, an aspect ratio of about 3, an elongation of 1.6-1.8, and a toroidal field of 6 T. This selection will guarantee sufficient flexibility to test a wide set of divertor concepts and techniques to cope with large heat loads, including conventional tungsten divertors; liquid metal divertors; both conventional and advanced magnetic configurations (including single null, snow flake, quasi snow flake, X divertor, double null); internal coils for strike point sweeping and control of the width of the scrape-off layer in the divertor region; and radiation control. The Poloidal Field system is planned to provide a total flux swing of more than 35 Vs, compatible with a pulse length of more than 100 s. This is compatible with the mission of studying the power exhaust problem and is obtained using superconducting coils. Particular attention is dedicated to diagnostics and control issues, especially those relevant for plasma control in the divertor region, designed to be as compatible as possible with a DEMO-like environment. The construction is expected to last about seven years, and the selection of an Italian site would be compatible with a budget of 500 M€.

  14. Development of thermal-hydraulic analysis methodology for multiple modules of water-cooled breeder blanket in fusion DEMO reactor

    Kim, Geon-Woo; Lee, Jeong-Hun [Department of Nuclear Engineering, Seoul National University 1 Gwanak-ro, Gwanak-gu, Seoul 151-744 (Korea, Republic of); Cho, Hyoung-Kyu, E-mail: chohk@snu.ac.kr [Department of Nuclear Engineering, Seoul National University 1 Gwanak-ro, Gwanak-gu, Seoul 151-744 (Korea, Republic of); Park, Goon-Cherl [Department of Nuclear Engineering, Seoul National University 1 Gwanak-ro, Gwanak-gu, Seoul 151-744 (Korea, Republic of); Im, Kihak [National Fusion Research Institute, 169-148, Yuseong-gu, Daejeon 305-806 (Korea, Republic of)

    2016-02-15

    Highlights: • A methodology to simulate the K-DEMO blanket system was proposed. • The results were compared with the CFD, to verify the prediction capability of MARS. • 46 Blankets in a single sector in K-DEMO were simulated using MARS-KS. • Supervisor program was devised to handle each blanket module individually. • The calculation results showed the flow rates, pressure drops, and temperatures. - Abstract: According to the conceptual design of the fusion DEMO reactor proposed by the National Fusion Research Institute of Korea, the water-cooled breeding blanket system incorporates a total of 736 blanket modules. The heat flux and neutron wall loading to each blanket module vary along their poloidal direction, and hence, thermal analysis for at least one blanket sector is required to confirm that the temperature limitations of the materials are satisfied in all the blanket modules. The present paper proposes a methodology of thermal analysis for multiple modules of the blanket system using a nuclear reactor thermal-hydraulic analysis code, MARS-KS. In order to overcome the limitations of the code, caused by the restriction on the number of computational nodes, a supervisor program was devised, which handles each blanket module separately at first, and then corrects the flow rate, considering pressure drops that occur in each module. For a feasibility test of the proposed methodology, 46 blankets in a single sector were simulated; the calculation results of the parameters, such as mass flow, pressure drops, and temperature distribution in the multiple blanket modules showed that the multi-module analysis method can be used for efficient thermal-hydraulic analysis of the fusion DEMO reactor.

  15. AcEST: DK950971 [AcEST

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  16. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  17. A review on two previous divertor target concepts for DEMO: mutual impact between structural design requirements and materials performance

    You, Jeong-Ha

    2015-09-01

    Development of a diverter target with a sufficient capability of power exhaust is a crucial prerequisite for the realization of a fusion power plant. While the design and technology for divertor target has been successfully developed for ITER, the applicability of this concept is not necessarily assured yet for DEMO mainly because the neutron irradiation dose expected for the DEMO divertor will be an order of magnitude higher than that of the ITER divertor. The possible embrittlement of structural heat sink materials due to irradiation is likely to restrict the structural performance and the operational flexibility of a target component to a considerable extent. For judgment of design feasibility of a target concept a quantitative evaluation of the thermal and structure mechanical performance is needed. In this article, a review on two representative target design concepts considered for the DEMO divertor is presented. Emphasis is put on the mutual impact between the design requirements and the performance of structural materials. Water-cooled and helium-cooled concepts are discussed considering two baseline heat sink materials, CuCrZr alloy and tungsten, respectively. Conclusions are derived from the critical features of the heat sink performance in terms of structural reliability, design/material interface and further R&D needs.

  18. Concept design of the DEMO divertor cassette-to-vacuum vessel locking system adopting a systems engineering approach

    Di Gironimo, G., E-mail: giuseppe.digironimo@unina.it [Università degli Studi di Napoli “Federico II”, Dipartimento di Ingegneria Industriale, Piazzale Tecchio 80, 80135 Napoli (Italy); Carfora, D. [Tampere University of Technology, Korkeakoulunkatu 6, 33720 Tampere (Finland); VTT Technical Research Centre of Finland, Tekniikankatu 1, PO Box 1300, FI-33101 Tampere (Finland); Università degli Studi di Napoli “Federico II”, Dipartimento di Ingegneria Industriale, Piazzale Tecchio 80, 80135 Napoli (Italy); Esposito, G.; Lanzotti, A.; Marzullo, D. [Università degli Studi di Napoli “Federico II”, Dipartimento di Ingegneria Industriale, Piazzale Tecchio 80, 80135 Napoli (Italy); Siuko, M. [VTT Technical Research Centre of Finland, Tekniikankatu 1, PO Box 1300, FI-33101 Tampere (Finland)

    2015-05-15

    Highlights: • An iterative and incremental design process for cassette-to-VV locking system of DEMO divertor is presented. • Three different concepts have been developed with a systematic design approach. • The final concept has been selected with Fuzzy-Analytic Hierarchy Process in virtual reality. - Abstract: This paper deals with pre-concept studies of DEMO divertor cassette-to-vacuum vessel locking system under the work program WP13-DAS-07-T06: Divertor Remote Maintenance System pre-concept study. An iterative design process, consistent with Systems Engineering guidelines and named Iterative and Participative Axiomatic Design Process (IPADeP), is used in this paper to propose new innovative solutions for divertor locking system, which can overcome the difficulties in applying the ITER principles to DEMO. The solutions conceived have been analysed from the structural point of view using the software Ansys and, eventually, evaluated using the methodology known as Fuzzy-Analytic Hierarchy Process. Due to the lack and the uncertainty of the requirements in this early conceptual design stage, the aim is to cover a first iteration of an iterative and incremental process to propose an innovative design concept to be developed in more details as the information will be completed.

  19. Evaluation of energy and particle impact on the plasma facing components in DEMO

    Igitkhanov, Yuri, E-mail: juri.gitkhanov@ihm.fzk.de [Karlsruhe Institute of Technology, IHM, Karlsruhe (Germany); Bazylev, Boris [Karlsruhe Institute of Technology, IHM, Karlsruhe (Germany)

    2012-08-15

    Highlights: Black-Right-Pointing-Pointer We analyze the first wall blanket W/EUROFER configuration for DEMO under steady-state normal operation and off-normal conditions, such as vertical displacements events (VDE) and runaway electrons (RE). The main issue is to find the optimal thickness of the W armor which will prevent tungsten surface from evaporation and melting and, on the other hand, will keep EUROFER below the critical thermal stresses. Black-Right-Pointing-Pointer The minimum thickness of the tungsten amour about 3 mm for W/EUROFER sandwich structure will keep the maximum EUROFER temperature below the critical limit for EUROFER steel under steady-state operation and ITER like cooling conditions. Black-Right-Pointing-Pointer The W surface temperature and the max. EUROFER temperature are increasing with incoming heat flux. For reference conditions (Dw {approx}3 mm, DEUROFER {approx}4 mm) the maximum tolerable heat flux which does not causes in thermal stresses in structural material is about {approx}13.5 MW/m{sup 2}. Black-Right-Pointing-Pointer The RE deposit their energy deeper into W armour and for energies {>=}50 MJ/m{sup 2} and deposition times {<=}0.1 s, the minimum armor thickness required to prevent EUROFER from thermal distraction is {>=}1.4 cm. Black-Right-Pointing-Pointer However, at this thickness the W surface melts. For higher RE energy deposition rates ({>=}100 MJ/m{sup 2} in 0.1 s), the required armor thickness to prevent thermal destruction is even larger so that the bulk of the armor layer will melt and evaporate. - Abstract: We analyze the first wall blanket W/EUROFER configuration for DEMO under steady-state normal operation and off-normal conditions, such as vertical displacement events (VDE) and runaway electrons (RE). The main issue is to find the optimal thickness of the W armor which will prevent tungsten surface from evaporation and melting and, on the other hand, will keep EUROFER below the critical thermal stresses. Under steady

  20. AC Losses of Prototype HTS Transmission Cables

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  1. Participation as Post-Fordist Politics: Demos, New Labour, and Science Policy.

    Thorpe, Charles

    2010-12-01

    In recent years, British science policy has seen a significant shift 'from deficit to dialogue' in conceptualizing the relationship between science and the public. Academics in the interdisciplinary field of Science and Technology Studies (STS) have been influential as advocates of the new public engagement agenda. However, this participatory agenda has deeper roots in the political ideology of the Third Way. A framing of participation as a politics suited to post-Fordist conditions was put forward in the magazine Marxism Today in the late 1980s, developed in the Demos thinktank in the 1990s, and influenced policy of the New Labour government. The encouragement of public participation and deliberation in relation to science and technology has been part of a broader implementation of participatory mechanisms under New Labour. This participatory program has been explicitly oriented toward producing forms of social consciousness and activity seen as essential to a viable knowledge economy and consumer society. STS arguments for public engagement in science have gained influence insofar as they have intersected with the Third Way politics of post-Fordism.

  2. Characterisation of NEXT-DEMO using xenon K$_{\\alpha}$ X-rays

    Lorca, D; Laing, A; Ferrario, P; Gómez-Cadenas, J J; Álvarez, V; Borges, F I G; Camargo, M; Cárcel, S; Cebrián, S; Cervera, A; Conde, C A N; Dafni, T; Díaz, J; Esteve, R; Fernandes, L M P; Ferreira, A L; Freitas, E D C; Gehman, V M; Goldschmidt, A; Gómez, H; González-Díaz, D; Gutiérrez, R M; Hauptman, J; Morata, J A Hernando; Herrera, D C; Irastorza, I G; Labarga, L; Liubarsky, I; Losada, M; Luzón, G; Marí, A; Martínez-Lema, G; Martínez, A; Miller, T; Monrabal, F; Monserrate, M; Monteiro, C M B; Mora, F J; Moutinho, L M; Vidal, J Muñoz; Nebot-Guinot, M; Nygren, D; Oliveira, C A B; Pérez, J; Aparicio, J L Pérez; Renner, J; Ripoll, L; Rodríguez, A; Rodríguez, J; Santos, F P; Santos, J M F dos; Seguí, L; Serra, L; Shuman, D; Simón, A; Sofka, C; Sorel, M; Toledo, J F; Torrent, J; Tsamalaidze, Z; Veloso, J F C A; Webb, R; White, J T; Yahlali, N

    2014-01-01

    The NEXT experiment aims to observe the neutrinoless double beta decay of $^{136}$Xe in a high pressure gas TPC using electroluminescence (EL) to amplify the signal from ionization. Understanding the response of the detector is imperative in achieving a consistent and well understood energy measurement. The abundance of xenon k-shell x-ray emission during data taking has been identified as a multitool for the characterisation of the fundamental parameters of the gas as well as the equalisation of the response of the detector. The NEXT-DEMO prototype is a ~1.5 kg volume TPC filled with natural xenon. It employs an array of 19 PMTs as an energy plane and of 256 SiPMs as a tracking plane with the TPC light tube and SiPM surfaces being coated with tetraphenyl butadiene (TPB) which acts as a wavelength shifter for the VUV scintillation light produced by xenon. This paper presents the measurement of the properties of the drift of electrons in the TPC, the effects of the EL production region, and the extraction of p...

  3. Validation of a FAST Model of the Statoil-Hywind Demo Floating Wind Turbine

    Driscoll, Frederick; Jonkman, Jason; Robertson, Amy; Sirnivas, Senu; Skaare, Bjorn; Nielsen, Finn Gunnar

    2016-09-01

    To assess the accuracy of the National Renewable Energy Laboratory's (NREL's) FAST simulation tool for modeling the coupled response of floating offshore wind turbines under realistic open-ocean conditions, NREL developed a FAST model of the Statoil Hywind Demo floating offshore wind turbine, and validated simulation results against field measurements. Field data were provided by Statoil, which conducted a comprehensive test measurement campaign of its demonstration system, a 2.3-MW Siemens turbine mounted on a spar substructure deployed about 10 km off the island of Karmoy in Norway. A top-down approach was used to develop the FAST model, starting with modeling the blades and working down to the mooring system. Design data provided by Siemens and Statoil were used to specify the structural, aerodynamic, and dynamic properties. Measured wind speeds and wave spectra were used to develop the wind and wave conditions used in the model. The overall system performance and behavior were validated for eight sets of field measurements that span a wide range of operating conditions. The simulated controller response accurately reproduced the measured blade pitch and power. The structural and blade loads and spectra of platform motion agree well with the measured data.

  4. Design of a water cooled monoblock divertor for DEMO using Eurofer as structural material

    Richou, Marianne, E-mail: marianne.richou@cea.fr [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Li-Puma, Antonella [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Visca, Eliseo [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, IT-00044 Frascati (Italy)

    2014-10-15

    The performed investigation focus on a monoblock type design for a water cooled DEMO divertor using Eurofer as structural material. In 2013, a study case of such a concept was presented. It was shown that basic concepts using Eurofer as structural material are limited to an incident heat flux of 8 MW m{sup −2}. Since, the EFDA agency issued new specifications. In this study, the conceptual design is reassessed with regard to specifications. Then, steady state thermal analyses and thermo-mechanical elastic analyses have been performed to define an upgrade of the geometry taking into account new specifications, design criteria and the maximum heat flux requirement of 10 MW m{sup −2}. An analysis of the influence of each adjustable geometrical parameter on thermo-mechanical design criteria was performed. As a consequence, geometrical parameters were set in order to fit to materials requirements. For defined hydraulic conditions taken in the most favourable configuration, the limit of this design is estimated to an incident heat flux of 10 MW m{sup −2}. Margin to critical heat flux and rules against progressive deformation/ratcheting in structural material limit the design.

  5. FAST: A European ITER satellite experiment in the view of DEMO

    Crisanti, F., E-mail: Crisanti@frascati.enea.it [Associazione Euratom/ENEA sulla Fusione, CP 65-00044 Frascati, Rome (Italy); Cucchiaro, A. [Associazione Euratom/ENEA sulla Fusione, CP 65-00044 Frascati, Rome (Italy); Albanese, R.; Artaserse, G. [Assoc. Euratom-ENEA-CREATE, Univ. Napoli Federico II, Via Claudio 21, 80125 Napoli (Italy); Baruzzo, M.; Bolzonella, T. [Consorzio RFX, EURATOM-ENEA Association, Corso Stati Uniti 4, 35127 Padova (Italy); Brolatti, G.; Calabro, G.; Crescenzi, F.; Coletti, R.; Costa, P.; Corte, A. della; Di Zenobio, A.; Frosi, P. [Associazione Euratom/ENEA sulla Fusione, CP 65-00044 Frascati, Rome (Italy); Harting, D. [Ins. Plasmaphysik, Forschungszentrum, Euratom Ass., Tril. Euregio Cluster, D-52425 Julich (Germany); Taroni, L. Lauro [New College, Oxford OX1 3BN (United Kingdom); Maddaluno, G. [Associazione Euratom/ENEA sulla Fusione, CP 65-00044 Frascati, Rome (Italy); Marcuzzi, D. [Consorzio RFX, EURATOM-ENEA Association, Corso Stati Uniti 4, 35127 Padova (Italy); Maviglia, F. [Assoc. Euratom-ENEA-CREATE, Univ. Napoli Federico II, Via Claudio 21, 80125 Napoli (Italy); Muzzi, L. [Associazione Euratom/ENEA sulla Fusione, CP 65-00044 Frascati, Rome (Italy)

    2011-10-15

    Fusion Advanced Studies Torus (FAST) aims to contribute to the exploitation of ITER and to explore innovative DEMO technology. FAST has been designed to study, in an integrated scenario: (a) relevant plasma-wall interaction problems, with a large power load (P/R {approx} 22 MW/m; P/R{sup 2} {approx} 12 MW/m{sup 2}) and with a full metallic wall; (b) to tackle operational problems in regimes with relevant fusion parameters; (c) to investigate the non-linear dynamics of fast particles (alpha like) in burning plasmas. FAST will operate on a wide parameters range, namely in high performance H-mode (BT {approx} 8.5 T; IP {approx} 8 MA) as well as in advanced Tokamak operation up to full non-inductive current scenario (IP {approx} 2 MA). The main heating is based on 30 MW ICRH, but the ports have been designed to allocate up to 20 MW of 1 MeV NNBI. Helium gas at 30 K is used for cooling of the full machine, a preliminary analysis shows the possibility of realizing FAST with a complete superconductor set of coils. An innovative active system is under development to reduce and to control the magnetic ripple. Tungsten (W) or liquid lithium (L-Li) has been chosen for the divertor material plates and the code EDGE2D has been used to optimize the divertor geometry.

  6. Laser-driven Beat-Wave Current Drive in Dense Plasmas with Demo on CTIX

    Liu, Fei; Horton, Robert; Hwang, David; Zhu, Ben; Evans, Russell; Hong, Sean; Hsu, Scott

    2010-11-01

    The ability to remotely generate plasma current in dense plasmas hanging freely in vacuum in voluminous amount without obstruction to diagnostics will greatly enhance our ability to study the physics of high energy density plasmas in strong magnetic fields. Plasma current can be generated through nonlinear beat-wave process by launching two intense electromagnetic waves into unmagnetized plasma. Beat-wave acceleration of electrons has been demonstrated in a low-density plasma using microwaves [1]. The proposed PLX experimental facility presently under construction at Los Alamos offers the opportunity to test the method at a density level scalable to the study of HED plasmas. For PLX beat-wave experiments, CO2 lasers will be used as pump waves due to their high power and tunability. For a typical PLX density ne=10^17cm-3, two CO2 lasers can be separately tuned to 9P(28) and 10P(20) to match the 2.84THz plasma frequency. The beat-wave demo experiment will be conducted on CTIX. The laser arrangement is being converted to two independent single lasers. Frequency-tuning methods, optics focusing system and diagnostics system will be discussed. The laser measurements and results of synchronization of two lasers will be presented, and scaling to PLX experiments will be given. [1] Rogers, J. H. and Hwang, D. Q., PRL. v68 p3877 (1992).

  7. AC-3 audio coder

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  8. DEMOS PLUS. Robot for decontaminating soils and cavity walls of the reactor and fuel pools NPP primarily during periods of recharging fuel; DEMOS PLUS. Robot para la descontaminacion de suelos y paredes de la cavidad de reactor y piscinas de combustible de CC.NN. principalmente durante los periodos de recarga de combustible

    Lacalle Bayo, J.; Vaquer Perez, J. I.; Rosello Garcia, J. I.

    2014-07-01

    In this work the robot Plus Demos, equipment that has been developed by GD Energy Services from the redesign and development of robot Demos show, which took place on last year. This evolution has given the team greater capabilities, highlighting the decontamination of vertical surfaces. The main objective pursued is to minimize operational doses to workers operating in cavity as well as the risk of surface contamination during them. (Author)

  9. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  10. Dynamic outgassing of deuterium, helium and nitrogen from plasma-facing materials under DEMO relevant conditions

    Möller, S.; Matveev, D.; Martynova, Y.; Unterberg, B.; Rasinski, M.; Wegener, T.; Kreter, A.; Linsmeier, Ch.

    2017-01-01

    In confined plasma magnetic fusion devices significant amounts of the hydrogen isotopes used for the fusion reaction can be stored in the plasma-facing materials by implantation. The desorption of this retained hydrogen was seen to follow a t α law with α  ≈  -0.7 in tokamaks. For a pulsed fusion reactor this outgassing can define the inter-pulse waiting time. This work presents new experimental data on the dynamic outgassing in ITER grade tungsten exposed under the well-defined conditions of PSI-2 to pure and mixed D2 plasmas. A peak ion flux of 1022 D+ m-2 s is applied for up to 6 h at sample temperatures of up to 900 K. Pure D2 and mixed D2  +  He, D2  +  N2 and D2  +  He  +  N2 plasmas are applied to the sample at 68 V bias. The D2, He, N outgassing at 293 K and 580 k are observed via in-vacuo quadrupole mass spectrometry covering the range of 40 s-200 000 s after exposure. The outgassing decay follows a single power law with exponents α  =  -0.7  to  -1.1 at 293 K, but at 580 K a drop from α  =  -0.25 to  -2.35 is found. For DEMO a pump-down time to 0.5 mPa in the order of 1-5 h can be expected. The outgassing is in all cases dominated by D2.

  11. Assessment of GPS Reflectometry from TechDemoSat-1 for Scatterometry and Altimetry Applications

    Shah, R.; Hajj, G. A.

    2015-12-01

    The value of GPS reflectometry for scatterometry and altimetry applications has been a topic of investigation for the past two decades. TechDemoSat-1 (TDS-1), a technology demonstration satellite launched in July of 2014, with an instrument to collect GPS reflections from 4 GPS satellites simultaneously, provide the first extensive data that allows for validation and evaluation of GPS reflectometry from space against more established techniques. TDS-1 uses a high gain (~13 dBi) L1 antenna pointing 6 degrees off nadir with a 60ohalf-beam width. Reflected GPS L1 signals are processed into Delay Doppler Maps (DDMs) inside the receiver and made available (through Level-1b) along with metadata describing the bistatic geometry, antenna gain, etc., on a second-by-second basis for each of the 4 GPS tracks recorded at any given time. In this paper we examine level-1b data from TDS-1 for thousands of tracks collected over the span of Jan.-Feb., 2015. This data corresponds to reflections from various types of surfaces throughout the globe including ice, deserts, forests, oceans, lakes, wetlands, etc. Our analysis will consider how the surface type manifests itself in the DDMs (e.g., coherence vs. non-coherence reflection) and derivable physical quantities. We will consider questions regarding footprint resolution, waveform rise time and corresponding bistatic range accuracy, and level of precision for altimetry (sea surface height) and scatterometry (significant wave height and sea surface wind). Tracks from TDS-1 that coincide with Jason-1 or 2 tracks will be analyzed, where the latter can be used as truth for comparison and validation. Where coincidences are found, vertical delay introduced by the media as measured by Jason will be mapped to bistatic propagation path to correct for neutral atmospheric and ionospheric delays.

  12. Maximal design basis accident of fusion neutron source DEMO-TIN

    Kolbasov, B. N., E-mail: Kolbasov-BN@nrcki.ru [National Research Center Kurchatov Institute (Russian Federation)

    2015-12-15

    When analyzing the safety of nuclear (including fusion) facilities, the maximal design basis accident at which the largest release of activity is expected must certainly be considered. Such an accident is usually the failure of cooling systems of the most thermally stressed components of a reactor (for a fusion facility, it is the divertor or the first wall). The analysis of safety of the ITER reactor and fusion power facilities (including hybrid fission–fusion facilities) shows that the initial event of such a design basis accident is a large-scale break of a pipe in the cooling system of divertor or the first wall outside the vacuum vessel of the facility. The greatest concern is caused by the possibility of hydrogen formation and the inrush of air into the vacuum chamber (VC) with the formation of a detonating mixture and a subsequent detonation explosion. To prevent such an explosion, the emergency forced termination of the fusion reaction, the mounting of shutoff valves in the cooling systems of the divertor and the first wall or blanket for reducing to a minimum the amount of water and air rushing into the VC, the injection of nitrogen or inert gas into the VC for decreasing the hydrogen and oxygen concentration, and other measures are recommended. Owing to a continuous feed-out of the molten-salt fuel mixture from the DEMO-TIN blanket with the removal period of 10 days, the radioactivity release at the accident will mainly be determined by tritium (up to 360 PBq). The activity of fission products in the facility will be up to 50 PBq.

  13. Effect of activation cross-section uncertainties on the radiological assessment of the MFE/DEMO first wall

    Cabellos, O. [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, Madrid (Spain)]. E-mail: cabellos@din.upm.es; Reyes, S. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Sanz, J. [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, Madrid (Spain); University Nacional Educacion a Distancia, Dep. Ingenieria Energetica, Juan del Rosal 12, 28040 Madrid (Spain); Rodriguez, A. [University Nacional Educacion a Distancia, Dep. Ingenieria Energetica, Juan del Rosal 12, 28040 Madrid (Spain); Youssef, M. [University of California, Los Angeles, CA (United States); Sawan, M. [University of Wisconsin, Madison, WI (United States)

    2006-02-15

    A Monte Carlo procedure has been applied in this work in order to address the impact of activation cross-sections (XS) uncertainties on contact dose rate and decay heat calculations for the outboard first wall (FW) of a magnetic fusion energy (MFE) demonstration (DEMO) reactor. The XSs inducing the major uncertainty in the prediction of activation related quantities have been identified. Results have shown that for times corresponding to maintenance activities the uncertainties effect is insignificant since the dominant XSs involved in these calculations are based on accurate experimental data evaluations. However, for times corresponding to waste management/recycling activities, the errors induced by the XSs uncertainties, which in this case are evaluated using systematic models, must be considered. It has been found that two particular isotopes, {sup 6}Co and {sup 94}Nb, are key contributors to the global DEMO FW activation uncertainty results. In these cases, the benefit from further improvements in the accuracy of the critical reaction XSs is discussed.

  14. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  15. AC Optimal Power Flow

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  16. AC susceptibilities of grain-textured superconductors

    Sakamoto, N. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan)], E-mail: saka@te.kyusan-u.ac.jp; Fukuda, Y.; Koga, M.; Akune, T. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan); Khan, H.R. [Institut von Ionenstrahl und Vakuum Technologie, 73728 Esslingen (Germany); Lueders, K. [Freie Universitaet Berlin, Arnimallee, Fac.Physik, D-14195 Berlin (Germany)

    2008-09-15

    In-phase {chi}{sub n}' and out-phase {chi}{sub n}'' components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field B{sub dc}, an amplitude B{sub a} and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low-T{sub c} metallic superconductors, {chi}{sub 1}' shows smooth transition and {chi}{sub 1}'' does single peak. High-T{sub c} oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in {chi}{sub 1}'' and shoulders in {chi}{sub 1}' appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  17. Single-Phase Direct AC-AC Boost Converter

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  18. The enhanced pellet centrifuge launcher at ASDEX Upgrade: Advanced operation and application as technology test facility for ITER and DEMO

    Ploeckl, B., E-mail: bernhard.ploeckl@ipp.mpg.de [Max Planck Institute for Plasma Physics, EURATOM Association, Boltzmannstr. 2, 85748 Garching (Germany); Day, Chr. [Karlsruhe Institute of Technology (KIT), 76021 Karlsruhe (Germany); Lamalle, Ph. [ITER Organization, Route de Vinon sur Verdon, CS 90046, 13067 Saint-Paul-lez-Durance (France); Lang, P.T.; Rohde, V.; Viezzer, E. [Max Planck Institute for Plasma Physics, EURATOM Association, Boltzmannstr. 2, 85748 Garching (Germany)

    2015-10-15

    The pellet centrifuge at ASDEX Upgrade has served for more than 20 years as a powerful tool for plasma control. Its recently enhanced control system provides more thorough control over parameters and a detailed view of all measured values. A study has recently been initiated on the conceptual design of an optimized DEMO core particle fuelling system. For this approach, first technical tests aimed on an optimized pellet transfer with respect to the preparation of the solid fuel and the transfer systems have been performed. An investigation of the temperature dependence of transfer efficiency (mass loss due to erosion and broken pellets) has revealed a weak dependence. For ITER, in which it is intended to operate a heating scheme with ICRF minority heating of He-3, test injections are performed using D{sub 2}-pellets as carriers for He-4. Admixing of N{sub 2} was investigated as well.

  19. Scoping of material response under DEMO neutron irradiation: comparison with fission and influence of nuclear library selection

    Gilbert, M R

    2016-01-01

    Predictions of material activation inventories will be a key input to virtually all aspects of the operation, safety and environmental assessment of future fusion nuclear plants. Additionally, the neutron-induced transmutation (change) of material composition (inventory) with time, and the creation and evolution of configurational damage from atomic displacements, require precise quantification because they can lead to significant changes in material properties, and thus influence reactor-component lifetime. A comprehensive scoping study has been performed to quantify the activation, transmutation (depletion and build-up) and immediate damage response under neutron irradiation for all naturally occurring elements from hydrogen to bismuth. The resulting database provides a global picture of the response of a material, covering the majority of nuclear technological space, but focussing specifically on typical conditions expected for a demonstration fusion power plant (DEMO). Results from fusion are compared aga...

  20. Needs and gaps in the development of aluminum-based corrosion and T-permeation barriers for DEMO blankets

    Wulf, Sven-Erik, E-mail: sven-erik.wulf@kit.edu; Krauss, Wolfgang; Konys, Jürgen

    2015-10-15

    Highlights: • New processes for barriers based on electroplating introduced in the last years. • New processes ECA and ECX able to overcome former fabrication problems. • Scales by ECA showed long-term compatibility in flowing Pb–Li (>12,000 h). • Further fusion relevant characterization and optimization of scales is required. • Qualification of T-permeation properties is urgently needed. - Abstract: Low-activation-ferritic–martensitic (RAFM) steels are candidates for structural materials in different blanket designs foreseen for DEMO and partly for TBM's tested in ITER. In all designs the liquid breeder Pb–15.7Li is in direct contact with the structural material, and thus two major topics – corrosion and T-permeation – influence the reliable, safe and economical application of such combination of breeder and structural material. As bare RAFM steels exhibit high corrosion rates of up to 400 μm/h in flowing Pb–15.7Li, Al-based coatings made by different coating processes were developed during the last 15 years and showed promising results in protecting RAFM steels from corrosion and T-permeation reduction. Especially barriers made by HDA, and electroplating (ECA, ECX), proved their ability to protect Eurofer against corrosion in flowing Pb–15.7Li. However, available T-permeation data for coated RAFM steels are rare and partly ambiguous for these coatings. This paper summarizes the state-of-the-art of aluminum-based barrier development and points out gaps and needs in future scale characterization and T-permeation barrier development. Additionally, necessary qualification steps on the path toward a reliable fabrication route are presented that is required to produce aluminum-based corrosion and T-permeation barriers on RAFM steels for blanket applications in future fusion reactors like DEMO.

  1. ACS CCD Stability Monitor

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  2. Using AC Motors in Robotics

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  3. Design concept of conducting shell and in-vessel components suitable for plasma vertical stability and remote maintenance scheme in DEMO reactor

    Utoh, Hiroyasu, E-mail: uto.hiroyasu@jaea.go.jp [Japan Atomic Energy Agency, Obuchi, Rokkasho-mura, Aomori-ken 039-3212 (Japan); International Fusion Energy Research Centre, 2-166, Obuchi, Rokkasho, Aomori 039-3212 (Japan); Takase, Haruhiko [Japan Atomic Energy Agency, Obuchi, Rokkasho-mura, Aomori-ken 039-3212 (Japan); International Fusion Energy Research Centre, 2-166, Obuchi, Rokkasho, Aomori 039-3212 (Japan); Sakamoto, Yoshiteru; Tobita, Kenji [Japan Atomic Energy Agency, Obuchi, Rokkasho-mura, Aomori-ken 039-3212 (Japan); Mori, Kazuo; Kudo, Tatsuya [Japan Atomic Energy Agency, Obuchi, Rokkasho-mura, Aomori-ken 039-3212 (Japan); International Fusion Energy Research Centre, 2-166, Obuchi, Rokkasho, Aomori 039-3212 (Japan); Someya, Youji; Asakura, Nobuyuki; Hoshino, Kazuo; Nakamura, Makoto; Tokunaga, Shinsuke [Japan Atomic Energy Agency, Obuchi, Rokkasho-mura, Aomori-ken 039-3212 (Japan)

    2016-02-15

    Highlights: • Conceptual design of in-vessel component including conducting shell has been investigated. • The conducting shell design for plasma vertical stability was clarified from the plasma vertical stability analysis. • The calculation results showed that the double-loop shell has the most effect on plasma vertical stability. - Abstract: In order to realize a feasible DEMO, we designed an in-vessel component including the conducting shell. The project is affiliated with the broader approach DEMO design activities and is conceptualized from a plasma vertical stability and engineering viewpoint. The dependence of the plasma vertical stability on the conducing shell parameters and the electromagnetic force at plasma disruption were investigated in numerical simulations (programmed in the 3D eddy current analysis code and a plasma position control code). The simulations assumed the actual shape and position of the vacuum vessel and in-vessel components. The plasma vertical stability was most effectively maintained by the double-loop shell.

  4. Developing Structural, High-heat flux and Plasma Facing Materials for a near-term DEMO Fusion Power Plant: the EU Assessment

    Stork, D; Boutard, J-L; Buckthorpe, D; Diegele, E; Dudarev, S L; English, C; Federici, G; Gilbert, M R; Gonzalez, S; Ibarra, A; Linsmeier, Ch; Puma, A Li; Marbach, G; Morris, P F; Packer, L W; Raj, B; Rieth, M; Tran, M Q; Ward, D J; Zinkle, S J

    2014-01-01

    The findings of the EU 'Materials Assessment Group' (MAG), within the 2012 EU Fusion Roadmap exercise, are discussed. MAG analysed the technological readiness of structural, plasma facing and high heat flux materials for a DEMO concept to be constructed in the early 2030s, proposing a coherent strategy for R&D up to a DEMO construction decision. Technical consequences for the materials required and the development, testing and modelling programmes, are analysed using: a systems engineering approach, considering reactor operational cycles, efficient maintenance and inspection requirements, and interaction with functional materials/coolants; and a project-based risk analysis, with R&D to mitigate risks from material shortcomings including development of specific risk mitigation materials.

  5. Partial AC-coupling minigrids

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  6. Aislamiento acústico

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  7. Performance of tungsten-based materials and components under ITER and DEMO relevant steady-state thermal loads

    Ritz, Guillaume Henri

    2011-07-01

    In nuclear fusion devices the surfaces directly facing the plasma are irradiated with high energy fluxes. The most intense loads are deposited on the divertor located at the bottom of the plasma chamber, which has to withstand continuous heat loads with a power density of several MW . m{sup -2} as well as transient events. These are much shorter (in the millisecond and sub-millisecond regime) but deposit a higher power densities of a few GW . m{sup -2}. The search for materials that can survive to those severe loading conditions led to the choice of tungsten which possesses advantageous attributes such as a high melting point, high thermal conductivity, low thermal expansion and an acceptable activation rate. These properties made it an attractive and promising candidate as armor material for divertors of future fusion devices such as ITER and DEMO. For the DEMO divertor, conceptual studies on helium-cooled tungsten plasma-facing components were performed. The concept was realized and tested under DEMO specific cyclic thermal loads. The examination of the plasma-facing components by microstructural analyses before and after thermal loading enabled to determine the mechanisms for components failure. Among others, it clearly showed the impact of the tungsten grade and the thermal stress induced crack formation on the performance of the armor material and in general of the plasma-facing component under high heat loads. A tungsten qualification program was launched to study the behaviour of various tungsten grades, in particular the crack formation, under fusion relevant steady-state thermal loads. In total, seven commercially available materials from two industrial suppliers were investigated. As the material's thermal response is strongly related to its microstructure, this program comprised different material geometries and manufacturing technologies. It also included the utilization of an actively cooled specimen holder which has been designed to perform

  8. Analysis of the thermo-mechanical behaviour of the DEMO Water-Cooled Lithium Lead breeding blanket module under normal operation steady state conditions

    Di Maio, P.A.; Arena, P. [Dipartimento di Energia, Ingegneria dell’Informazione e Modelli Matematici, Università di Palermo, Viale delle Scienze, 90128 Palermo (Italy); Aubert, J. [CEA Saclay, DEN/DANS/DM2S/SEMT, 91191 Gif sur Yvette Cedex (France); Bongiovì, G. [Dipartimento di Energia, Ingegneria dell’Informazione e Modelli Matematici, Università di Palermo, Viale delle Scienze, 90128 Palermo (Italy); Chiovaro, P., E-mail: pierluigi.chiovaro@unipa.it [Dipartimento di Energia, Ingegneria dell’Informazione e Modelli Matematici, Università di Palermo, Viale delle Scienze, 90128 Palermo (Italy); Giammusso, R. [ENEA – C.R. Brasimone, 40032 Camugnano (Italy); Li Puma, A. [CEA Saclay, DEN/DANS/DM2S/SEMT, 91191 Gif sur Yvette Cedex (France); Tincani, A. [ENEA – C.R. Brasimone, 40032 Camugnano (Italy)

    2015-10-15

    Highlights: • A DEMO WCLL blanket module thermo-mechanical behaviour has been investigated. • Two models of the WCLL blanket module have been set-up adopting a code based on FEM. • The water flow domain in the module has been considered. • A set of uncoupled steady state thermo-mechanical analyses has been carried out. • Critical temperature is not overcome. Safety verifications are generally satisfied. - Abstract: Within the framework of DEMO R&D activities, a research cooperation has been launched between ENEA, the University of Palermo and CEA to investigate the thermo-mechanical behaviour of the outboard equatorial module of the DEMO1 Water-Cooled Lithium Lead (WCLL) blanket under normal operation steady state scenario. The research campaign has been carried out following a theoretical–computational approach based on the Finite Element Method (FEM) and adopting a qualified commercial FEM code. In particular, two different 3D FEM models (Model 1 and Model 2), reproducing respectively the central and the lateral poloidal–radial slices of the WCLL blanket module, have been set up. A particular attention has been paid to the modelling of water flow domain, within both the segment box channels and the breeder zone tubes, to simulate realistically the coolant-box thermal coupling. Results obtained are herewith reported and critically discussed.

  9. Phase sensitive quantum interference on forbidden transition in ladder scheme

    Koganov, Gennady A

    2014-01-01

    A three level ladder system is analyzed and the coherence of initially electric-dipole forbidden transition is calculated. Due to the presence of two laser fields the initially dipole forbidden transition becomes dynamically permitted due to ac Stark effect. It is shown that such transitions exhibit quantum-interference-related phenomena, such as electromagnetically induced transparency, gain without inversion and enhanced refractive index. Gain and dispersion characteristics of such transitions strongly depend upon the relative phase between the driving and the probe fields. Unlike allowed transitions, gain/absorption behavior of ac-Stark allowed transitions exhibit antisymmetric feature on the Rabi sidebands. It is found that absorption/gain spectra possess extremely narrow sub-natural resonances on these ac Stark allowed forbidden transitions. An interesting finding is simultaneous existence of gain and negative dispersion at Autler-Townes transition which may lead to both reduction of the group velocity a...

  10. High current and low q{sub 95} scenario studies for FAST in the view of ITER and DEMO

    Calabrò, G., E-mail: giuseppe.calabro@enea.it [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044 Frascati, Rome (Italy); Crisanti, F.; Ramogida, G. [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044 Frascati, Rome (Italy); Mantica, P.; Baiocchi, B. [Istituto di Fisica del Plasma ‘P.Caldirola’, Associazione Euratom-ENEA-CNR, Milano (Italy); Cucchiaro, A.; Frosi, P.; Fusco, V. [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044 Frascati, Rome (Italy); Liu, Y. [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Mastrostefano, S.; Villone, F. [Associazione EURATOM/ENEA/CREATE, DIEI, Università di Cassino e del Lazio Meridionale (Italy); Vlad, G. [Associazione Euratom-ENEA sulla Fusione, C.P. 65-I-00044 Frascati, Rome (Italy); Fresa, R. [Associazione Euratom-ENEA-CREATE, DIFA-Univ. della Basilicata, Via dell’Ateneo Lucano, 10 I-85100 Potenza (Italy)

    2013-10-15

    The Fusion Advanced Study Torus (FAST) has been proposed as a possible European satellite, in view of ITER and DEMO, in order to: (a) explore plasma wall interaction in reactor relevant conditions, (b) test tools and scenarios for safe and reliable tokamak operation up to the border of stability, and (c) address fusion plasmas with a significant population of fast particles. A new FAST scenario has been designed focusing on low-q operation, at plasma current I{sub P} = 10 MA, toroidal field B{sub T} = 8.5 T, with a q{sub 95} ≈ 2.3 that would correspond to I{sub P} ≈ 20 MA in ITER. The flat-top of the discharge can last a couple of seconds (i.e. half the diffusive resistive time and twice the energy confinement time), and is limited by the heating of the toroidal field coils. A preliminary evaluation of the end-of-pulse temperatures and of the electromagnetic forces acting on the central solenoid pack and poloidal field coils has been performed. Moreover, a VDE plasma disruption has been simulated and the maximum total vertical force applied on the vacuum vessel has been estimated.

  11. Design of a Multi-Tube Pd-Membrane Module for Tritium Recovery from He in DEMO

    Marco Incelli

    2016-10-01

    Full Text Available Dense self-supported Pd-alloy membranes are used to selectively separate hydrogen and hydrogen isotopes. In particular, deuterium (D and tritium (T are currently identified as the main elements for the sustainability of the nuclear fusion reaction aimed at carbon free power generation. In the fusion nuclear reactors, a breeding blanket produces the tritium that is extracted and purified before being sent to the plasma chamber in order to sustain the fusion reaction. In this work, the application of Pd-alloy membranes has been tested for recovering tritium from a solid breeding blanket through a helium purge stream. Several simulations have been performed in order to optimize the design of a Pd-Ag multi-tube module in terms of geometry, operating parameters, and membrane module configuration (series vs. parallel. The results demonstrate that a pre-concentration stage before the Pd-membrane unit is mandatory because of the very low tritium concentration in the He which leaves the breeding blanket of the fusion reactor. The most suitable operating conditions could be reached by: (i increasing the hydrogen partial pressure in the lumen side and (ii decreasing the shell pressure. The preliminary design of a membrane unit has been carried out for the case of the DEMO fusion reactor: the optimized membrane module consists of an array of 182 Pd-Ag tubes of 500 mm length, 10 mm diameter, and 0.100 mm wall thickness (total active area of 2.85 m2.

  12. Development of Thermal-hydraulic Analysis Methodology for Multi-module Breeding Blankets in K-DEMO

    Kim, Geon-Woo; Lee, Jeong-Hun; Park, Goon-Cherl; Cho, Hyoung-Kyu [Seoul National University, Seoul (Korea, Republic of); Im, Kihak [National Fusion Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    In this paper, the purpose of the analyses is to extend the capability of MARS-KS to the entire blanket system which includes a few hundreds of single blanket modules. Afterwards, the plan for the whole blanket system analysis using MARS-KS is introduced and the result of the multiple blanket module analysis is summarized. A thermal-hydraulic analysis code for a nuclear reactor safety, MARS-KS, was applied for the conceptual design of the K-DEMO breeding blanket thermal analysis. Then, a methodology to simulate multiple blanket modules was proposed, which uses a supervisor program to handle each blanket module individually at first and then distribute the flow rate considering pressure drops arises in each module. For a feasibility test of the proposed methodology, 10 outboard blankets in a toroidal field sector were simulated, which are connected with each other through the inlet and outlet common headers. The calculation results of flow rates, pressure drops, and temperatures showed the validity of the calculation and thanks to the parallelization using MPI, almost linear speed-up could be obtained.

  13. Landscape refuges delay resistance of the European corn borer to Bt-maize: a demo-genetic dynamic model.

    Tyutyunov, Yuri; Zhadanovskaya, Ekaterina; Bourguet, Denis; Arditi, Roger

    2008-08-01

    We constructed a reaction-diffusion model of the development of resistance to transgenic insecticidal Bt crops in pest populations. Kostitzin's demo-genetic model describes local interactions between three competing pest genotypes with alleles conferring resistance or susceptibility to transgenic plants, the spatial spread of insects being modelled by diffusion. This new approach makes it possible to combine a spatial demographic model of population dynamics with classical genetic theory. We used this model to examine the effects of pest dispersal and of the size and shape of the refuge on the efficiency of the "high-dose/refuge" strategy, which was designed to prevent the development of resistance in populations of insect pests, such as the European corn borer, Ostrinia nubilalis Hübner (Lepidoptera, Crambidae). We found that, with realistic combinations of refuge size and pest dispersal, the development of resistance could be considerably delayed. With a small to medium-sized farming area, contiguous refuge plots are more efficient than a larger number of smaller refuge patches. We also show that the formal coupling of classical Fisher-Haldane-Wright population genetics equations with diffusion terms inaccurately describes the development of resistance in a spatially heterogeneous pest population, notably overestimating the speed with which Bt resistance is selected in populations of pests targeted by Bt crops.

  14. Neutronic design studies of a conceptual DCLL fusion reactor for a DEMO and a commercial power plant

    Palermo, I.; Veredas, G.; Gómez-Ros, J. M.; Sanz, J.; Ibarra, A.

    2016-01-01

    Neutronic analyses or, more widely, nuclear analyses have been performed for the development of a dual-coolant He/LiPb (DCLL) conceptual design reactor. A detailed three-dimensional (3D) model has been examined and optimized. The design is based on the plasma parameters and functional materials of the power plant conceptual studies (PPCS) model C. The initial radial-build for the detailed model has been determined according to the dimensions established in a previous work on an equivalent simplified homogenized reactor model. For optimization purposes, the initial specifications established over the simplified model have been refined on the detailed 3D design, modifying material and dimension of breeding blanket, shield and vacuum vessel in order to fulfil the priority requirements of a fusion reactor in terms of the fundamental neutronic responses. Tritium breeding ratio, energy multiplication factor, radiation limits in the TF coils, helium production and displacements per atom (dpa) have been calculated in order to demonstrate the functionality and viability of the reactor design in guaranteeing tritium self-sufficiency, power efficiency, plasma confinement, and re-weldability and structural integrity of the components. The paper describes the neutronic design improvements of the DCLL reactor, obtaining results for both DEMO and power plant operational scenarios.

  15. Spaceborne GNSS reflectometry for ocean winds: First results from the UK TechDemoSat-1 mission

    Foti, Giuseppe; Gommenginger, Christine; Jales, Philip; Unwin, Martin; Shaw, Andrew; Robertson, Colette; Roselló, Josep

    2015-07-01

    First results are presented for ocean surface wind speed retrieval from reflected GPS signals measured by the low Earth orbiting UK TechDemoSat-1 satellite (TDS-1). Launched in July 2014, TDS-1 provides the first new spaceborne Global Navigation Satellite System-Reflectometry (GNSS-R) data since the pioneering UK-Disaster Monitoring Mission (UK-DMC) experiment in 2003. Examples of onboard-processed delay-Doppler maps reveal excellent data quality for winds up to 27.9 m/s. Collocated Advanced Scatterometer (ASCAT) winds are used to develop and evaluate a wind speed algorithm based on signal-to-noise ratio (SNR) and the bistatic radar equation. For SNRs greater than 3 dB, wind speed is retrieved without bias and a precision around 2.2 m/s between 3 and 18 m/s even without calibration. Exploiting lower SNR signals, however, requires good knowledge of the antenna beam, platform attitude, and instrument gain setting. This study demonstrates the capabilities of low-cost, low-mass, and low-power GNSS-R receivers ahead of their launch on the NASA Cyclone GNSS (CYGNSS) constellation in 2016.

  16. Potential and limits of water cooled divertor concepts based on monoblock design as possible candidates for a DEMO reactor

    Li-Puma, Antonella, E-mail: antonella.lipuma@cea.fr [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Richou, Marianne; Magaud, Philippe; Missirlian, Marc [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Visca, Eliseo [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, IT-00044 Frascati (Italy); Ridolfini, Vincenzo Pericoli [EFDA-CSU Garching, PPPT department, D-85748 Garching bei München (Germany)

    2013-10-15

    In this paper water-cooled divertor concepts based on tungsten monoblock design identified in previous studies as candidate for fusion power plant have been reviewed to assess their potential and limits as possible candidates for a DEMO concept deliverable in a short to medium term (“conservative baseline design”). The rationale and technology development assumptions that have led to their selection are revisited taking into account present factual information on reactor parameters, materials properties and manufacturing technologies. For that purpose, main parameters impacting the divertor design are identified and their relevance discussed. The state of the art knowledge on materials and relevant manufacturing techniques is reviewed. Particular attention is paid to material properties change after irradiation; phenomenon thresholds (if any) and possible operating ranges are identified (in terms of temperature and damage dose). The suitability of various proposed heat sink/structural and sacrificial layer materials, as proposed in the past, are re-assessed (e.g. with regard to the possibility of reducing peak heat flux and/or neutron radiation damages). As a result, potential and limits of various proposed concepts are highlighted, ranges in which they could operate (if any) defined and possible improvements are proposed. Identified missing point in materials database and/or manufacturing techniques knowledge that should be uppermost investigated in future R and D activities are reported. This work has been carried out in the frame of EFDA PPPT Work Programme activities.

  17. Hopping models and ac universality

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  18. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  19. AC410 Unit 9 Assignment

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  20. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  1. AcEST: BP917259 [AcEST

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  2. AcEST: BP921446 [AcEST

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  3. AcEST: DK943932 [AcEST

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  4. AcEST: DK963222 [AcEST

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  5. AcEST: DK953266 [AcEST

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  6. On radio frequency current drive in the ion cyclotron range of frequencies in DEMO and large ignited plasmas

    Brambilla, Marco; Bilato, Roberto

    2015-02-01

    To explore the possibility of efficient fast wave current drive in an ignited plasma in the ion cyclotron (IC) range of frequency in spite of competition from absorption by ions, we have added to the full-wave toroidal code TORIC a set of subroutines which evaluate absorption by these particles at IC harmonic resonances, using a realistic ‘slowing-down’ distribution function, and taking into account that their Larmor radius is comparable or even larger than the fast wave wavelength. The thermalized population of α-particles is not a serious competitor for power absorption as long as their number density is compatible with maintenance of ignition. By contrast, the energetic slowing down fraction, in spite of its even greater dilution, can absorb from the waves a substantial amount of power at the cyclotron resonance and its harmonics. An extensive exploration both in frequency and in toroidal wavenumbers using the parameters of one of the European versions of DEMO shows that three frequency windows exist in which damping is nevertheless predominantly on the electrons. Designing an antenna capable of shaping the launched spectrum to optimize current drive, however, will not be straightforward. Only in a narrow range when the first IC harmonic of tritium is deep inside the plasma on the high-field side of the magnetic axis, and that of deuterium and helium is still outside on the low-field side, it appears possible to achieve a satisfactory current drive efficiency with a conventional multi-strap antenna, preferentially located in the upper part of the vessel. Exploiting the other two windows at quite low and quite high frequencies is either impossible on first principles, or will demand novel ideas in antenna design.

  7. Current generation by helicons and LH waves in modern tokamaks and reactors FNSF-AT, ITER and DEMO. Scenarios, modeling and antennae

    Vdovin, V.

    2014-02-01

    The Innovative concept and 3D full wave code modeling Off-axis current drive by RF waves in large scale tokamaks, reactors FNSF-AT, ITER and DEMO for steady state operation with high efficiency was proposed [1] to overcome problems well known for LH method [2]. The scheme uses the helicons radiation (fast magnetosonic waves at high (20-40) IC frequency harmonics) at frequencies of 500-1000 MHz, propagating in the outer regions of the plasmas with a rotational transform. It is expected that the current generated by Helicons will help to have regimes with negative magnetic shear and internal transport barrier to ensure stability at high normalized plasma pressure βN > 3 (the so-called Advanced scenarios) of interest for FNSF and the commercial reactor. Modeling with full wave three-dimensional codes PSTELION and STELEC2 showed flexible control of the current profile in the reactor plasmas of ITER, FNSF-AT and DEMO [2,3], using multiple frequencies, the positions of the antennae and toroidal waves slow down. Also presented are the results of simulations of current generation by helicons in tokamaks DIII-D, T-15MD and JT-60SA [3]. In DEMO and Power Plant antenna is strongly simplified, being some analoge of mirrors based ECRF launcher, as will be shown. For spherical tokamaks the Helicons excitation scheme does not provide efficient Off-axis CD profile flexibility due to strong coupling of helicons with O-mode, also through the boundary conditions in low aspect machines, and intrinsic large amount of trapped electrons, as is shown by STELION modeling for the NSTX tokamak. Brief history of Helicons experimental and modeling exploration in straight plasmas, tokamaks and tokamak based fusion Reactors projects is given, including planned joint DIII-D - Kurchatov Institute experiment on helicons CD [1].

  8. Multiple Module Simulation of Water Cooled Breeding Blankets in K-DEMO Using Thermal-Hydraulic Analysis Code MARS-KS

    Kim, Geon-Woo; Lee, Jeong-Hun; Park, Goon-Cherl; Cho, Hyoung-Kyu [Seoul National University, Seoul (Korea, Republic of); Im, Kihak [National Fusion Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    A preliminary concept for the Korean fusion demonstration reactor (K-DEMO) has been studied by the National Fusion Research Institute (NFRI) based on the National Fusion Roadmap of Korea. The feasibility studies have been performed in order to establish the conceptual design guidelines of the breeding blanket. As a part of the NFRI research, Seoul National University (SNU) is conducting thermal design, evaluation and validation of the water-cooled breeding blanket for the K-DEMO reactor. The purpose of this study is to extend the capability of MARS-KS to the overall blanket system analysis which includes 736 blanket modules in total. The strategy for the multi-module blanket system analysis using MARS-KS is introduced and the analysis result of the 46 blanket modules of single sector was summarized. A thermal-hydraulic analysis code for a nuclear reactor safety, MARS-KS, was applied for thermal analysis of the conceptual design of the K-DEMO breeding blanket. Then, a methodology to simulate multiple blanket modules was proposed, which uses a supervisor program to handle each blanket module individually at first and then distribute the flow rate considering the pressure drop that occurs in each module. For a feasibility test of the proposed methodology, 46 blankets in a sector, which are connected with each other through the common headers for the sector inlet and outlet, were simulated. The calculation results of flow rates, pressure drops, and temperatures showed the validity of the calculation. Because of parallelization using the MPI system, the computational time could be reduced significantly. In future, this methodology will be extended to an efficient simulation of multiple sectors, and further validation for transient simulation will be carried out for more practical applications.

  9. 聚变示范堆气体注入系统氚渗透分析%Tritium permeation of gas injection system for DEMO

    王俊; 张国书; 张龙

    2014-01-01

    以中国聚变工程实验堆(CFETR)的堆芯参数为例,参照ITER的相关工程设计,对聚变示范堆(DEMO)气体注入系统(GIS)作出了初步的管道布局考虑。基于此布局,计算了稳态运行下 GIS 含氚管道气流压降,对燃料储存与输运系统的泵压头提出了要求,得出相应泵压头下GIS的氚渗透量。计算结果表明,重力势是管道气流压降的主要原因,在负压情况下,GIS的氚渗透对整体氚循环的影响不大。这为研究DEMO的氚自持问题提供了相关参数,为GIS歧管布局的进一步优化奠定了基础。%In the present work, tritium permeation issue of gas injection system (GIS) in DEMO were focused. Based on the reactor core parameters of Chian Fusion Engineering Test Reactor (CFETR) and referring to accumulated experience of GIS design in ITER, preliminary pipes layout of DEMO GIS was performed. Steady-state tritium gas pressure drop calculation along the pipes and pump head request to the fuel storage and delivery system were made on the basis of the GIS’s structure layout. Tritium permeation under corresponding pump head was calculated at the same time. According to the calculation results, gravitational potential is the main determinant to pressure drop in pipe flow and the tritium permeation in GIS is of little amount to the whole tritium cycle in the case negative pressure. So this work offers related parameters to tritium self-sufficiency issues in DEMO, and also lays the foundation for further optimization of GIS’s structure layout.

  10. Magic Wavelength for Hydrogen 1S-2S Transition

    Kawasaki, Akio

    2015-01-01

    The magic wavelength for an optical lattice for hydrogen atoms that cancels the first order AC Stark shift of 1S-2S transition is calculated to be 513 nm. The amount of AC Stark shift $ \\Delta E = -1.19$ kHz/(10kW/cm$^2$) and the slope $d\\Delta E/d \

  11. AcEST: DK954361 [AcEST

    Full Text Available nin T, cardiac muscle OS=Homo sapiens... 35 0.27 sp|P98193|DMP1_RAT Dentin matrix...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac...EEDAEAEAETEETRAEEDEEEEEAKEAEDG 68 Query: 329 PADQETP 349 P ++ P Sbjct: 69 PMEESKP 75 >sp|P98193|DMP1_RAT Dentin

  12. AcEST: DK956827 [AcEST

    Full Text Available n, cytoplasmic 1 OS=Salmo salar GN=AC... 389 e-107 tr|B3TH90|B3TH90_POERE Beta-actin OS=Poecilia reticulata ...PE=2 SV=1 389 e-107 tr|B3TH89|B3TH89_POERE Beta-actin OS=Poecilia reticulata PE=4 SV=1 389 e-107 tr|B3GLI4|B

  13. AcEST: DK943965 [AcEST

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  14. AC dynamometer; Koryu dinamo meter

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  15. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  16. DEMO-II trial. Aerobic exercise versus stretching exercise in patients with major depression-a randomised clinical trial.

    Jesper Krogh

    Full Text Available BACKGROUND: The effect of referring patients from a clinical setting to a pragmatic exercise intervention for depressive symptoms, cognitive function, and metabolic variables has yet to be determined. METHODS: Outpatients with major depression (DSM-IV were allocated to supervised aerobic or stretching exercise groups during a three months period. The primary outcome was the Hamilton depression score (HAM-D(17. Secondary outcomes were cognitive function, cardiovascular risk markers, and employment related outcomes. RESULTS: 56 participants were allocated to the aerobic exercise intervention versus 59 participants to the stretching exercise group. Post intervention the mean difference between groups was -0.78 points on the HAM-D(17 (95% CI -3.2 to 1.6; P = .52. At follow-up, the participants in the aerobic exercise group had higher maximal oxygen uptake (mean difference 4.4 l/kg/min; 95% CI 1.7 to 7.0; P = .001 and visuospatial memory on Rey's Complex Figure Test (mean difference 3.2 points; 95% CI 0.9 to 5.5; P = .007 and lower blood glucose levels (mean difference 0.2 mmol/l; 95% CI 0.0 to 0.5; P = .04 and waist circumference (mean difference 2.2 cm; 95% CI 0.3 to 4.1; P = .02 compared with the stretching exercise group. CONCLUSIONS: The results of this trial does not support any antidepressant effect of referring patients with major depression to a three months aerobic exercise program. Due to lower recruitment than anticipated, the trial was terminated prior to reaching the pre-defined sample size of 212 participants; therefore the results should be interpreted in that context. However, the DEMO-II trial does suggest that an exercise program for patients with depression offer positive short-term effects on maximal oxygen uptake, visuospatial memory, fasting glucose levels, and waist circumference. TRIAL REGISTRATION: ClinicalTrials.gov NCT00695552.

  17. TBM/MTM for HTS-FNSF: An Innovative Testing Strategy to Qualify/Validate Fusion Technologies for U.S. DEMO

    Laila El-Guebaly

    2016-08-01

    Full Text Available The qualification and validation of nuclear technologies are daunting tasks for fusion demonstration (DEMO and power plants. This is particularly true for advanced designs that involve harsh radiation environment with 14 MeV neutrons and high-temperature operating regimes. This paper outlines the unique qualification and validation processes developed in the U.S., offering the only access to the complete fusion environment, focusing on the most prominent U.S. blanket concept (the dual cooled PbLi (DCLL along with testing new generations of structural and functional materials in dedicated test modules. The venue for such activities is the proposed Fusion Nuclear Science Facility (FNSF, which is viewed as an essential element of the U.S. fusion roadmap. A staged blanket testing strategy has been developed to test and enhance the DCLL blanket performance during each phase of FNSF D-T operation. A materials testing module (MTM is critically important to include in the FNSF as well to test a broad range of specimens of future, more advanced generations of materials in a relevant fusion environment. The most important attributes for MTM are the relevant He/dpa ratio (10–15 and the much larger specimen volumes compared to the 10–500 mL range available in the International Fusion Materials Irradiation Facility (IFMIF and European DEMO-Oriented Neutron Source (DONES.

  18. Constituting the polity, constituting the demos: on the place of the all affected interests principle in democratic theory and in resolving the democratic boundary problem

    David Owen

    2012-09-01

    Full Text Available This essay considers the role of the ‘all affected interests’ principle in democratic theory, focusing on debates concerning its form, substance and relationship to the resolution of the democratic boundary problem. It begins by defending an ‘all actually affected’ formulation of the principle against Goodin's ‘incoherence argument’ critique of this formulation, before addressing issues concerning how to specify the choice set appropriate to the principle. Turning to the substance of the principle, the argument rejects Nozick's dismissal of its intuitive appeal and considers the two arguments advanced in favour of the principle as a criterion of democratic inclusion: the interlinked interests argument and the tracking power argument. It is shown that neither of these arguments can substantiate a view of the principle as a criterion of democratic inclusion, although both ground a constitutional understanding of the principle as specifying the scope of a duty of justification. It is then proposed that the principle can play an important role in a two-stage resolution of the democratic boundary problem in which it addresses the question of who is entitled to inclusion in the ‘pre-political’ demos that determines whether to constitute a polity. The second stage of this resolution requires an answer to the question of who should constitute the ‘political demos’, that is, the demos of a constituted polity and it is argued that a version of the “all subjected persons” principle can appropriately play this role.

  19. Normal and Accidental Scenarios Analyses with MELCOR 1.8.2 and MELCOR 2.1 for the DEMO Helium-Cooled Pebble Bed Blanket Concept

    Bruno Gonfiotti

    2015-01-01

    Full Text Available As for Light Water Reactors (LWRs, one of the most challenging accidents for the future DEMOnstration power plant is the Loss of Coolant Accident, which can trigger the pressurization of the confinement structures and components. Hence, careful analyses have to be executed to demonstrate that the confinement barriers are able to withstand the pressure peak within design limits and the residual cooling capabilities of the Primary Heat Transfer System are sufficient to remove the decay heat. To do so, severe accident codes, as MELCOR, can be employed. In detail, the MELCOR code has been developed to cope also with fusion reactors, but unfortunately, these fusion versions are based on the old 1.8.x source code. On the contrary, for LWRs, the newest 2.1.x versions are continuously updated. Thanks to the new features introduced in these latest 2.1.x versions, the main phenomena occurring in the helium-cooled blanket concepts of DEMO can be simulated in a basic manner. For this purpose, several analyses during normal and accidental DEMO conditions have been executed. The aim of these analyses is to compare the results obtained with MELCOR 1.8.2 and MELCOR 2.1 in order to highlight the differences among the results of the main thermal-hydraulic parameters.

  20. Developing structural, high-heat flux and plasma facing materials for a near-term DEMO fusion power plant: The EU assessment

    Stork, D.; Agostini, P.; Boutard, J. L.; Buckthorpe, D.; Diegele, E.; Dudarev, S. L.; English, C.; Federici, G.; Gilbert, M. R.; Gonzalez, S.; Ibarra, A.; Linsmeier, Ch.; Li Puma, A.; Marbach, G.; Morris, P. F.; Packer, L. W.; Raj, B.; Rieth, M.; Tran, M. Q.; Ward, D. J.; Zinkle, S. J.

    2014-12-01

    The findings of the EU 'Materials Assessment Group' (MAG), within the 2012 EU Fusion Roadmap exercise, are discussed. MAG analysed the technological readiness of structural, plasma facing and high heat flux materials for a DEMO concept to be constructed in the early 2030s, proposing a coherent strategy for R&D up to a DEMO construction decision. A DEMO phase I with a 'Starter Blanket' and 'Starter Divertor' is foreseen: the blanket being capable of withstanding ⩾2 MW yr m-2 fusion neutron fluence (∼20 dpa in the front-wall steel). A second phase ensues for DEMO with ⩾5 MW yr m-2 first wall neutron fluence. Technical consequences for the materials required and the development, testing and modelling programmes, are analysed using: a systems engineering approach, considering reactor operational cycles, efficient maintenance and inspection requirements, and interaction with functional materials/coolants; and a project-based risk analysis, with R&D to mitigate risks from material shortcomings including development of specific risk mitigation materials. The DEMO balance of plant constrains the blanket and divertor coolants to remain unchanged between the two phases. The blanket coolant choices (He gas or pressurised water) put technical constraints on the blanket steels, either to have high strength at higher temperatures than current baseline variants (above 650 °C for high thermodynamic efficiency from He-gas coolant), or superior radiation-embrittlement properties at lower temperatures (∼290-320 °C), for construction of water-cooled blankets. Risk mitigation proposed would develop these options in parallel, and computational and modelling techniques to shorten the cycle-time of new steel development will be important to achieve tight R&D timescales. The superior power handling of a water-cooled divertor target suggests a substructure temperature operating window (∼200-350 °C) that could be realised, as a baseline-concept, using tungsten on a copper

  1. Developing structural, high-heat flux and plasma facing materials for a near-term DEMO fusion power plant: The EU assessment

    Stork, D., E-mail: derek.stork@btinternet.com [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Agostini, P. [ENEA, Brasimone Research Centre, 40032 Cumugnano, Bologna (Italy); Boutard, J.L. [CEA, cab HC, Saclay, F-91191 Gif-sur-Yvette (France); Buckthorpe, D. [AMEC, Booths Park, Chelford Road, Knutsford, Cheshire WA16 8QZ (United Kingdom); Diegele, E. [Karlsruhe Institute for Technology, IMF-I, D-7602 Karlsruhe (Germany); Dudarev, S.L. [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); English, C. [National Nuclear Laboratory, Chadwick House, Warrington Road, Birchwood Park WA3 6AE (United Kingdom); Federici, G. [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching 85748 (Germany); Gilbert, M.R. [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Gonzalez, S. [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching 85748 (Germany); Ibarra, A. [CIEMAT, Avda. Complutense 40, Madrid (Spain); Linsmeier, Ch. [Forschungszentrum Jülich GmbH, Institut für Energie- und Klimaforschung – Plasmaphysik, EURATOM Association, 52425 Jülich (Germany); Li Puma, A. [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Marbach, G. [CEA, cab HC, Saclay, F-91191 Gif-sur-Yvette (France); Morris, P.F. [Formerly of TATA Steel Europe, Swinden Technology Centre, Moorgate, Rotherham S60 3AR (United Kingdom); Packer, L.W. [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Raj, B. [Indian National Academy of Engineering, Shaheed Jeet Singh Marg, New Delhi 110016 (India); Rieth, M. [Karlsruhe Institute for Technology, IMF-I, D-7602 Karlsruhe (Germany); and others

    2014-12-15

    The findings of the EU ‘Materials Assessment Group’ (MAG), within the 2012 EU Fusion Roadmap exercise, are discussed. MAG analysed the technological readiness of structural, plasma facing and high heat flux materials for a DEMO concept to be constructed in the early 2030s, proposing a coherent strategy for R and D up to a DEMO construction decision. A DEMO phase I with a ‘Starter Blanket’ and ‘Starter Divertor’ is foreseen: the blanket being capable of withstanding ⩾2 MW yr m{sup −2} fusion neutron fluence (∼20 dpa in the front-wall steel). A second phase ensues for DEMO with ⩾5 MW yr m{sup −2} first wall neutron fluence. Technical consequences for the materials required and the development, testing and modelling programmes, are analysed using: a systems engineering approach, considering reactor operational cycles, efficient maintenance and inspection requirements, and interaction with functional materials/coolants; and a project-based risk analysis, with R and D to mitigate risks from material shortcomings including development of specific risk mitigation materials. The DEMO balance of plant constrains the blanket and divertor coolants to remain unchanged between the two phases. The blanket coolant choices (He gas or pressurised water) put technical constraints on the blanket steels, either to have high strength at higher temperatures than current baseline variants (above 650 °C for high thermodynamic efficiency from He-gas coolant), or superior radiation-embrittlement properties at lower temperatures (∼290–320 °C), for construction of water-cooled blankets. Risk mitigation proposed would develop these options in parallel, and computational and modelling techniques to shorten the cycle-time of new steel development will be important to achieve tight R and D timescales. The superior power handling of a water-cooled divertor target suggests a substructure temperature operating window (∼200–350 °C) that could be realised, as a

  2. DC and AC transport properties on La0.8Sr0.2MnO3

    Zhantao Wei; Xinsheng Yang; Li Lv; Min Zhang; Yong Zhang

    2014-01-01

    Magnetoresistive sensor can be widely used in modern transportation field, such as the vehicle positioning and navigation system, vehicle detection system, and intelligent transportation system. In order to improve the efficiency of magnetoresistive sensor, we synthesized La0.8Sr0.2MnO3 polycrystalline bulks at different sintering temperatures and investigated their DC and AC transport properties in this work. As a result, all samples showed insulator-metal (I-M) phase transition, and the transition temperature (TI-M) shifted to higher temperature with the increase of sintering temperature. The TI-M measured at different AC frequencies was smaller than that measured at DC condition, which implied that the I-M phase transition was suppressed at AC frequencies. The resistivity mea-sured at high AC frequencies was larger than that measured at low AC frequencies, which could be attributed to the change of the magnetic penetration depth (d). However, the room-temperature AC-magnetoresistance (MR) at low frequencies was much larger than that at high frequencies and room-temperature DC-MR. These findings demon-strate that reducing the AC frequency is an effective way for enhancing the room-temperature MR, which can be used to promote the efficiency of magnetoresistive sensor.

  3. AcEST: DK943968 [AcEST

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  4. AcEST: DK954735 [AcEST

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  5. A DEVICE FOR MEASURING SUPERCONDUCTING TRANSITION TEMPERATURE BY AC SUSCEPTIBILITY MEASUREMENT OF SUPERCONDUCTING FILM IN SMALL ^* CRYOCOOLER%在小型制冷机中测量薄片交流磁化率以决定超导转变温度的装置

    褚向华; 王三胜; 杨慧; 陈笃行

    2012-01-01

    In this paper, a device for measuring superconducting transition temperature in small cryocooler, based on principles of electromagnetic induction and superconducting magnetic effect, is introduced. This device consists of a vacuum chamber, a small cryocooler, a vacuum pump, a vacuum gauge, a lock-in amplifier, a temperature controller, a computer and a coil pancake and so on. The coil pancake, which is fixed in the vacuum claamoer, contains a primary coil and secondary coil, the primary coil and secondary coil are respectively wound onto two coil formers. The measured superconducting thin film is put between the primary coil and the secondary coil. The small cryocooler is used to cool superconducting thin film, the vacuum pump is used to pump gas in the vacuum chamber, and the temperature controller is used to measure and control the temperature of superconducting thin filro. The internal oscillator of the lock-in amplifier is connected to the primary coil to provide an excitation field exerted to the superconducting film. At the same time, the lock-in amplifier is used to measure the response of the secondary coil. In our system, the sample temperature datum and the voltage output of the secondary coil are transmitted and saved in the computer; then these datum can be drawn into V--T lines displayed on the computer screen at real time. Experiments show that this device can be used to obtain superconducting transition temperature automatically by measuring ac susceptibility with a lower cost.%本文介绍了一种利用电磁感应原理和超导磁效应,在小型制冷机中测量超导体转变温度的装置.本装置包括密闭的真空室、压缩制冷机、真空泵、真空计、锁相放大器、温控仪、计算机、线圈绕组.其中,线圈绕组置于真空室内,由初级线圈和次级线圈组成,初级线圈和次级线圈分别绕制在两个线圈骨架上;被测超导薄片材料放置于初级线圈和次级线圈之间

  6. Demo III Operational Concept

    2007-11-02

    Mounted /Unmounted, Manned/Unmanned) Performance Goals 3 ISO 9001 Certified Game Plan Technology Development Modeling & Simulation Test Bed Integration 99 00... Powertrain • 78 Hp VW Turbo Diesel Engine • 70 GPM Sunstrand Hydrostatic Pump • Pump Drive Sized for 4300 RPM and 2500 RPM Engine Speeds • 15 Cu In...Planning & Simulation OCU/XUV Cooperative Mobility Controller (Wingman) AMS RSTA Platoon-level Mission Execution Section-level Mission Execution Vehicle

  7. Construct Demo Input Deck

    2010-06-01

    agents more or less likely to interact in order to capture differences in factors such as seniority, career type, introversion , or other factors which... Intelligence Modeling Conference. Oak Ridge National Laboratory, TN Krackhardt D, Carley K. 1998. A PCANS Model of Structure in Organization. In

  8. Doppler dart demo

    Marry, Stephanie

    2015-01-01

    During last summer at Barrington High School, I taught a course in a summer bridge program designed to prepare students for physics. As an element of the course, students were asked to design a quantitative lab relating to something they enjoyed doing outside of school. The project required students to collect data, observe the effects of changing one variable, and present their conclusions. One group of students chose to determine the best method for completing timed paintball target practice courses. They wanted to see how firing a paint gun while moving toward and away from the target would affect the time required to complete the course. To answer these questions they decided to employ two automatic 18-dart Nerf® guns and a skateboard. Two experiments were performed, one with the student firing the dart gun while riding the skateboard toward the target and one with him firing the dart gun while riding the skateboard away from the target (Fig. 1). (Note: Teachers should inform their school administrators of their intent to use toy guns in class.)

  9. The DEMO Quasisymmetric Stellarator

    McFadden, Geoffrey B.; Garabedian, Paul R.

    2010-01-01

    The NSTAB nonlinear stability code solves differential equations in conservation form, and the TRAN Monte Carlo test particle code tracks guiding center orbits in a fixed background, to provide simulations of equilibrium, stability, and transport in tokamaks and stellarators. These codes are well correlated with experimental observations and have been validated by convergence studies. Bifurcated 3D solutions of the 2D tokamak problem have been calculated that model persistent disruptions, neo...

  10. KBSA Concept Demo

    1993-04-01

    93-38 has been reviewed and is approved for publication. DONALD M. ELEFANTE Project Engineer FOR THE COMMANDER: •ER Chief Scientist Command, Control...NOTES Rome Laboratory Project Engineer: Donald M. Elefante /C3CA/(315)330-3565. 12a. DISTRIBUTION/AVAILABILUTY STATEMENT 12b. DISTRIBUTION CODE...organizations and people: "* Rome Laboratory: Don Elefante , Doug White, Frank Sliwa, Nancy Roberts, Joe Carozzoni, and Lou Hoebel. "* Andersen

  11. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  12. Shape Dependence of Low-Temperature Magnetic Relaxation of Mn12Ac

    LIU Hai-Qing; SU Shao-Kui; JING Xiu-nian; LIU Ying; LI Yan-rong; HE Lun-Hua; GE Pei-Wen; YAN Qi-Wei; WANG Yun-Ping

    2008-01-01

    We report the discovery that the low-temperature magnetic relaxation in Mn,12 Ac single crystals strongly depends on the shape of the samples. The relaxation time exhibits a minimum at the phase transition point between ferromagnetic and antiferromagnetic phases. The shape dependence is attributed to the dipolar interaction between molecular magnets.

  13. Universality of ac conduction in disordered solids

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...

  14. Silencing of Two Insulin Receptor Genes Disrupts Nymph-Adult Transition of Alate Brown Citrus Aphid

    Ding, Bi-Yue; Shang, Feng; Zhang, Qiang; Xiong, Ying; Yang, Qun; Niu, Jin-Zhi; Smagghe, Guy; Wang, Jin-Jun

    2017-01-01

    Insulin receptors play key roles in growth, development, and polymorphism in insects. Here, we report two insulin receptor genes (AcInR1 and AcInR2) from the brown citrus aphid, Aphis (Toxoptera) citricidus. Transcriptional analyses showed that AcInR1 increased during the nymph–adult transition in alate aphids, while AcInR2 had the highest expression level in second instar nymphs. AcInR1 is important in aphid development from fourth instar nymphs to adults as verified by dsRNA feeding mediated RNAi. The silencing of AcInR1 or/and AcInR2 produced a variety of phenotypes including adults with normal wings, malformed wings, under-developed wings, and aphids failing to develop beyond the nymphal stages. Silencing of AcInR1 or AcInR2 alone, and co-silencing of both genes, resulted in 73% or 60%, and 87% of aphids with problems in the transition from nymph to normal adult. The co-silencing of AcInR1 and AcInR2 resulted in 62% dead nymphs, but no mortality occurred by silencing of AcInR1 or AcInR2 alone. Phenotypes of adults in the dsInR1 and dsInR2 were similar. The results demonstrate that AcInR1 and AcInR2 are essential for successful nymph–adult transition in alate aphids and show that RNAi methods may be useful for the management of this pest. PMID:28230772

  15. Anomalous behavior of magnetostriction and magnetic ac-suseptibility of Gd1-xPrxCo5 polycrystals

    A. Amirabadizadeh

    2003-12-01

    Full Text Available Magnetostriction and low field ac-susceptibility of polycrystalline Gd1-xPrxCo5 (x = 0, 0.1 and 0.5 alloys are measured in temperature region of 77-300 K. XRD patterns show that our samples are single phase. For x = 0 (GdCo5 there are no anomaly in temperature dependence of magnetostriction and ac-susceptibility curves. For x = 0.1 and 0.5 temperature dependence of ac-susceptibilities show easy-axes phase transitions. In the case of x = 0.1 sample, the easy-axes of magnetization changes from canted to axial (practically, hexagonal c-axis direction as temperature increases, and ac-susceptibility of x = 0.5 sample shows two iterative transitions, first from basal to canted then canted to axial. Magnetostriction of Pr contained samples anomalously decreases at spin reorientation regions.

  16. Examining the Link Between Public Transit Use and Active Commuting

    Melissa Bopp

    2015-04-01

    Full Text Available Background: An established relationship exists between public transportation (PT use and physical activity. However, there is limited literature that examines the link between PT use and active commuting (AC behavior. This study examines this link to determine if PT users commute more by active modes. Methods: A volunteer, convenience sample of adults (n = 748 completed an online survey about AC/PT patterns, demographic, psychosocial, community and environmental factors. t-test compared differences between PT riders and non-PT riders. Binary logistic regression analyses examined the effect of multiple factors on AC and a full logistic regression model was conducted to examine AC. Results: Non-PT riders (n = 596 reported less AC than PT riders. There were several significant relationships with AC for demographic, interpersonal, worksite, community and environmental factors when considering PT use. The logistic multivariate analysis for included age, number of children and perceived distance to work as negative predictors and PT use, feelings of bad weather and lack of on-street bike lanes as a barrier to AC, perceived behavioral control and spouse AC were positive predictors. Conclusions: This study revealed the complex relationship between AC and PT use. Further research should investigate how AC and public transit use are related.

  17. RHIC spin flipper AC dipole controller

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  18. AcEST: DK956298 [AcEST

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  19. AcEST: DK959751 [AcEST

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  20. AcEST: BP920842 [AcEST

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  1. Cluster emission in the radioactive decay of 223Ac

    Steyn, G F; Faccio, D; Bonetti, R; Tretyakova, S P; Shishkin, S V; Ogloblin, A A; Pik-Pichak, G A; Vermeulen, C; van der Meulen, N P; van der Walt, T N; McGee, D

    2010-01-01

    The branching ratio of 223Ac decay by spontaneous 14C emission was measured and a search for 15N clusters was performed. After exposure of a hemispherical array of solid-state nuclear track detectors, 347 14C events were identified and no 15N events. B(14C) = λ(14C)/λ(α) = (3.2 ± 1.0) x 10-11 is consistent with a favoured ground state to ground state transition. As no nitrogen tracks were found, only an upper limit could be inferred for 15N emission, B(15N) = λ(15N)/λ(α) ≤ 2.2 x 10-13 (confidence limit 90%), consistent with an unfavoured transition. Intense 227Pa sources were produced for this study, using the reaction 232Th(p,6n)227Pa. This offered an opportunity to compare the measured source strength with predictions based on published excitation function data.

  2. The DEMO trial: a randomized, parallel-group, observer-blinded clinical trial of strength versus aerobic versus relaxation training for patients with mild to moderate depression

    Krogh, Jesper; Saltin, Bengt; Gluud, Christian

    2009-01-01

    OBJECTIVE: To assess the benefit and harm of exercise training in adults with clinical depression. METHOD: The DEMO trial is a randomized pragmatic trial for patients with unipolar depression conducted from January 2005 through July 2007. Patients were referred from general practitioners......: Our findings do not support a biologically mediated effect of exercise on symptom severity in depressed patients, but they do support a beneficial effect of strength training on work capacity. TRIAL REGISTRATION: (ClinicalTrials.gov) Identifier: NCT00103415....... or psychiatrists and were eligible if they fulfilled the International Classification of Diseases, Tenth Revision, criteria for unipolar depression and were aged between 18 and 55 years. Patients (N = 165) were allocated to supervised strength, aerobic, or relaxation training during a 4-month period. The primary...

  3. An Assessment of the Penetrations in the First Wall Required for Plasma Measurments for Control of an Advanced Tokamak Plasma Demo

    Kenneth M. Young

    2010-02-22

    A Demonstration tokamak (Demo) is an essential next step toward a magnetic-fusion based reactor. One based on advanced-tokamak (AT) plasmas is especially appealing because of its relative compactness. However, it will require many plasma measurements to provide the necessary signals to feed to ancillary systems to protect the device and control the plasma. This note addresses the question of how much intrusion into the blanket system will be required to allow the measurements needed to provide the information required for plasma control. All diagnostics will require, at least, the same shielding designs as planned for ITER, while having the capability to maintain their calibration through very long pulses. Much work is required to define better the measurement needs and the quantity and quality of the measurements that will have to be made, and how they can be integrated into the other tokamak structures.

  4. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  5. R&D around a photoneutralizer-based NBI system (Siphore) in view of a DEMO Tokamak steady state fusion reactor

    Simonin, A.; Achard, Jocelyn; Achkasov, K.; Bechu, S.; Baudouin, C.; Baulaigue, O.; Blondel, C.; Boeuf, J. P.; Bresteau, D.; Cartry, G.; Chaibi, W.; Drag, C.; de Esch, H. P. L.; Fiorucci, D.; Fubiani, G.; Furno, I.; Futtersack, R.; Garibaldi, P.; Gicquel, A.; Grand, C.; Guittienne, Ph.; Hagelaar, G.; Howling, A.; Jacquier, R.; Kirkpatrick, M. J.; Lemoine, D.; Lepetit, B.; Minea, T.; Odic, E.; Revel, A.; Soliman, B. A.; Teste, P.

    2015-11-01

    Since the signature of the ITER treaty in 2006, a new research programme targeting the emergence of a new generation of neutral beam (NB) system for the future fusion reactor (DEMO Tokamak) has been underway between several laboratories in Europe. The specifications required to operate a NB system on DEMO are very demanding: the system has to provide plasma heating, current drive and plasma control at a very high level of power (up to 150 MW) and energy (1 or 2 MeV), including high performances in term of wall-plug efficiency (η  >  60%), high availability and reliability. To this aim, a novel NB concept based on the photodetachment of the energetic negative ion beam is under study. The keystone of this new concept is the achievement of a photoneutralizer where a high power photon flux (~3 MW) generated within a Fabry-Perot cavity will overlap, cross and partially photodetach the intense negative ion beam accelerated at high energy (1 or 2 MeV). The aspect ratio of the beam-line (source, accelerator, etc) is specifically designed to maximize the overlap of the photon beam with the ion beam. It is shown that such a photoneutralized based NB system would have the capability to provide several tens of MW of D0 per beam line with a wall-plug efficiency higher than 60%. A feasibility study of the concept has been launched between different laboratories to address the different physics aspects, i.e. negative ion source, plasma modelling, ion accelerator simulation, photoneutralization and high voltage holding under vacuum. The paper describes the present status of the project and the main achievements of the developments in laboratories.

  6. Simulational studies of epitaxial semiconductor superlattices: Quantum dynamical phenomena in ac and dc electric fields

    Reynolds, Joseph [Iowa State Univ., Ames, IA (United States)

    1997-10-08

    Using high-accuracy numerical methods the author investigates the dynamics of independent electrons in both ideal and realistic superlattices subject to arbitrary ac and/or dc electric fields. For a variety of superlattice potentials, optically excited initial wave packets, and combinations of ac and dc electric fields, he numerically solves the time-dependent Schroedinger equation. In the case of ideal periodic superlattice potentials, he investigates a long list of dynamical phenomena involving multiple miniband transitions and time-dependent electric fields. These include acceleration effects associated with interminiband transitions in strong fields, Zener resonances between minibands, dynamic localization with ac fields, increased single-miniband transport with an auxiliary resonant ac field, and enhanced or suppressed interminiband probability exchange using an auxiliary ac field. For all of the cases studied, the resulting time-dependent wave function is analyzed by projecting the data onto convenient orthonormal bases. This allows a detailed comparison with approximately analytic treatments. In an effort to explain the rapid decay of experimentally measured Bloch oscillation (BO) signals the author incorporates a one-dimensional representation of interface roughness (IR) into their superlattice potential. He shows that as a result of IR, the electron dynamics can be characterized in terms of many discrete, incommensurate frequencies near the Block frequency. Chapters 2, 3, 4 and 5 have been removed from this report and will be processed separately.

  7. AC-tabsmodeller for superledende kabelledere

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  8. Electric field in an AC dielectric barrier discharge overlapped with a nanosecond pulse discharge

    Goldberg, Benjamin M.; Shkurenkov, Ivan; Adamovich, Igor V.; Lempert, Walter R.

    2016-08-01

    The effect of ns discharge pulses on the AC barrier discharge in hydrogen in plane-to-plane geometry is studied using time-resolved measurements of the electric field in the plasma. The AC discharge was operated at a pressure of 300 Torr at frequencies of 500 and 1750 Hz, with ns pulses generated when the AC voltage was near zero. The electric field vector is measured by ps four-wave mixing technique, which generates coherent IR signal proportional to the square of electric field. Absolute calibration was done using an electrostatic (sub-breakdown) field applied to the discharge electrodes, when no plasma was generated. The results are compared with one-dimensional kinetic modeling of the AC discharge and the nanosecond pulse discharge, predicting behavior of both individual micro-discharges and their cumulative effect on the electric field distribution in the electrode gap, using stochastic averaging based on the experimental micro-discharge temporal probability distribution during the AC period. Time evolution of the electric field in the AC discharge without ns pulses, controlled by a superposition of random micro-discharges, exhibits a nearly ‘flat top’ distribution with the maximum near breakdown threshold, reproduced quite well by kinetic modeling. Adding ns pulse discharges on top of the AC voltage waveform changes the AC discharge behavior in a dramatic way, inducing transition from random micro-discharges to a more regular, near-1D discharge. In this case, reproducible volumetric AC breakdown is produced at a well-defined moment after each ns pulse discharge. During the reproducible AC breakdown, the electric field in the plasma exhibits a sudden drop, which coincides in time with a well-defined current pulse. This trend is also predicted by the kinetic model. Analysis of kinetic modeling predictions shows that this effect is caused by large-volume ionization and neutralization of surface charges on the dielectrics by ns discharge pulses. The present

  9. Memory effect in ac plasma displays

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  10. MoMar-Demo at Lucky Strike. A near-real time multidisciplinary observatory of hydrothermal processes and ecosystems at the Mid-Atlantic Ridge

    Cannat, M.; Sarradin, P.; Blandin, J.; Escartin, J.; Colaco, A.; MoMAR-Demo Scientific Party : Aron Michael, Aumont Virginie, Baillard Christian, Ballu Valérie, Barreyre Thibaut, Blandin Jérôme, Blin Alexandre, Boulart Cédric, Cannat Mathilde, Carval Thierry, Castillo Alain, Chavagnac Valérie, Coail Jean Yves, Colaço Ana, Corela Carlos, Courrier Christophe, Crawford Wayne, Cuvelier Daphné, Daniel Romuald, Dausse Denis, Escartin Javier, Fabrice Fontaine, Gabsi Taoufik, Gayet Nicolas, Guyader Gérard, Lallier François, Lecomte Benoit, Legrand Julien, Lino Silva, Miranda Miguel, Mitard Emmelyne, Pichavant Pascal, Pot Olivier, Reverdin Gilles, Rommevaux Céline, Sarradin Pierre Marie, Sarrazin Jozée, Tanguy Virginie, Villinger Heinrich, Zbinden Magali

    2011-12-01

    The MoMAR "Monitoring the Mid-Atlantic Ridge" project was initiated by InterRidge in 1998 to study the environmental instability resulting from active mid-ocean-ridge processes at hydrothermal vent fields south of the Azores. It then developped into a component of the ESONET (European Seafloor Observatory Network) and EMSO (European Multidisciplinary Subsea Observatory) programs, which coordinate eulerian observatory initiatives in the seas around Europe. MoMAR experiments have started in 2006 and address two main questions : What are the feedbacks between volcanism, deformation, seismicity, and hydrothermalism at a slow spreading mid-ocean ridge? and How does the hydrothermal ecosystem couple with these sub-seabed processes? The MoMAR-Demo project started in 2010 with partial support from ESONET. It has been implemented so far by 2 cruises of the RV Pourquoi Pas ? during which we successfully deployed (in 2010), and upgraded (in 2011) a near-realtime buoyed observatory system. The system comprises two Sea Monitoring Nodes (SeaMoN) at the seafloor, which are acoustically linked to a surface relay buoy (BoRel), ensuring satellite communication to a land base station in Brest (France). One SeaMoN node connects to a 3-components seismometer and an hydrophone for seismic event detection, and two pressure probes for geodetic measurements, and the other SeaMoN node connects to a video camera, a dissolved-iron analyzer, and an optode (oxygen and temperature probe) for ecological time studies. The BOREL transmission buoy is equiped with GPS (geodetic experiment and buoy location) and meteo station. Data and/or status signals from these sensors are transmitted every 6 hours, and put on line in compliance with the ESONET-EMSO data policy (temporary access through http://www.ifremer.fr/WC2en/allEulerianNetworks). The MoMAR-Demo system also allows for interactive connections and changes of data transmission rates on demand. It is nested in arrays of autonomous sensors (OBSs

  11. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  12. Molecular modeling of methyl-α-Neu5Ac analogues docked against cholera toxin--a molecular dynamics study.

    Blessy, J Jino; Sharmila, D Jeya Sundara

    2015-02-01

    Molecular modeling of synthetic methyl-α-Neu5Ac analogues modified in C-9 position was investigated by molecular docking and molecular dynamics (MD) simulation methods. Methyl-α-Neu5Ac analogues were docked against cholera toxin (CT) B subunit protein and MD simulations were carried out for three Methyl-α-Neu5Ac analogue-CT complexes (30, 10 and 10 ns) to estimate the binding activity of cholera toxin-Methyl-α-Neu5Ac analogues using OPLS_2005 force field. In this study, direct and water mediated hydrogen bonds play a vital role that exist between the methyl-α-9-N-benzoyl-amino-9-deoxy-Neu5Ac (BENZ)-cholera toxin active site residues. The Energy plot, RMSD and RMSF explain that the simulation was stable throughout the simulation run. Transition of phi, psi and omega angle for the complex was calculated. Molecular docking studies could be able to identify the binding mode of methyl-α-Neu5Ac analogues in the binding site of cholera toxin B subunit protein. MD simulation for Methyl-α-9-N-benzoyl-amino-9-deoxy-Neu5Ac (BENZ), Methyl-α-9-N-acetyl-9-deoxy-9-amino-Neu5Ac and Methyl-α-9-N-biphenyl-4-acetyl-deoxy-amino-Neu5Ac complex with CT B subunit protein was carried out, which explains the stable nature of interaction. These methyl-α-Neu5Ac analogues that have computationally acceptable pharmacological properties may be used as novel candidates for drug design for cholera disease.

  13. Magnetization of YBCO film with ac travelling magnetic waves of relatively short wavelengths

    Wang, Wei; Coombs, Tim

    2017-02-01

    The magnetizations of the YBCO film with ac travelling magnetic waves of relatively short wavelengths were studied. The results have verified that the reported "intermediate value" of the superconducting current density [Wang et al., Appl. Phys. Lett. 104(3), 032602 (2014)] was caused by the existence of multiple transition regions in the sample: the magnetic poles induce ±JC in the pole regions, which produces two transition regions within each wavelength λ ( +JC→-JC→+JC , and vice versa, while the symbol → indicates the transition region). The current densities in the transition region are with intermediate values, which are smaller than the critical value. In case of relatively short wavelength, there are multiple transition regions, which occupy a large fraction of the YBCO sample with intermediate current values. Moreover, the wavelike current distributions might help explain the flux transportation and dc output voltage in HTS flux pump.

  14. Sustainable Transition

    Hansen, Ole Erik; Søndergård, Bent

    2014-01-01

    transition processes. Where. Addresses design processes aimed at sustainable transition enacted in complex social settings, socio-technical systems involving many different actors and agendas. How. The chapter outlines a conceptual and analytic framework for a reflexive design practice for sustainability...... including the perspective of structural changes (transition of socio-technical systems and social practices) and Design as metadesign; an reflexivity on contextual framework of the design practice (regimes/design spaces)....

  15. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  16. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  17. 马士基将重组AC-2和AC-3航线

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  18. Cooperative Frequency Control for Autonomous AC Microgrids

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  19. AcEST: DK954326 [AcEST

    Full Text Available mily ATPase, CDC48 subfamily OS=Met... 125 1e-27 tr|B8GJ73|B8GJ73_9EURY AAA famil...al transitional endo... 122 1e-26 tr|A7IB30|A7IB30_METB6 AAA family ATPase, CDC48 subfamily OS=Met...... 122 2e-26 tr|A2SR43|A2SR43_METLZ AAA family ATPase, CDC48 subfamily OS=Met... 122 2e-26...et... 120 5e-26 tr|Q2FSR5|Q2FSR5_METHJ AAA family ATPase, CDC48 subfamily OS=Met... 120 5e-26 >tr|O81459|O81

  20. Josephson effects in an alternating current biased transition edge sensor

    Gottardi, Luciano; Akamatsu, Hiroki; van der Kuur, Jan; Bruijn, Marcel P; Hartog, Roland H den; Hijmering, Richard; Khosropanah, Pourya; Lambert, Colin; van der Linden, Anton J; Ridder, Marcel L; Suzuki, Toyo; Gao, Jan R

    2016-01-01

    We report the experimental evidence of the ac Josephson effect in a transition edge sensor (TES) operating in a frequency domain multiplexer and biased by ac voltage at MHz frequencies. The effect is observed by measuring the non-linear impedance of the sensor. The TES is treated as a weakly linked superconducting system and within the resistively shunted junction model framework. We provide a full theoretical explanation of the results by finding the analytic solution of the non-inertial Langevian equation of the system and calculating the non-linear response of the detector to a large ac bias current in the presence of noise.

  1. imulation Results of Single Stage AC- AC Converter for Induction Heating

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  2. Micro pumping methods based on AC electrokinetics and Electrorheologically actuated PDMS valves

    Soni, Gaurav; Squires, Todd; Meinhart, Carl

    2006-11-01

    We have developed 2 different micropumping methods for transporting ionic fluids through microchannels. The first method is based on Induced Charge Electroosmosis (ICEO) and AC flow field-effect. We used an AC electric field to produce a symmetric ICEO flow on a planar electrode, called `gate'. In order to break the symmetry of ICEO, we applied an additional AC voltage to the gate electrode. Such modulation of the gate potential is called field effect and produces a unidirectional pumping over the gate surface. We used micro PIV to measure pumping velocities for a range of ionic concentration, AC frequency and gate voltage. We have also conducted numerical simulations to understand the deteriorating effect of lateral conduction of surface charge on the pumping velocities. The second method is based on vibration of a flexible PDMS diaphragm actuated by an electrorheological (ER) fluid. ER fluid is a colloidal suspension exhibiting a reversible liquid-to-solid transition under an electric field. This liquid-to-solid transition can yield very high shear stress and can be used to open and close a PDMS valve. Three such valves were fabricated and actuated in a peristaltic fashion in order to achieve positive displacement pumping of fluids.

  3. A Generalised Fault Protection Structure Proposed for Uni-grounded Low-Voltage AC Microgrids

    Bui, Duong Minh; Chen, Shi-Lin; Lien, Keng-Yu; Jiang, Jheng-Lun

    2016-04-01

    This paper presents three main configurations of uni-grounded low-voltage AC microgrids. Transient situations of a uni-grounded low-voltage (LV) AC microgrid (MG) are simulated through various fault tests and operation transition tests between grid-connected and islanded modes. Based on transient simulation results, available fault protection methods are proposed for main and back-up protection of a uni-grounded AC microgrid. In addition, concept of a generalised fault protection structure of uni-grounded LVAC MGs is mentioned in the paper. As a result, main contributions of the paper are: (i) definition of different uni-grounded LVAC MG configurations; (ii) analysing transient responses of a uni-grounded LVAC microgrid through line-to-line faults, line-to-ground faults, three-phase faults and a microgrid operation transition test, (iii) proposing available fault protection methods for uni-grounded microgrids, such as: non-directional or directional overcurrent protection, under/over voltage protection, differential current protection, voltage-restrained overcurrent protection, and other fault protection principles not based on phase currents and voltages (e.g. total harmonic distortion detection of currents and voltages, using sequence components of current and voltage, 3I0 or 3V0 components), and (iv) developing a generalised fault protection structure with six individual protection zones to be suitable for different uni-grounded AC MG configurations.

  4. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  5. 21 CFR 886.4440 - AC-powered magnet.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  6. 21 CFR 888.1240 - AC-powered dynamometer.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  7. 21 CFR 886.1630 - AC-powered photostimulator.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  8. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  9. Consistent behaviour of AC susceptibility and transport properties in magnetic superconductor RuSr 2GdCu 2O 8

    Očko, M.; Živkovic, I.; Prester, M.; Drobac, Dj.; Ariosa, D.; Berger, H.; Pavuna, D.

    2004-02-01

    We report on AC susceptibility, resistivity, thermopower and measurements of sintered magnetic superconductor RuSr 2GdCu 2O 8. The antiferromagnetic phase transition at 133 K is seen clearly in the AC susceptibility as well as in the derivative of resistivity and thermopower. Above the antiferromagnetic transition, we have found some new evidences of the similarity between HTC compounds and the magnetic superconductor. The onset of superconductivity is observed by both transport methods at 46 K, and an explanation why it is not seen in the AC susceptibility data is given. The end of the SC transition occurs at about 24 K in all measured properties. We discuss the steps of broad SC transition, especially the maximum in susceptibility at 34 K, and compare our results with related studies reported in the literature.

  10. Consistent behaviour of AC susceptibility and transport properties in magnetic superconductor RuSr{sub 2}GdCu{sub 2}O{sub 8}

    Ocko, M. E-mail: ocko@ifs.hr; Zivkovic, I.; Prester, M.; Drobac, Dj.; Ariosa, D.; Berger, H.; Pavuna, D

    2004-02-01

    We report on AC susceptibility, resistivity, thermopower and measurements of sintered magnetic superconductor RuSr{sub 2}GdCu{sub 2}O{sub 8}. The antiferromagnetic phase transition at 133 K is seen clearly in the AC susceptibility as well as in the derivative of resistivity and thermopower. Above the antiferromagnetic transition, we have found some new evidences of the similarity between HTC compounds and the magnetic superconductor. The onset of superconductivity is observed by both transport methods at 46 K, and an explanation why it is not seen in the AC susceptibility data is given. The end of the SC transition occurs at about 24 K in all measured properties. We discuss the steps of broad SC transition, especially the maximum in susceptibility at 34 K, and compare our results with related studies reported in the literature.

  11. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  12. Levels in 221Fr fed by the α decay of 225Ac

    Ardisson, G.; Gasparro, J.; Barci, V.; Sheline, R. K.

    2000-12-01

    The α decay of 225Ac to 221Fr was reinvestigated by γ-ray spectroscopic studies with HPGe detectors and 225Ac sources purified using continuous elution processes. Energies and intensities of about 120 γ-ray transitions were measured. Among these, 40 are reported for the first time. A 221Fr level scheme with 46 excited states and 124 transitions is proposed. The level structure is described in terms of a reflection asymmetric structure with parity doublet bands Kπ=1/2+/-, 3/2+/-, 5/2+/-, and 3/2+/- in order of increasing energy. Both strong and intermediate coupling models have been shown to be in good agreement with the experimental data.

  13. Conspiração e demoção: mecanismos de simplicação da estrutura silábica

    Dermeval da Hora

    2008-07-01

    Full Text Available

    Defende-se que alguns fenômenos sincrônicos da Língua Portuguesa, dentre eles a redução dos ditongos átonos finais, a monotongação dos ditongos crescentes orais e o apagamento da vibrante pós-vocálica em posição de coda, parecem caminhar na direção da simplificação da estrutura silábica da língua. Estes fenômenos, aparentemente diferentes entre si, demonstram possuir, no entanto, um traço em comum: em todos eles, a simplificação é resultado de um mesmo processo – a demoção da restrição de fidelidade MAX-IO. Para entender esta hipótese, porém, faz-se necessário um repasse do que vem a ser a idéia de conspiração e um entendimento de como a sílaba está estruturada nas línguas naturais.

  14. Zebrafish embryotoxicity test for developmental (neuro)toxicity: Demo case of an integrated screening approach system using anti-epileptic drugs.

    Beker van Woudenberg, Anna; Snel, Cor; Rijkmans, Eke; de Groot, Didima; Bouma, Marga; Hermsen, Sanne; Piersma, Aldert; Menke, Aswin; Wolterbeek, André

    2014-11-01

    To improve the predictability of the zebrafish embryotoxicity test (ZET) for developmental (neuro)toxicity screening, we used a multiple-endpoints strategy, including morphology, motor activity (MA), histopathology and kinetics. The model compounds used were antiepileptic drugs (AEDs): valproic acid (VPA), carbamazepine (CBZ), ethosuximide (ETH) and levetiracetam (LEV). For VPA, histopathology was the most sensitive parameter, showing effects already at 60μM. For CBZ, morphology and MA were the most sensitive parameters, showing effects at 180μM. For ETH, all endpoints showed similar sensitivity (6.6mM), whereas MA was the most sensitive parameter for LEV (40mM). Inclusion of kinetics did not alter the absolute ranking of the compounds, but the relative potency was changed considerably. Taking all together, this demo-case study showed that inclusion of multiple-endpoints in ZET may increase the sensitivity of the assay, contribute to the elucidation of the mode of toxic action and to a better definition of the applicability domain of ZET.

  15. Dynamic Stark effect and forbidden-transition spectrallineshapes

    Stalnaker, Jason E.; Budker, D.; Freedman, S.J.; Guzman, J.S.; Rochester, S.M.; Yashchuk, V.V.

    2005-12-15

    We report on an experimental and theoretical study of thedynamic (ac) Stark effect on a for bidden transition. A general frameworkfor parameterizing and describing off-resonant ac-Stark shifts ispresented. A model is developed to calculate spectral line shapesresulting from resonant excitation of atoms in an intense standinglight-wave in the presence of off-resonant ac-Stark shifts. The model isused in the analysis and interpretation of a measurement of the ac-Starkshifts of the static-electric-field-induced 6s2 1S0 -->5d6s 3D1transition at 408 nm in atomic Yb. The results are in agreement withestimates of the ac-Stark shift of the transition under the assumptionthat the shift is dominated by that of the 6s2 1S0 ground state. Adetailed description of the experiment and analysis is presented. Abi-product of this work is an ind ependent determination (from thesaturation behavior of the 408-nm transition) of the Stark transitionpolarizability, which is found to be in agreement with our earliermeasurement. This work is part of the ongoing effort aimed at a precisionmeasurement of atomic parity-violation effects in Yb.

  16. Current distribution effects in AC impedance spectroscopy of electroceramic point contact and thin film model electrodes

    Nielsen, Jimmi; Jacobsen, Torben

    2010-01-01

    The Finite-Element-Method (FEM) was used for the simulations of the effect of a changing current distribution during AC impedance spectrum recording on electroceramic point contact and thin film model electrodes. For pure electronic conducting point contact electrodes the transition from...... regarding its significance is provided. The associated characteristic impedance spectrum shape change is simulated and its origin discussed. Furthermore, the characteristic shape of impedance spectra of thin electroceramic film electrodes with lateral ohmic resistance is studied as a function...

  17. Reinvestigation of superconducting phase diagram of UGe{sub 2} by AC magnetic susceptibility experiment

    Ban, S. [Deptartment of Physics, University of Nagoya, Nagoya, 464-8602 (Japan)]. E-mail: f060214d@mbox.nagoya-u.ac.jp; Deguchi, K. [Deptartment of Physics, University of Nagoya, Nagoya, 464-8602 (Japan); Aso, N. [Institute for Solid State Physics, University of Tokyo, Kashiwa 277-8581 (Japan); Homma, Y. [Oarai Branch, Inst. for Mater. Research, University of Tohoku, Ibaraki 311-1313 (Japan); Shiokawa, Y. [Oarai Branch, Inst. for Mater. Research, University of Tohoku, Ibaraki 311-1313 (Japan); Sato, N.K. [Deptartment of Physics, University of Nagoya, Nagoya, 464-8602 (Japan)

    2007-03-15

    We report a superconducting phase diagram of the ferromagnetic superconductor UGe{sub 2} investigated by AC magnetic susceptibility measurements. In contrast to previous phase diagrams, we found that the superconducting transition temperature and volume fraction show a 'M-shaped' structure as a function of pressure. From this observation, we suggest that both of two critical points will play a crucial role in the occurrence of superconductivity in UGe{sub 2}.

  18. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  19. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  20. Power Electronic Transformer based Three-Phase PWM AC Drives

    Basu, Kaushik

    A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common

  1. Phase transitions

    Solé, Ricard V

    2011-01-01

    Phase transitions--changes between different states of organization in a complex system--have long helped to explain physics concepts, such as why water freezes into a solid or boils to become a gas. How might phase transitions shed light on important problems in biological and ecological complex systems? Exploring the origins and implications of sudden changes in nature and society, Phase Transitions examines different dynamical behaviors in a broad range of complex systems. Using a compelling set of examples, from gene networks and ant colonies to human language and the degradation o

  2. Cyclotron and linac production of Ac-225.

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  3. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  4. The Effective AC Response of Nonlinear Composites

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  5. Control of Power Converters in AC Microgrids

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  6. The ACS Nearby Galaxy Survey Treasury

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  7. AC410 Unit 2 Homework Assignment

    Laynebaril1

    2017-01-01

      AC410 Unit 2 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-2-homework-assignment/   3-31 Ron Barber, CPA, is auditing the financial statements of DGF, Inc., a publicly held company. During the course of the audit, Barber discovered that DGF has been making illegal bribes to foreign government officials to obtain business, and he reported the matter to senior management and the board of directors of DGF. Required: If management a...

  8. Cascaded Buck-Boost AC/AC converter%级联式Buck-Boost AC/AC变换器

    张友军; 丁明昌; 任永保; 王阿敏; 翁振明

    2010-01-01

    详细分析了Buck型和Boost型AC/AC变换器的工作原理及其控制方法,在此基础上提出了一种新型级联式Buck-Boost AC/AC变换器及其三模式控制策略.三模式控制策略是比较输入电压与基准输出电压的大小,使得变换器只有3种工作模式:Buck模式、Boost模式和滤波模式.该电路虽然由Buck型和Boost型AC/AC变换器2级变换器级联而成,并采用2级占空比调制,但实际上最多只存在一级功率变换,具有控制简单、变换效率高、开关管电压应力低等优点.仿真结果证明了级联式Buck-Boost AC/AC变换器及其控制策略的可行性和理论分析的正确性.

  9. YBCO thin films in ac and dc films

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  10. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  11. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  12. An 'Orca-stra' of Science and Sound: The Reverberations of Northeast Pacific Whales and How We're Helping People Understand Them Though Games, Demos and Listening

    Pelz, M.; Dewey, R. K.; Hoeberechts, M.; Kanes, K.; Ewing, N.

    2015-12-01

    Presented by the Ocean Networks Canada (ONC) Leaning and Engagement team, this demonstration focuses on our strategy for engaging and inspiring the next generation of ocean advocates by introducing them to one of the ocean's most charismatic inhabitants: marine mammals (and don't worry, we don't need any tanks or neoprene suits to do it). Using bioacoustic data, we can bring the essence of the animals with us. ONC, an initiative of the University of Victoria, operates cabled ocean observatories which supply continuous power and Internet connectivity to a broad suite of subsea instruments from the coast to the deep sea. This Internet connectivity permits researchers, students and members of the public to download freely available data onto their computers from anywhere around the globe, in real-time. Our demo focuses on the story of bioacoustics from instrument to animal. When visiting classrooms or hosting booths, we enhance user knowledge and experience by connecting familiar animals with their acoustic data from hydrophones. This includes listening to hydrophone clips collected from the network, analyzing sounds using interactive, real-time software and playing interactive games designed to get participants thinking like a scientist and taking a whale's perspective. For example, participants listen to recordings and guess the sound, identify frequencies and try a working hydrophone. The presentation consists of a suite of activities that meet a broad range of Next Generation Science Standards and includes links to the SoundCloud, https://soundcloud.com/oceannetworkscanada the ONC hydrophone FAQ, http://www.oceannetworks.ca/smart-hydrophone-faq and a classroom ready resource, Shouting Whales http://openschool.bc.ca/shouting_whales/index.html . The included links allow users anywhere to have a similar whale "experience" as the data are classroom ready, accessible and free.

  13. 76 FR 65633 - RIN 1904-AC43

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  14. AC power generation from microbial fuel cells

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  15. Thermal Simulation of AC Electromagnetic Contactor

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  16. A dry-cooled AC quantum voltmeter

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  17. Protection of AC and DC Microgrids

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  18. Modeling of long High Voltage AC Underground

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  19. From Beamline to Scanner with 225Ac

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  20. Aging, Counterfeiting Configuration Control (AC3)

    2010-01-31

    relabeled fake microcircuit chips from overseas - threaten the reliability, safety, and performance of DoD systems. These systems are vulnerable... NASA , Raytheon internal, etc. Aging, Counterfeiting Configuration Control (AC3) Page 13 of 28 are important in determining the alert’s priority

  1. The superconducting proposal for the CS magnet system of FAST: a preliminary analysis of the heat load due to AC losses

    Pompeo, N

    2011-01-01

    FAST (Fusion Advanced Studies Torus), the Italian proposal of a Satellite Facility to ITER, is a compact tokamak (R$_0$ = 1.82 m, a = 0.64 m, triangularity $\\delta$ = 0.4) able to investigate non-linear dynamics effects of $\\alpha$-particle behavior in burning plasmas and to test technical solutions for the first wall/divertor directly relevant for ITER and DEMO. Currently, ENEA is investigating the feasibility of a superconducting solution for the magnet system. This paper focuses on the analysis of the CS (Central Solenoid) magnet thermal behavior. In particular, considering a superconducting solution for the CS which uses the room available in the resistive design and referring to one of the most severe scenario envisaged for FAST, the heat load of the CS winding pack due to AC losses is preliminarily evaluated. The results provide a tentative baseline for the definition of the strand requirements and conductor design, that can be accepted in order to fulfil the design requirements.

  2. Digital model for harmonic interactions in AC/DC/AC systems

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  3. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  4. Automatic Control Systems (ACS for Generation and Sale of Electric Power Under Conditions of Industry-Sector Liberalization

    Yu. Petrusha

    2013-01-01

    Full Text Available Possible risks pertaining to transition of electric-power industry to market relations have been considered in the paper. The paper presents an integrated ACS for generation and sale of electric power as an improvement of methodology for organizational and technical management. The given system is based on integration of operating Automatic Dispatch Control System (ADCS and developing Automatic Electricity Meter Reading System (AEMRS. The paper proposes to form an inter-branch sector of ACS PLC (Automatic Control System for Prolongation of Life Cycle users which is oriented on provision of development strategy.

  5. AC Zeeman Effect of Atom%原子的交流塞曼效应

    邢爱堂

    1999-01-01

    The formula of level shifts in AC Zeeman effect is derived on the base of a simple semiclassical method. The theoretical predictions of this formula are qualitatively in good agreement with the phenomena observed in AC Zeeman experiment. Furthermore,two important properties of AC Zeeman effect are predicted in theory:the level shifts in AC Zeeman effect of atom are the transient courses concurring with transition;the level shifts have saturation property.%用一种简单的半经典方法推导出了交流塞曼效应中的能级移动公式.从这一公式得到的结果与实验中观察到的现象是一致的,而且从理论上预言了交流塞曼效应的2个重要性质:原子交流塞曼效应中的能级移动是与跃迁同时发生的瞬态过程;能级移动具有饱和性.

  6. A novel wireless power and data transmission AC to DC converter for an implantable device.

    Liu, Jhao-Yan; Tang, Kea-Tiong

    2013-01-01

    This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz.

  7. AC Conductivity and Dielectric Relaxation Behavior of Sb2S3 Bulk Material

    Abd El-Rahman, K. F.; Darwish, A. A. A.; Qashou, Saleem I.; Hanafy, T. A.

    2016-07-01

    The Sb2S3 bulk material was used for next-generation anode for lithium-ion batteries. Alternative current (AC) conductivity, dielectric properties and electric modulus of Sb2S3 have been investigated. The measurements were carried out in the frequency range from 40 Hz to 5 MHz and temperature range from 293 K to 453 K. The direct current (DC) conductivity, σ DC, shows an activated behavior and the calculated activation energy is 0.50 eV. The AC conductivity, σ AC, was found to increase with the increase of temperature and frequency. The conduction mechanism of σ AC was controlled by the correlated barrier hopping model. The behavior of the dielectric constant, ɛ', and dielectric loss index, ɛ'', reveal that the polarization process of Sb2S3 is dipolar in nature. The behavior of both ɛ' and ɛ'' reveals that bulk Sb2S3 has no ferroelectric or piezoelectric phase transition. The dielectric modulus, M, gives a simple method for evaluating the activation energy of the dielectric relaxation. The calculated activation energy from M is 0.045 eV.

  8. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  9. Dicty_cDB: FCL-AC21 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC21 (Link to dictyBase) - - - Contig-U15479-1 FCL-AC21E ...(Link to Original site) - - - - - - FCL-AC21E 632 Show FCL-AC21 Library FCL (Link to library) Clone ID FCL-AC2... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC21Q.Seq.d/ Representative seq. ID FCL-AC2...1E (Link to Original site) Representative DNA sequence >FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC2...M/SL/SLG7-D/SLG773Q.Seq.d/ 1205 0.0 FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC21

  10. Tessellations & Transitions.

    Cassidy, Joan

    1998-01-01

    Describes two sixth-grade lessons on the work of M. C. Escher: (1) the first lesson instructs students on tessellations, or tiles that interlock in a repeated pattern; (2) the second lesson explores Escher's drawings of transitions from two- to three-dimensional space. (DSK)

  11. AC impedance spectroscopy on copper phthalocyanine thin films

    Robinson, Kyle P.

    Impedance spectroscopy is used to study copper phthalocyanine thin films in order to disentangle the contributions of the crystal and the unavoidable grain boundaries. The spectroscopy data is fit with an equivalent circuit model to determine resistance, capacitance, and activation energy for different grain morphologies. The copper phthalocyanine thin films are deposited via thermal evaporation on platinum interdigitated electrodes on glass substrates at different temperatures from 300 to 530 K with constant thickness of 22 nm. AC measurements, implementing a precision LCR meter are taken from 20Hz - 2 MHz, and at measurement temperatures from 25 - 90 °C. Stabilizing current by subjecting samples to 5 days in the dark, the impedance spectrum can be represented by Cole-Cole plots, which show either one or two peaks. The two maxima may be attributed to the crystalline bulk and grain boundaries of the film. We observe that the grain boundary resistance component changes by three orders of magnitude when varying the grain morphology, and the capacitance changes by one order of magnitude. The resistance of the grain boundary shows a minimum near the phase transition temperature of 450 K, followed by an increase in resistance for samples deposited at higher temperatures. The capacitance on the other hand, shows a maximum near the phase transition temperature. Similarly, the activation energy for the grain boundary peaks at 1.29 +/- 0.12 eV at the same phase-transition tempemture, whereas the crystalline bulk component has a constant activation energy of 0.36 +/- 0.08 eV for all sample of different grain sizes. Additional data taken using a perpendicular configuration for a 30 nm thick cobalt phthalocyanine thin film shows a double peak. The low temperature measurements for these samples are interpreted to have two contributions from micro-shorts and crystalline bulk.

  12. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  13. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  14. Methods for Addressing Missing Data with Applications from ACS Exams

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  15. 21 CFR 880.5500 - AC-powered patient lift.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  16. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  17. AC LED的研究现状与发展%Current research and development of AC LED

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  18. “Two conditions for a successful partnership: high-levels of NGO professionalism and the readiness of local and regional administrations to find new forms of partnership” - Interview with Asmik Novikova, Demos Centre, Moscow, 6 March and 12 October 2008

    Gilles Favarel-Garrigues

    2009-03-01

    Full Text Available Introducing DemosPIPSS.ORG - Could you introduce yourself and describe your career (including what circumstances brought you to work for Demos? Asmik Novikova: After I graduated from Moscow State University in the summer of 2001, I wondered where I could find a good place for my research plans. I wished to develop and conduct sociological surveys, but not in an overly academic way. I felt that sociology was a very effective tool to study the current situation in Russian society and maybe fin...

  19. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  20. Transition Operators

    Alcock-Zeilinger, Judith

    2016-01-01

    In this paper, we give a generic algorithm of the transition operators between Hermitian Young projection operators corresponding to equivalent irreducible representations of SU(N), using the compact expressions of Hermitian Young projection operators derived in a companion paper. We show that the Hermitian Young projection operators together with their transition operators constitute a fully orthogonal basis for the algebra of invariants of $V^{\\otimes m}$ that exhibits a systematically simplified multiplication table. We discuss the full algebra of invariants over $V^{\\otimes 3}$ and $V^{\\otimes 4}$ as explicit examples. In our presentation we make use of various standard concepts such as Young projection operators, Clebsch-Gordan operators, and invariants (in birdtrack notation). We tie these perspectives together and use them to shed light on each other.

  1. Lazy AC-Pattern Matching for Rewriting

    Walid Belkhir; Alain Giorgetti

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  2. AC plasma anemometer—characteristics and design

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  3. Lazy AC-Pattern Matching for Rewriting

    Walid Belkhir

    2012-04-01

    Full Text Available We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  4. The Hubble Legacy Archive ACS Grism Data

    Kuemmel, M; Fosbury, R; Haase, J; Hook, R N; Kuntschner, H; Lombardi, M; Micol, A; Nilsson, K K; Stoehr, F; Walsh, J R

    2011-01-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 \\mu$m, with a dispersion of $40 \\ \\AA / pixel$ and a resolution of $\\sim 80\\ \\AA$ for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47,919 datasets (65% of the total number of extracted spect...

  5. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  6. Molecular biology of maize Ac/Ds elements: an overview.

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  7. Development of a hardware-based AC microgrid for AC stability assessment

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  8. Transit space

    Raahauge, Kirsten Marie

    2008-01-01

    This article deals with representations of one specific city, Århus, Denmark, especially its central district. The analysis is based on anthropological fieldwork conducted in Skåde Bakker and Fedet, two well-off neighborhoods. The overall purpose of the project is to study perceptions of space...... and the interaction of cultural, social, and spatial organizations, as seen from the point of view of people living in Skåde Bakker and Fedet. The focus is on the city dwellers’ representations of the central district of Århus with specific reference to the concept of transit space. When applied to various Århusian...

  9. Conformational Transitions

    Czerminski, Ryszard; Roitberg, Adrian; Choi, Chyung; Ulitsky, Alexander; Elber, Ron

    1991-10-01

    Two computational approaches to study plausible conformations of biological molecules and the transitions between them are presented and discussed. The first approach is a new search algorithm which enhances the sampling of alternative conformers using a mean field approximation. It is argued and demonstrated that the mean field approximation has a small effect on the location of the minima. The method is a combination of the LES protocol (Locally Enhanced Sampling) and simulated annealing. The LES method was used in the past to study the diffusion pathways of ligands from buried active sites in myoglobin and leghemoglobin to the exterior of the protein. The present formulation of LES and its implementation in a Molecular Dynamics program is described. An application for side chain placement in a tetrapeptide is presented. The computational effort associated with conformational searches using LES grows only linearly with the number of degrees of freedom, whereas in the exact case the computational effort grows exponentially. Such saving is of course associated with a mean field approximation. The second branch of studies pertains to the calculation of reaction paths in large and flexible biological systems. An extensive mapping of minima and barriers for two different tetrapeptides is calculated from the known minima and barriers of alanine tetrapeptide which we calculated recently.1 The tetrapeptides are useful models for the formation of secondary structure elements since they are the shortest possible polymers of this type which can still form a complete helical turn. The tetrapeptides are isobutyryl-val(χ1=60)-ala-ala and isobutyryl-val(χ1=-60)-ala-ala. Properties of the hundreds of minima and of the hundreds intervening barriers are discussed. Estimates for thermal transition times between the many conformers (and times to explore the complete phase space) are calculated and compared. It is suggested that the most significant effect of the side chain size is

  10. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  11. AC Electric Field Activated Shape Memory Polymer Composite

    Kang, Jin Ho; Siochi, Emilie J.; Penner, Ronald K.; Turner, Travis L.

    2011-01-01

    Shape memory materials have drawn interest for applications like intelligent medical devices, deployable space structures and morphing structures. Compared to other shape memory materials like shape memory alloys (SMAs) or shape memory ceramics (SMCs), shape memory polymers (SMPs) have high elastic deformation that is amenable to tailored of mechanical properties, have lower density, and are easily processed. However, SMPs have low recovery stress and long response times. A new shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive fillers to enhance its thermo-mechanical characteristics. A new composition of shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive functionalized graphene sheets (FGS) to enhance its thermo-mechanical characteristics. The elastic modulus of LaRC-SMPC is approximately 2.7 GPa at room temperature and 4.3 MPa above its glass transition temperature. Conductive FGSs-doped LaRC-SMPC exhibited higher conductivity compared to pristine LaRC SMP. Applying an electric field at between 0.1 Hz and 1 kHz induced faster heating to activate the LaRC-SMPC s shape memory effect relative to applying DC electric field or AC electric field at frequencies exceeding1 kHz.

  12. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  13. From Deng to the Demos?

    Mulvad, Andreas Møller

    2016-01-01

    of China’s hope to renew its political-ideological mandate by revitalizing Chinese culture, yet its radical economic underpinnings (emphasizing de-commodification and de-urbanization) make it hard to square with the overall logic of capitalist reform and opening-up. The successful articulation...

  14. Demo biomassagewassen binnen project Energieboerderij

    Mheen, van der H.J.C.J.

    2011-01-01

    Door de Stuurgroep Energieboerderij werd op 16 maart 2011 de in een velddemo te beproeven gewassen vastgesteld. Gekozen werd voor de navolgende acht gewassen: Landschapsmais, Mariadistel, Tagetes minuta, Tagetes patula, Milkweed, Switchgrass, Reed Canary Grass (RCG) en Witte Krodde. Met uitzondering

  15. Demo biomassagewassen binnen project Energieboerderij

    Mheen, van der, H.J.C.J.

    2011-01-01

    Door de Stuurgroep Energieboerderij werd op 16 maart 2011 de in een velddemo te beproeven gewassen vastgesteld. Gekozen werd voor de navolgende acht gewassen: Landschapsmais, Mariadistel, Tagetes minuta, Tagetes patula, Milkweed, Switchgrass, Reed Canary Grass (RCG) en Witte Krodde. Met uitzondering van de matig ontwikkelde Witte Krodde en Milkweed werd van alle gewassen op het tijdstip van maximale gewasvorming de hoeveelheid biomassa bepaald en werd aan gedroogde gewasmonsters de methaangas...

  16. WLCG Operations portal demo tutorial

    CERN. Geneva

    2016-01-01

    This is a navigation through http://wlcg-ops.web.cern.ch/ the Worldwide LHC Computing Grid (WLCG) Operations' portal. In this portal you will find documentation and information about WLCG Operation activities for: System Administrators at the WLCG sites LHC Experiments Operation coordination people, including Task Forces and Working Groups

  17. Frequency-driven quantum oscillations in a graphene layer under circularly polarized ac fields

    Vega Monroy, R., E-mail: ricardovega@mail.uniatlantico.edu.co; Martinez Castro, O.; Salazar Cohen, G.

    2015-06-19

    In this paper we predict a new type of quantum oscillations driven by the frequency of a circularly polarized ac field in a monolayer of graphene placed inside an optical cavity. We show that the displacement of the structure of photon-dressed electron states near the Fermi level and the electron transitions, from extended states to bound photon-dressed electron states inside an energy gap, lead to a periodic change of singularities in the electron density of states, resulting in quantum oscillations in thermodynamic, transport and other properties in graphene.

  18. DC injection into low voltage AC networks

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  19. Flexible AC transmission systems modelling and control

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  20. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  1. Djungle power. A more remote AC bus

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  2. Electrothermally driven flows in ac electrowetting.

    García-Sánchez, Pablo; Ramos, Antonio; Mugele, Frieder

    2010-01-01

    Mixing within sessile drops can be enhanced by generating internal flow patterns using ac electrowetting. While for low ac frequencies, the flow patterns have been attributed to oscillations of the drop surface, we provide here the driving mechanism of the hitherto unexplained high-frequency flows. We show that: (1) the electric field in the liquid bulk becomes important, leading to energy dissipation due to Joule heating and a temperature increase of several degrees Celsius, and (2) the fluid flow at these frequencies is generated by electrothermal effect, i.e., gradients in temperature give rise to gradients in conductivity and permittivity, the electric field acting on these inhomogeneities induces an electrical body force that generates the flow. We solved numerically the equations for the electric, temperature and flow fields. The temperature is obtained from a convection-diffusion equation where Joule heating is introduced as a source term. From the solution of the electric field and the temperature, we compute the electrical force that acts as a body force in Stokes equations. Our numerical results agree with previous experimental observations.

  3. Cascading failures in ac electricity grids

    Rohden, Martin; Jung, Daniel; Tamrakar, Samyak; Kettemann, Stefan

    2016-09-01

    Sudden failure of a single transmission element in a power grid can induce a domino effect of cascading failures, which can lead to the isolation of a large number of consumers or even to the failure of the entire grid. Here we present results of the simulation of cascading failures in power grids, using an alternating current (AC) model. We first apply this model to a regular square grid topology. For a random placement of consumers and generators on the grid, the probability to find more than a certain number of unsupplied consumers decays as a power law and obeys a scaling law with respect to system size. Varying the transmitted power threshold above which a transmission line fails does not seem to change the power-law exponent q ≈1.6 . Furthermore, we study the influence of the placement of generators and consumers on the number of affected consumers and demonstrate that large clusters of generators and consumers are especially vulnerable to cascading failures. As a real-world topology, we consider the German high-voltage transmission grid. Applying the dynamic AC model and considering a random placement of consumers, we find that the probability to disconnect more than a certain number of consumers depends strongly on the threshold. For large thresholds the decay is clearly exponential, while for small ones the decay is slow, indicating a power-law decay.

  4. Transport AC Losses in Striated YBCO Coated Conductors (Postprint)

    2012-02-01

    AFRL-RZ-WP-TP-2012-0124 TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) G.A. Levin and P.N. Barnes Mechanical Energy...TRANSPORT AC LOSSES IN STRIATED YBCO COATED CONDUCTORS (POSTPRINT) 5a. CONTRACT NUMBER In-house 5b. GRANT NUMBER 5c. PROGRAM ELEMENT...2006. 14. ABSTRACT DC current-voltage characteristics and transport ac losses of striated and non-striated Y1Ba2Cu3O7-δ ( YBCO ) coated conductors

  5. The impact of personal background and school contextual factors on academic competence and mental health functioning across the primary-secondary school transition.

    Sharmila Vaz

    Full Text Available Students negotiate the transition to secondary school in different ways. While some thrive on the opportunity, others are challenged. A prospective longitudinal design was used to determine the contribution of personal background and school contextual factors on academic competence (AC and mental health functioning (MHF of 266 students, 6-months before and after the transition to secondary school. Data from 197 typically developing students and 69 students with a disability were analysed using hierarchical linear regression modelling. Both in primary and secondary school, students with a disability and from socially disadvantaged backgrounds gained poorer scores for AC and MHF than their typically developing and more affluent counterparts. Students who attended independent and mid-range sized primary schools had the highest concurrent AC. Those from independent primary schools had the lowest MHF. The primary school organisational model significantly influenced post-transition AC scores; with students from Kindergarten--Year 7 schools reporting the lowest scores, while those from the Kindergarten--Year 12 structure without middle school having the highest scores. Attending a school which used the Kindergarten--Year 12 with middle school structure was associated with a reduction in AC scores across the transition. Personal background factors accounted for the majority of the variability in post-transition AC and MHF. The contribution of school contextual factors was relatively minor. There is a potential opportunity for schools to provide support to disadvantaged students before the transition to secondary school, as they continue to be at a disadvantage after the transition.

  6. Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing

    Gottardi, Luciano; de Korte, Piet A J; Hartog, Roland Den; Dirks, Bob; Popescu, Manuela; Hoevers, Henk F C; Bruijn, Marcel; Borderias, Maria Parra; Takei, Y

    2016-01-01

    We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDMconfiguration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/RN < 0.5). The measured energy resolution at 5.89keV is 2.7eV for DC bias and 3.7eV for AC bias, while the baseline resolution is 2.8eV and 3.3eV, respectively.

  7. Evaluation of a.c. conductivity behaviour of graphite filled polysulphide modified epoxy composites

    Navin Chand; Deepak Jain

    2004-06-01

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled and unfilled epoxy composites. It was observed that the dielectric constant, tan and a.c. conductivity increase with increasing temperature. Near the transition temperature the materials show anomalous behaviour for the observed properties. Peaks of dielectric constant, tan and a.c. conductivity were observed to shift towards lower temperature with increasing frequency. Clear relaxation (tan ) peaks around 169°C were observed in epoxy resin, which shifted to lower temperature side on increasing the frequency. Addition of 2.91 wt% graphite shifted the tan peaks towards higher temperature side by creating hindrances to the rotation of polymer dipoles. Addition of 2.91 wt% graphite leads to an increased relaxation time of dipoles in polysulphide epoxy from 1.44 × 10-5-3.92 × 10-5 (s) at 90°C by creating the hindrance to the rotation of dipoles.

  8. AC electric motors control advanced design techniques and applications

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  9. AC Own Motion Percentage of Randomly Sampled Cases

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  10. Spin reorientation transition process in single crystal NdFeO3

    Song, Gaibei; Jiang, Junjie; Kang, Baojuan; Zhang, Jincang; Cheng, Zhenxiang; Ma, Guohong; Cao, Shixun

    2015-06-01

    The spin reorientation transition in single crystal NdFeO3 is studied using AC magnetic susceptibility, hysteresis loops, and polarized terahertz (THz) time domain spectroscopy measurements. Different frequency dependence behaviors of AC susceptibility reflect that the dynamic response of magnetization inside the spin reorientation region differs from the phase outside the transition region. The magnetization hysteresis loops at different temperatures reveal that domains formed during the spin reorientation process, which coincides with the abrupt increase of AC magnetic susceptibility during the transition. In addition, temperature dependent THz wave excitation of quasi-antiferromagnetic mode indicates the process of spin reorientation as a continuous rotation of Fe3+ spins rather than a mixed phase of Γ4 and Γ2.

  11. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  12. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  13. Mechanism of Transition-Metal Nanoparticle Catalytic Graphene Cutting.

    Ma, Liang; Wang, Jinlan; Yip, Joanne; Ding, Feng

    2014-04-03

    Catalytic cutting by transition-metal (TM) particles is a promising method for the synthesizing of high-quality graphene quantum dots and nanoribbons with smooth edges. Experimentally, it is observed that the cutting always results in channels with zigzag (ZZ) or armchair (AC) edges. However, the driving force that is responsible for such a cutting behavior remains a puzzle. Here, by calculating the interfacial formation energies of the TM-graphene edges with ab initio method, we show that the surface of a catalyst particle tends to be aligned along either AC or ZZ direction of the graphene lattice, and thus the cutting of graphene is guided as such. The different cutting behaviors of various catalysts are well-explained based on the competition between TM-passivated graphene edges and the etching-agent-terminated ones. Furthermore, the kinetics of graphene catalytic cutting along ZZ and AC directions, respectively, are explored at the atomic level.

  14. Correlation between AC and DC transport properties of Mn substituted cobalt ferrite

    Supriya, Sweety; Kumar, Sunil; Kar, Manoranjan

    2016-12-01

    The CoFe2-xMnxO4 compound is prepared by following the sol gel technique. The structural analysis through XRD and Rietveld has been confirmed for the single cubic phase having F d 3 ¯ m space group for CoFe2-xMnxO4 and also verified it through Raman spectroscopy measurements. The tetrahedral site observed to be red shifted with increase in Mn concentration in cobalt ferrite. All the XRD patterns have been analyzed by employing the Rietveld refinement technique. The particle size was found to be in the range of 30-40 nm. The electrical properties of polycrystalline CoFe2-xMnxO4 for x = 0.00, 0.10, 0.15, and 0.2, spinel ferrite was investigated by impedance spectroscopy. The influence of doping, frequency and temperature on the electrical transport properties of the CoFe2-xMnxO4 for x = 0.00, 0.10, 0.15, and 0.20 were investigated. The magnitude of Z' and Z″ decreases with increase in temperature. Only one semicircle is observed in each Cole Cole plot which reveals that ac conductivity is dominated by grains. The grain resistance and grain boundary resistance both were found to decrease as a function of temperature. Temperature variation of DC electrical conductivity follows the Arrhenius relationship. A detailed analysis of electrical parameters provides assistance in connecting information regarding the conduction mechanism as well as determination of both dielectric and magnetic transition temperatures in the substituted cobalt ferrite. Detailed analysis of ac impedance and DC resistivity measurement reveals that, the magnetic ordering temperature in the Mn substituted cobalt ferrite does not respond to the frequency of ac electrical signal; however, it responds to the DC resistivity. The correlation between ac impedance and DC resistivity has been established.

  15. Effective ac response in weakly nonlinear composites

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  16. The AC and DC Conductivity of Nanocomposites

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  17. Fuzzy efficiency optimization of AC induction motors

    Jani, Yashvant; Sousa, Gilberto; Turner, Wayne; Spiegel, Ron; Chappell, Jeff

    1993-01-01

    This paper describes the early states of work to implement a fuzzy logic controller to optimize the efficiency of AC induction motor/adjustable speed drive (ASD) systems running at less than optimal speed and torque conditions. In this paper, the process by which the membership functions of the controller were tuned is discussed and a controller which operates on frequency as well as voltage is proposed. The membership functions for this dual-variable controller are sketched. Additional topics include an approach for fuzzy logic to motor current control which can be used with vector-controlled drives. Incorporation of a fuzzy controller as an application-specific integrated circuit (ASIC) microchip is planned.

  18. Transcranial alternating current stimulation (tACS

    Andrea eAntal

    2013-06-01

    Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.

  19. AC Dielectrophoresis Using Elliptic Electrode Geometry

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  20. Composite Based EHV AC Overhead Transmission Lines

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV......) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  1. Resistivity and AC calorimetry measurements on CeNiGe{sub 2} under pressure

    Holmes, A.T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan)]. E-mail: alex@djebel.mp.es.osaka-u.ac.jp; Muramatsu, T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Miyake, A. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Kaczorowski, D. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wroclaw (Poland); Bukowski, Z. [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wroclaw (Poland); Kagayama, T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Shimizu, K. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan)

    2007-03-15

    We present resistivity and AC calorimetry measurements of single crystalline CeNiGe{sub 2} under high pressure and low temperature in a diamond anvil cell. CeNiGe{sub 2} is a highly anisotropic, antiferromagnetic Kondo system at ambient pressure, located close to the boundary with non-magnetic systems. It has two ordering temperatures, T{sub N1}=3.9K and T{sub N2}=3.2K, which are suppressed under pressure. Between 0.7 and 1.4GPa only a single transition was identified, with T{sub N} reaching 1.9K by 1.4 GPa. At 1.9GPa two transitions could again be seen by AC calorimetry at 2.0 and 1.3K, accompanied by a qualitative change in the behaviour of the resistivity. The Sommerfeld coefficient showed a maximum of 755mJmol{sup -1}K{sup -2} at 1.4GPa, up from 448mJmol{sup -1}K{sup -2} at close to ambient pressure. The residual resistivity was found to decrease sharply above 1.4GPa after an initial increase with pressure.

  2. Glass Transition Temperature Depression at the Percolation Threshold in Carbon Nanotube-Epoxy Resin and Polypyrrole-Epoxy Resin Composites

    Barrau, Sophie; Demont, Philippe; Maraval, Céline; Bernès, Alain; Lacabanne, Colette

    2005-01-01

    The glass transition temperatures of conducting composites, obtained by blending carbon nanotubes (CNTs) or polypyrrole (PPy) particles with epoxy resin, were investigated by using both differential scanning calorimetry (DSC) and dynamical mechanical thermal analysis (DMTA). For both composites, dc and ac conductivity measurements revealed an electrical percolation threshold at which the glass transition temperature and mechanical modulus of the composites pass through a minimum.

  3. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  4. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can accurately produce...... the correct volt-sec average at its output, while simultaneously achieving inductive voltage boosting. More interestingly, these performance features are achieved with no increase in the number of semiconductor commutations, and hence no increase in switching losses. The proposed converter therefore offers...

  5. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  6. Scaling and universality of ac conduction in disordered solids

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  7. The topological AC effect on noncommutative phase space

    Li, K; Li, Kang; Wang, Jianhua

    2006-01-01

    The Aharonov-Casher (AC) effect in non-commutative(NC) quantum mechanics is studied. Instead of using the star product method, we use a generalization of Bopp's shift method. After solving the Dirac equations both on noncommutative space and noncommutative phase space by the new method, we obtain the corrections to AC phase on NC space and NC phase space respectively.

  8. Considerations for an Ac Dipole for the LHC

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  9. Equivalent circuit models for ac impedance data analysis

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  10. A remark on Kov\\'acs' vanishing theorem

    Fujino, Osamu

    2012-01-01

    We give an alternative proof of Kov\\'acs' vanishing theorem. Our proof is based on the standard arguments of the minimal model theory. We do not need the notion of Du Bois pairs. We reduce Kov\\'acs' vanishing theorem to the well-known relative Kawamata--Viehweg--Nadel vanishing theorem.

  11. Flexible AC transmission systems: the state of the art

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  12. Precursors of Short GRBs Registered by SPI-ACS/INTEGRAL

    Minaev, P.; Pozanenko, A.

    2016-10-01

    We have searched for precursors in light curves of short gamma-ray bursts registered by SPI-ACS/INTEGRAL in 2002-2014. The portion of short bursts with precursor activity will be less than 0.4% from all short bursts registered by SPI-ACS.

  13. Effect of electric fields on the stabilization of premixed laminar bunsen flames at low AC frequency: Bi-ionic wind effect

    Kim, Minkuk

    2012-03-01

    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally by applying AC electric fields at low frequency below 60. Hz together with DC in the single electrode configuration. The blowoff velocity has been measured for varying AC voltage and frequency. A transition frequency between low and high frequency regimes has been identified near 40-50. Hz, where AC electric fields have minimal effect on flame stabilization. In the low frequency regime, the blowoff velocity decreased linearly with AC voltage such that the flames became less stable. This was consistent with the DC result, implying the influence of the ionic wind effect. The variation of blowoff velocity with AC frequency showed a non-monotonic behavior in that the velocity decreased and then increased, exhibiting minimum blowoff velocity near 6-8. Hz. Based on the molecular kinetic theory, the developing degree of ionic wind was derived. By considering the ionic wind effects arising from both positive and negative ions in a flame zone, the bi-ionic wind effect successfully explained the non-monotonic behavior of blowoff velocity with AC frequency in the low frequency regime. © 2011 The Combustion Institute.

  14. New switching pattern for AC/AC converters with RB-IGBTs for offshore wind parks

    Mogstad, Anne Berit

    2008-01-01

    Offshore wind power has an increasing interest in the research community and among the politicians. Therefore it is important to find the right solutions to meet the environmental and commercial requirements to give offshore wind power a promising future. This thesis are proposing a new converter topology for offshore wind parks. Since the topology is based on DC transmission in stead of AC transmission it is better suited for use in this type of parks. All the converters are located in the w...

  15. Determination for β-delayed fission probability of 230Ac

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  16. Characterisation of AC1: a naturally decaffeinated coffee

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  17. Ac response of a coupled double quantum dot

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  18. Estimation of the Thurstonian model for the 2-AC protocol

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  19. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  20. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    房绪鹏

    2006-01-01

    提出了一种新型AC/AC变流器电路--单相电压型Z源AC/AC变流器;介绍了其电路拓扑、工作原理、控制方法等;给出了相应的仿真和实验结果.仿真和实验证实了该电路拓扑的合理性和优越性.

  1. An Ac transposon system based on maize chromosome 4S for isolating long-distance-transposed Ac tags in the maize genome.

    Wang, Fei; Li, Zhaoying; Fan, Jun; Li, Pengfei; Hu, Wei; Wang, Gang; Xu, Zhengkai; Song, Rentao

    2010-12-01

    Transposon tagging is an important tool for gene isolation and functional studies. In maize, several transposon-tagging systems have been developed, mostly using Activator/Dissociation (Ac/Ds) and Mutator systems. Here, we establish another Ac-based transposon system with the donor Ac tightly linked with sugary1 (su1) on maize chromosome 4S. Newly transposed Ac (tr-Acs) were detected based on a negative dosage effect, and long-distance-transposed Ac events were identified and isolated from the donor Ac by a simple backcross scheme. In this study, we identified 208 independent long-distance-transposed Ac lines. Thirty-one flanking sequences of these tr-Acs were isolated and localized in the maize genome. As found in previous studies, the tr-Acs preferentially inserted into genic sequences. The distribution of tr-Acs is not random. In our study, the tr-Acs preferentially transposed into chromosomes 1, 2, 9 and 10. We discuss the preferential distribution of tr-Acs from Ac systems. Our system is complementary to two other Ac-based regional-mutagenesis systems in maize, and the combined use of these systems will achieve an even and high-density distribution of Ac elements throughout the maize genome for functional-genomics studies.

  2. Structural Transitions in Topologically Constrained DNA

    Leger, J.; Romano, G.; Sarkar, A.; Robert, J.; Bourdieu, L.; Chatenay, D.; Marko, J. F.

    2000-03-01

    We propose a theoretical explanation for results of recent single molecule micromanipulation experiments (Leger et al, PRL 83, 1066, 1999) on double-stranded DNA with fixed linking number. The topological constraint leads to novel structural transitions, including a shift of the usual 60 pN B-form to S-form transition force plateau up to a force of 100 pN when linking is fixed at zero. Our model needs five distinct states to explain the four different observed transitions. The various constant-force plateaus observed for different fixed values of linking correspond to a mixture of different pairs of states, weighted to satisfy the topological constraint. Our model allows us to conclude that sufficiently overtwisted DNA (positive linkage number) undergoes a transition from B-form DNA to a mixture of S-form and P-form DNA at a force plateau near 45 pN, and then to homogeneous P-form DNA at a force plateau near 110 pN. A similar two-step transition occurs for undertwisted DNA, and by analysing the twisting necessary to produce pure S-form DNA we conclude that the S-state has helix repeat of 38 bp. Support from the Whitaker Foundation, the NSF, the ACS-PRF and Research Corporation is gratefully acknowledged.

  3. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  4. Thermal hysteresis of Morin transition in hematite particles.

    Suber, L; Imperatori, P; Mari, A; Marchegiani, G; Mansilla, M Vasquez; Fiorani, D; Plunkett, W R; Rinaldi, D; Cannas, C; Ennas, G; Peddis, D

    2010-07-14

    Rhombohedral shaped, single crystal hematite particles with narrow size distribution (D(TEM) = 93 +/- 2 nm) were prepared by hydrolysis of iron chloride and polymerisation in water. The results of field dependent magnetization measurements at different warming-cooling rates and ac susceptibility measurements at varying frequencies are reported and discussed. Thermal hysteresis (DeltaT(M)) associated with the Morin transition and field dependence of the Morin temperature (T(M)) are observed in warming-cooling cycles (DeltaT(M) = 25 and 13 K for H = 0.1 and 3 T, respectively) due to the first order phase transition. A frequency dependence of ac susceptibility is observed above T(M), as a result of the relaxation of the magnetic moment of hematite particles in the weak-ferromagnetic phase.

  5. PyTransit: Transit light curve modeling

    Parviainen, Hannu

    2015-05-01

    PyTransit implements optimized versions of the Giménez and Mandel & Agol transit models for exoplanet transit light-curves. The two models are implemented natively in Fortran with OpenMP parallelization, and are accessed by an object-oriented python interface. PyTransit facilitates the analysis of photometric time series of exoplanet transits consisting of hundreds of thousands of data points, and of multipassband transit light curves from spectrophotometric observations. It offers efficient model evaluation for multicolour observations and transmission spectroscopy, built-in supersampling to account for extended exposure times, and routines to calculate the projected planet-to-star distance for circular and eccentric orbits, transit durations, and more.

  6. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Henrik H. El Ali

    2012-10-01

    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  7. Measurement of AC loss of superconductors by vaporizing method

    Wakabayashi, Hiroshi; Isono, Takaaki; Matsui, Kunihiro; Fujisaki, Reishi; Nunoya, Yoshihiko; Koizumi, Norikiyo; Takahashi, Yoshikazu; Tsuji, Hiroshi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1995-07-01

    In Japan Atomic Energy Research Institute, the development of superconducting pulse conductors for next period nuclear fusion reactors has been carried out. For these conductors, the rated current of 46 kA and the rated magnetic field of 13T are demanded. When the pulse excitation of superconductors is carried out, AC loss arises, and the temperature of the superconductors rises, and when it exceeds a certain value, the superconducting state cannot be maintained. Therefore, the AC loss of pulse conductors must be limited to a low value. It is difficult to evaluate the AC loss of superconductors by calculation, therefore, it is evaluated by actual measurement. There are magnetizing method and vaporizing method for measuring the AC loss. This time, the equipment for measuring the AC loss of 40 kA class superconductors by vaporizing method which measures the helium gas quantity vaporizing at the time of AC loss occurrence was designed and manufactured for the first time. The method of measuring the AC loss, the structure of the measuring equipment, the helium gas recovering part and the measuring part, the countermeasures for preventing helium gas leakage, the resistance heater for calibration, and the results of measurement are reported. (K.I.)

  8. AC Impedance Behaviour of Black Diamond Films

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  9. Faint Galaxies in deep ACS observations

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L

    2003-01-01

    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  10. Neurinoma central do nervo acústico

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  11. Cyclotron production of Ac-225 for targeted alpha therapy.

    Apostolidis, C; Molinet, R; McGinley, J; Abbas, K; Möllenbeck, J; Morgenstern, A

    2005-03-01

    The feasibility of producing Ac-225 by proton irradiation of Ra-226 in a cyclotron through the reaction Ra-226(p,2n)Ac-225 has been experimentally demonstrated for the first time. Proton energies were varied from 8.8 to 24.8 MeV and cross-sections were determined by radiochemical analysis of reaction yields. Maximum yields were reached at incident proton energies of 16.8 MeV. Radiochemical separation of Ac-225 from the irradiated target yielded a product suitable for targeted alpha therapy of cancer.

  12. An Improved AC-BM Algorithm for Monitoring Watch List

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  13. Recurrent Security Gaps In 802.11ac Routers

    Mohammed Farik; ABM Shawkat Ali

    2015-01-01

    Abstract In comparison to earlier IEEE 802.11 standard abgn routers todays popular 802.11ac standard routers have enhanced security. However 802.11ac router still has major security vulnerabilities. The novelty of this paper is that we not only highlight multiple security vulnerabilities in 802.11ac router technologies that still have not been secured since the earlier standards but also present some new ideas with solutions. We believe that our line of thoughts on security vulnerabilities ga...

  14. Analysis of Input and Output Ripples of PWM AC Choppers

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  15. Advanced DC/AC inverters applications in renewable energy

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  16. Single-Phase Four Switch Z-Source AC-AC Converters%单相四开关Z源AC-AC变换器

    汤雨; 谢少军; 张超华

    2007-01-01

    提出了一种单相四开关Z源AC-AC变换器,它包括电压型与电流型两类.与传统脉宽调制AC-AC变换器相比,它具有如下特点:输出电压范围宽且可升可降,输出电压与输入电压可同相或反相,冲击和谐波电流小,可靠性高.针对AC-AC变换器中固有的开关管换流问题,提出了一种适用于单相四开关Z源AC-AC变换器的换流方案,无需外加缓冲吸收电路即可实现开关管的安全换流.以电压型单相四开关Z源AC-AC变换器为例,对其进行了理论分析、仿真和原理试验研究.实验结果证实了Z源变换器的特性及换流方案的可行性.

  17. Second- and First-Order Phase Transitions in CDT

    Ambjorn, J; Jurkiewicz, J; Loll, R

    2012-01-01

    Causal Dynamical Triangulations (CDT) is a proposal for a theory of quantum gravity, which implements a path-integral quantization of gravity as the continuum limit of a sum over piecewise flat spacetime geometries. We use Monte Carlo simulations to analyse the phase transition lines bordering the physically interesting de Sitter phase of the four-dimensional CDT model. Using a range of numerical criteria, we present strong evidence that the so-called A-C transition is first order, while the B-C transition is second order. The presence of a second-order transition may be related to an ultraviolet fixed point of quantum gravity and thus provide the key to probing physics at and possibly beyond the Planck scale.

  18. Magic Wavelength for the Hydrogen 1S-2S Transition

    Kawasaki, Akio

    2016-05-01

    The state of the art precision measurement of the transition frequencies of neutral atoms is performed with atoms trapped by the magic wavelength optical lattice that cancels the ac Stark shift of the transitions. Trapping with magic wavelength lattice is also expected to improve the precision of the hydrogen 1S-2S transition frequency, which so far has been measured only with the atomic beam. In this talk, I discuss the magic wavelength for the hydrogen 1S-2S transition, and the possibility of implementing the optical lattice trapping for hydrogen. Optical trapping of hydrogen also opens the way to perform magnetic field free spectroscopy of antihydrogen for the test of CPT theorem.

  19. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  20. Hydrolysis of polycarbonate catalyzed by ionic liquid [Bmim][Ac].

    Song, Xiuyan; Liu, Fusheng; Li, Lei; Yang, Xuequn; Yu, Shitao; Ge, Xiaoping

    2013-01-15

    Hydrolysis of polycarbonate (PC) was studied using ionic liquid 1-butyl-3-methylimidazolium acetate ([Bmim][Ac]) as a catalyst. The influences of temperature, time, water dosage and [Bmim][Ac] dosage on the hydrolysis reaction were examined. Under the conditions of temperature 140°C, reaction time 3.0 h, m([Bmim][Ac]):m(PC)=1.5:1 and m(H(2)O):m(PC)=0.35:1, the conversion of PC was nearly 100% and the yield of bisphenol A (BPA) was over 96%. The ionic liquid could be reused up to 6 times without apparent decrease in the conversion of PC and yield of BPA. The kinetics of the reaction was also investigated. The results showed that the hydrolysis of PC in [Bmim][Ac] was a first-order kinetic reaction with an activation energy of 228 kJ/mol.

  1. Methanolysis of polycarbonate catalysed by ionic liquid [Bmim][Ac].

    Liu, Fusheng; Li, Lei; Yu, Shitao; Lv, Zhiguo; Ge, Xiaoping

    2011-05-15

    The methanolysis of polycarbonate (PC) was studied using ionic liquid [Bmim][Ac] as a catalyst. The effects of temperature, time, methanol dosage and [Bmim][Ac] dosage on the methanolysis reaction were examined. It was shown that the conversion of PC was nearly 100%, and the yield of bisphenol A (BPA) was over 95% under the following conditions: m([Bmim][Ac]):m(PC) = 0.75:1;m(methanol):m(PC) = 0.75:1; a reaction temperature of 90 °C and a total time of 2.5h. The ionic liquid could be reused up to 6 times with no apparent decrease in the conversion of PC and yield of BPA. The kinetics of the reaction was also investigated. The results indicated that the methanolysis of PC in [Bmim][Ac] was a first-order kinetic reaction with an activation energy of 167 kJ/mol.

  2. Alternating current(AC) corrosion analyzed by electrochemical impedance spectroscopy

    Ha, Tae Hyun; Kim, Dae Kyeong; Bae, Jeong Hyo; Lee, Hyun Goo; Lee, Sung Jin [Korea Electrotechnology Research Institute, Changwon (Korea, Republic of)

    2002-12-15

    So far, many research results on AC corrosion have been reported but each one is not consistent with another. In order to understand the characteristics and factors affecting on AC corrosion, Electrochemical impedance spectroscopy (E.I.S) was used and changes in kinetics and surface properties was analyzed. Generally, E.I.S. test has been used mainly for the diagnosis of the concrete corrosion and coating material. However, considering the outstanding functions of E.I.S. test, it can be adopted as a good method to study AC corrosion. Electrolyte resistance (R{sub sol}), double layer capacitance (C{sub dl}) and polarization resistance (R{sub p}) are the basic circuit elements. Using the model which is consist of these basic elements, various results of E.I.S. test can be interpreted. And through this method the mechanism and characteristics of AC corrosion can be explained

  3. ACS Algorithm in Discrete Ordinates for Pressure Vessel Dosimetry

    Walters William

    2016-01-01

    Full Text Available The Adaptive Collision Source (ACS method can solve the Linear Boltzmann Equation (LBE more efficiently by adaptation of the angular quadrature order. This is similar to, and essentially an extension of, the first collision source method. Previously, the ACS methodology has been implemented into the TITAN discrete ordinates code, and has shown speedups of 2–4 on a simple test problem, with very little loss of accuracy (within a provided adaptive tolerance. This work examines the use of the ACS method for a more realistic problem: pressure vessel dosimetry with the VENUS-2 MOX-fuelled reactor dosimetry benchmark. The ACS method proved to be able to obtain accurate results while being approximately twice as efficient as using a constant quadrature in a standard source iteration scheme.

  4. Fabrication of alumina films with laminated structures by ac anodization

    Hiroyo Segawa

    2014-01-01

    Full Text Available Anodization techniques by alternating current (ac are introduced in this review. By using ac anodization, laminated alumina films are fabricated. Different types of alumina films consisting of 50–200 nm layers were obtained by varying both the ac power supply and the electrolyte. The total film thickness increased with an increase in the total charge transferred. The thickness of the individual layers increased with the ac voltage; however, the anodization time had little effect on the film thickness. The laminated alumina films resembled the nacre structure of shells, and the different morphologies exhibited by bivalves and spiral shells could be replicated by controlling the rate of increase of the applied potentials.

  5. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  6. A hybrid electromechanical solid state switch for ac power control

    1972-01-01

    Bidirectional thyristor coupled to a series of actuator driven electromechanical contacts generates hybrid electromechanical solid state switch for ac power control. Device is useful in power control applications where zero crossover switching is required.

  7. A precursor of β-delayed fission:230Ac

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  8. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  9. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  10. Development of the Field of Flexible AC Transmission Systems (FACTS)

    2000-01-01

    @@ Theoretical and technological development of large capacity power electronics and flexible AC transmission systems are one of the most important projects developed by Tsinghua University. The Flexible AC Transmission System (FACTS) technology which uses power electronics to improve the efficiency and quality of the electrical generation, transmission and distribution system is considered to be one of the most significant technological innovations for power systems in the 20th century. The advanced static var generator (ASVG) is a key FACTS device.

  11. The topological AC effect on non-commutative phase space

    Li, Kang [Hangzhou Teachers College, Department of Physics, Hangzhou (China); The Abdus Salam International Center for Theoretical Physics, Trieste (Italy); Wang, Jianhua [Shaanxi University of Technology, Department of Physics, Hanzhong (China); The Abdus Salam International Center for Theoretical Physics, Trieste (Italy)

    2007-05-15

    The Aharonov-Casher (AC) effect in non-commutative (NC) quantum mechanics is studied. Instead of using the star product method, we use a generalization of Bopp's shift method. After solving the Dirac equations both on non-commutative space and non-commutative phase space by the new method, we obtain corrections to the AC phase on NC space and NC phase space, respectively. (orig.)

  12. Antifriction coatings based on a-C for biomedicine applications

    Yurjev, Y. N.; Kiseleva, D. V.; Zaitcev, D. A.; Sidelev, D. V.; Korneva, O. S.

    2016-01-01

    This article reports on the investigation of mechanical properties of carbon films deposited by dual magnetron sputtering system with closed and mirror magnetic field. There is shown that a-C films with predominantly sp2-phase have relatively high hardness (up to 20 GPa) and low friction index (∼0.01). The influence of magnetic field on friction index is determined. The analysis of experimental data shows the obtained a-C samples can be used for biomedicine applications.

  13. An AC magnetohydrodynamic micropump: towards a true integrated microfluidic system

    Lee, A P; Lemoff, A V; McConaghy, C F; Miles, R R

    1999-03-01

    An AC Magnetohydrodynamic (MHD) micropump has been demonstrated in which the Lorentz force is used to propel an electrolytic solution along a microchannel etched in silicon. This micropump has no moving parts, produces a continuous (not pulsatile) flow, and is compatible with solutions containing biological specimens. micropump, using the Lorentz force as the pumping mechanism for biological analysis. The AC Magnetohydrodynamic (MHD) micropump investigated produces a continuous flow and allows for complex microchannel design.

  14. Frequency dependence of the superparamagnetic transition in a Finemet-type nanocrystalline alloy

    Franco, V.; Blazquez, J.S.; Conde, C.F.; Conde, A. [Dpto. Fisica de la Materia Condensada. ICMSE-CSIC, Universidad de Sevilla, P.O. Box 1065, 41080-Sevilla (Spain); Kiss, L.F.; Kemeny, T. [Research Institute for Solid State Physics and Optics, Hungarian Academy of Sciences. P.O. Box 49, 1525-Budapest (Hungary); Hillier, A.D. [ISIS Facility, CCLRC, Rutherford Appleton Laboratory, Chilton, OX11 0QX (United Kingdom)

    2004-12-01

    The transition to superparamagnetism in a Cr-containing Finemet alloy has been studied by means of ac susceptibility and muon spin relaxation experiments. The influence of bias field and measuring frequency has been analyzed. The transition temperature is controlled by the interaction between the particles. These results are consistent with previous static magnetic measurements. (copyright 2004 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  15. AC electrophoretic deposition of organic-inorganic composite coatings.

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R

    2013-02-15

    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials.

  16. Update on bedside ultrasound (US) diagnosis of acute cholecystitis (AC).

    Zenobii, Maria Francesca; Accogli, Esterita; Domanico, Andrea; Arienti, Vincenzo

    2016-03-01

    Acute cholecystitis (AC) represents a principal cause of morbidity worldwide and is one of the most frequent reasons for hospitalization due to gastroenteric tract diseases. AC should be suspected in presence of clinical signs and of gallstones on an imaging study. Upper abdominal US represents the first diagnostic imaging step in the case of suspected AC. Computed tomography (CT) with intravenous contrast (IV) or magnetic resonance imaging (MRI) with gadolinium contrast and technetium hepatobiliary iminodiacetic acid (Tc-HIDA) can be employed to exclude complications. US examination should be performed with right subcostal oblique, with longitudinal and intercostal scans. Normal gallbladder US findings and AC major and minor US signs are described. Polyps, sludge and gallbladder wall thickening represent the more frequent pitfalls and they must be differentiated from stones, duodenal artifacts and many other non-inflammatory conditions that cause wall thickening, respectively. By means of bedside ultrasound, the finding of gallstones in combination with acute pain, when the clinician presses the gallbladder with the US probe (the sonographic Murphy's sign), has a 92.2 % positive predictive value for AC. In our preliminary experience, bedside US-performed by echoscopy (ES) and/or point-of-care US (POCUS) demonstrated good reliability in detecting signs of AC, and was always integrated with physical examination and performed by a skilled operator.

  17. Temperature integration at the AC thermosensory neurons in Drosophila.

    Tang, Xin; Platt, Michael D; Lagnese, Christopher M; Leslie, Jennifer R; Hamada, Fumika N

    2013-01-16

    Temperature sensation has a strong impact on animal behavior and is necessary for animals to avoid exposure to harmful temperatures. It is now well known that thermoTRP (transient receptor potential) channels in thermosensory neurons detect a variable range of temperature stimuli. However, little is known about how a range of temperature information is relayed and integrated in the neural circuits. Here, we show novel temperature integration between two warm inputs via Drosophila TRPA channels, TRPA1 and Pyrexia (Pyx). The internal AC (anterior cell) thermosensory neurons, which express TRPA1, detect warm temperatures and mediate temperature preference behavior. We found that the AC neurons were activated twice when subjected to increasing temperatures. The first response was at ∼25°C via TRPA1 channel, which is expressed in the AC neurons. The second response was at ∼27°C via the second antennal segments, indicating that the second antennal segments are involved in the detection of warm temperatures. Further analysis reveals that pyx-Gal4-expressing neurons have synapses on the AC neurons and that mutation of pyx eliminates the second response of the AC neurons. These data suggest that AC neurons integrate both their own TRPA1-dependent temperature responses and a Pyx-dependent temperature response from the second antennal segments. Our data reveal the first identification of temperature integration, which combines warm temperature information from peripheral to central neurons and provides the possibility that temperature integration is involved in the plasticity of behavioral outputs.

  18. Diagnostics of the Fermilab Tevatron using an AC dipole

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  19. A Novel High Performance Bridgeless Ac-Dc Boost Converter

    S.M.AshrafulAlam Mohon

    2016-08-01

    Full Text Available A new single phase high performance bridgeless AC-DC Boost converter is proposed. The converter is made bridgeless by the use of two unidirectional switches and two diodes at the input ac side for power conversion for both positive and negative half cycle. Because of the high frequency switching, the power factor of the circuit is inherently corrected and it requires a small filter to make the input current near sinusoidal with limited THD. The significant improvement in THD makes the circuit a good choice in applications needing AC-DC conversion with power conditioning. The circuit exhibits such better performances than conventional AC-DC boost converter with variable loads at constant frequency switching with no additional control circuits. The efficiency of the circuit is also satisfactory. Analysis and simulation results of the circuit are obtained by using software simulation. The main advantage of this new AC-DC converter is its superior power quality over conventional AC-DC boost converter

  20. Energy Released During the H-L Back Transition

    Eldon, D.; Kolemen, E.; Gohil, P.; McKee, G. R.; Yan, Z.; Schmitz, L.

    2015-11-01

    Prompt energy loss (ΔW) at the H-L transition, as a fraction of total stored energy before the transition, is about 30 % and is insensitive to density in ITER-similar DIII-D plasmas. Occasionally, some ELMs will appear before the transition and reduce total energy, thus reducing ΔW across the following transition. Other results (not in the ITER-similar shape) have shown that ELMs can be triggered in low powered H-modes, prior to H-L transitions, when the plasma is stable to ideal P-B modes (these are not typical type-I ELMs, despite superficial similarities) and E × B shear is strong. These are indeed ELMs occurring in H-mode and not part of a dithering transition. Finally, ELM ΔW is sensitive to edge toroidal rotation and becomes smaller than uncertainty (point to a strategy where ΔW for the H-L transition may be reduced by the presence of (not type-I) ELMs before the transition, and ΔW for the ELMs may be reduced by controlling rotation. Work supported by the US Department of Energy under DE-AC02-09CH11466 and DE-FC02-04ER54698.

  1. 21 CFR 880.6320 - AC-powered medical examination light.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate...

  2. Unintentional conversion of benign paroxysmal positional vertigo caused by repositioning procedures for canalithiasis: transitional BPPV.

    Babic, Borivoj B; Jesic, Snezana D; Milovanovic, Jovica D; Arsovic, Nenad A

    2014-05-01

    BPPV when diagnosed before any repositioning procedure is called primary BPPV. Primary BPPV canalithiasis treatment with repositioning procedures sometimes results in unintentional conversion of BPPV form: transitional BPPV. Objectives were to find transitional BPPV forms, how they influence relative rate of canal involvement and how to be treated. This study is a retrospective case review performed at an ambulatory, tertiary referral center. Participants were 189 consecutive BPPV patients. Main outcome measures were detection of transitional BPPV, outcome of repositioning procedures for transitional canalithiasis BPPV and spontaneous recovery for transitional cupulolithiasis BPPV. Canal distribution of primary BPPV was: posterior canal (Pc): 85.7% (162/189), horizontal canal (Hc): 11.6% (22/189), anterior canal (Ac): 2.6% (5/189); taken together with transitional BPPV it was: Pc: 71.3% (164/230), Hc: 26.5% (61/230), Ac: 2.2% (5/230). Transitional BPPV forms were: Hc canalithiasis 58% (24/41), Hc cupulolithiasis 37% (15/41) and common crux reentry 5% (2/41). Treated with barbecue maneuver transitional Hc canalithiasis cases either resolved in 58% (14/24) or transitioned further to transitional Hc cupulolithiasis in 42% (10/24). In follow-up of transitional Hc cupulolithiasis we confirmed spontaneous recovery in 14/15 cases in less than 2 days. The most frequent transitional BPPV form was Hc canalithiasis so it raises importance of barbecue maneuver treatment. Second most frequent was transitional Hc cupulolithiasis which very quickly spontaneously recovers and does not require any intervention. The rarest found transitional BPPV form was common crux reentry which is treated by Canalith repositioning procedure. Transitional BPPV taken together with primary BPPV may decrease relative rate of Pc BPPV, considerably increase relative rate of Hc BPPV and negligibly influence relative rate of Ac BPPV. Transitional BPPV forms can be produced by repositioning maneuvers

  3. AC Read-Out Circuits for Single Pixel Characterization of TES Microcalorimeters and Bolometers

    Gottardi, L.; van de Kuur, J.; Bandler, S.; Bruijn, M.; de Korte, P.; Gao, J. R.; den Hartog, R.; Hijmering, R. A.; Hoevers, H.; Koshropanah, P.; Kilbourne, C.; Lindemann, M. A.; Parra Borderias, M.; Ridder, M.

    2011-01-01

    SRON is developing Frequency Domain Multiplexing (FDM) for the read-out of transition edge sensor (TES) soft x-ray microcalorimeters for the XMS instrument of the International X-ray Observatory and far-infrared bolometers for the SAFARI instrument on the Japanese mission SPICA. In FDM the TESs are AC voltage biased at frequencies from 0.5 to 6 MHz in a superconducting LC resonant circuit and the signal is read-out by low noise and high dynamic range SQUIDs amplifiers. The TES works as an amplitude modulator. We report on several AC bias experiments performed on different detectors. In particular, we discuss the results on the characterization of Goddard Space Flight Center x-ray pixels and SRON bolometers. The paper focuses on the analysis of different read-out configurations developed to optimize the noise and the impedance matching between the detectors and the SQUID amplifier. A novel feedback network electronics has been developed to keep the SQUID in flux locked loop, when coupled to superconducting high Q circuits, and to optimally tune the resonant bias circuit. The achieved detector performances are discussed in view of the instrument requirement for the two space missions.

  4. The AC (Alternating Current) Electrical Behavior of Multi-layered Thermoelectric Devices

    Alim, Mohammad A.; Budak, Satilmis; Bhattacharjee, Sudip

    2016-11-01

    In this study the ac (alternating current) small-signal electrical data in the frequency range 5 Hz ≤ f ≤ 13 MHz are obtained for the multi-layered thermoelectric (TE) devices to extract underlying operative mechanisms via an equivalent circuit model. This model is developed from the complex plane plots in conjunction with the Bode plot. It is observed that the inductive behavior is prevalent for both unbombarded and bombarded TE devices regardless of the doses as both types are observed as somewhat weak in thermoelectric properties. The bombarded multi-layered devices followed a systematic pattern in ac behavior via semicircular relaxation both in the impedance and admittance planes for the same measured data. This pattern is attributed to the transition from one lumped behavior to two distinct mechanisms. It is observed that the conductive nature of the equivalent circuit model via non-blocking (non-capacitive) elements, attributed to the underlying operative electrical paths between the two opposite electrodes across the multi-layered device exists, satisfying direct current conditions of the equivalent circuit model. The inductive behavior at high frequencies originates from the conductive aspect of the lumped response of the device in addition to the contribution of the electrode leads. Thus, the proposed equivalent circuit model contains external inductance that verifies a meaningful representation of the multi-layered TE device, though weak in thermoelectric properties.

  5. A.c. susceptibility study of CaCl2 doped copper–zinc ferrite system

    A Y Lipare; P N Vasambekar; A S Vaingankar

    2003-08-01

    Polycrystalline soft ferrites, Zn$_x$ Cu$_{1–x}$ Fe2O4 ( = 0.30, 0.50, 0.70, 0.80 and 0.90), doped with controlled amount of calcium chloride (CaCl2) were prepared by standard ceramic route and studied for a.c. susceptibility. X-ray diffraction studies of the compositions reveal formation of single-phase cubic spinel. The values of lattice constant increase as doping percentage of CaCl2 increased from 0.01% to 0.05% and afterwards decrease slightly. The presence of chlorine ions is confirmed by absorption peak in far IR spectra near 650 cm-1 for all the samples. The variation of a.c. susceptibility with temperature shows the existence of single domain structure for = 0.3 and exhibits transition from single domain to multidomain structure with increased Ca2+ contents from 0.01 to 0.1%. The composition, = 0.5, shows multidomain structure independent of Ca2+ content. The samples for = 0.70, 0.80 and 0.90 show paramagnetic behaviour at and above room temperature.

  6. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae)

    Manoj Chugh; B R Gulati; S K Gakhar

    2010-03-01

    A repertoire of monoclonal antibodies (mAbs) was generated against the midgut proteins of Anopheles culicifacies mosquitoes. The mAbs AC-43 and AC-29 significantly inhibited Plasmodium vivax development inside the mosquito midgut. The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 recognized 52, 44, 40 and 29 kDa polypeptides. These female midgut-specific polypeptides are shared between An. culicifacies and An. stephensi, two major vectors of malaria in India. Deglycosylation assays revealed that -linked carbohydrates are the major components in epitopes corresponding to AC-43 and AC-29. Gold particle labelling revealed that both these mAbs preferentially bind to glycoproteins at the apical microvilli and the microvillus-associated network present inside transverse sections of the gut epithelium. These regions are particularly known to have receptors for ookinetes, which enable them to cross this epithelial barrier and provide them with certain necessary chemicals or components for further development into oocysts. Therefore, these glycoproteins appear to be potential candidates for a vectordirected transmission-blocking vaccine (TBV).

  7. Microscopic dynamics of AC{sub 60} compounds in the plastic, polymer, and dimer phases investigated by inelastic neutron scattering

    Schober, H.; Toelle, A. [Institut Laue-Langevin, F-38042 Grenoble (France); Renker, B.; Heid, R.; Gompf, F. [INFP, Forschungszentrum Karlsruhe, D-76021 Karlsruhe (Federal Republic of Germany)

    1997-09-01

    We present inelastic neutron-scattering results for AC{sub 60} (A=K,Rb,Cs) compounds. The spectra of the high-temperature fcc phases strongly resemble the ones of pristine C{sub 60} in the plastic phase. At equal temperatures we find identical rotational diffusion constants for pristine C{sub 60} and Rb{sub 1}C{sub 60} (D{sub r}=2.4 10{sup 10} s{sup {minus}1} at 400 K). The changes taking place in the inelastic part of the spectra on cooling AC{sub 60} indicate the formation of strong intermolecular bonds. The buildup of intensities in the gap region separating internal and external vibrations in pure C{sub 60} is the most prominent signature of this transition. The spectra of the low-temperature phases depend on their thermal history. The differences can be explained by the formation of a polymer phase (upon slow cooling from the fcc phase) and a dimer phase (upon fast cooling), respectively. The experimental data are analyzed on the basis of lattice dynamical calculations. The density-of-states are well modeled assuming a [2+2] bond for the polymer and a single intercage bond for the dimer. Indications for different intercage bonding are also found in the internal mode spectra, which, on the other hand, react only weakly to the charge transfer. The dimer phase is metastable and converts into the polymer phase with a strongly temperature-dependent time constant. The transition from the polymer to the fcc phase is accompanied by inelastic precursor effects which are interpreted as the signature of inhomogeneities arising from plastic monomer regions embedded in the polymer phase. In the polymer phase AC{sub 60} compounds show strong anharmonic behavior in the low-temperature region. The possible connection with the metal-to-insulator transition is discussed. {copyright} {ital 1997} {ital The American Physical Society}

  8. The Study on AC Susceptibility Grained Model for The High-Tc Superconductor Bi-2223

    Ozogul, O.

    2010-01-01

    The magnetic properties and the current transport of High-Tc ceramics are governed not only by the nature of diamagnetic grains but also by their interconnections which constitute the superconducting matrix. Such a sintered High-Tc Superconductor has two effects. One is intrinsic to the superconducting grains and the other is characteristic of the coupling between grains. These phenomena have been widely studied in order to understand the mechanisms governing the flux lines dynamic within critical-state models. While the original Bean model of the critical-state only predicts single characteristic in the imaginary part of the fundamental susceptibilities, grained Bean model, where the superconducting grains are immersed in weak superconducting matrix, predicts the typical double peak appear in the imaginary part and double transitions in the real part. The predictions of the grained Bean model for the field and temperature dependencies of the ac magnetic susceptibilities are compared with experimental results.

  9. AC susceptibility studies of grain-aligned superconductors by grained Bean model

    Sakamoto, Nobuyoshi; Akune, Tadahiro [Department of Electrical Engineering and Information Technology, Kyushu Sangyo University, 2-3-1 Matsukadai, Fukuoka (Japan); Matsumoto, Yasukuni, E-mail: saka@te.kyusan-u.ac.j [Department of Electrical Engineering, Fukuoka University, 8-19-1 Nanakuma Fukuoka (Japan)

    2009-03-01

    AC susceptibility of low-T{sub c} metallic superconductors shows smooth transition in the in-phase chi' and a peak in the out-phase chi''. High-T{sub c} oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics, such as double peaks in chi'' and shoulders in chi'. Instead of simple Bean model, a grained Bean model, where the superconducting grains is immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the grained Bean model show varied and deformed curves as observed in the high-T{sub c} superconductors. From the dependence of chi' and chi'' on temperatures T and DC magnetic fields B{sub dc} in grain-aligned Hg(Re)-1223 superconductors, textures of grains and interconnecting links and their grain-aligned nature can be estimated.

  10. AC susceptibility studies of grain-aligned superconductors by grained Bean model

    Sakamoto, Nobuyoshi; Akune, Tadahiro; Matsumoto, Yasukuni

    2009-03-01

    AC susceptibility of low-Tc metallic superconductors shows smooth transition in the in-phase χ' and a peak in the out-phase χ". High-Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics, such as double peaks in χ" and shoulders in χ'. Instead of simple Bean model, a grained Bean model, where the superconducting grains is immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the grained Bean model show varied and deformed curves as observed in the high-Tc superconductors. From the dependence of χ' and χ" on temperatures T and DC magnetic fields Bdc in grain-aligned Hg(Re)-1223 superconductors, textures of grains and interconnecting links and their grain-aligned nature can be estimated.

  11. Use of CYPRES™ cutters with a Kevlar clamp band for hold-down and release of the Icarus De-Orbit Sail payload on TechDemoSat-1

    Kingston, J.; Hobbs, S.; Roberts, P.; Juanes-Vallejo, C.; Robinson, F.; Sewell, R.; Snapir, B.; Llop, J. Virgili; Patel, M.

    2014-07-01

    TechDemoSat-1 is a UK-funded technology demonstration satellite, carrying 8 payloads provided by UK organisations, which is due to be launched in the first quarter of 2014. Cranfield University has supplied a De-Orbit Sail (DOS) payload to allow the mission to comply with end-of-life debris mitigation guidelines. The payload provides a passive, simple, and low-cost means of mitigating debris proliferation in Low Earth Orbit, by enhancing spacecraft aerodynamic drag at end-of-life and reducing time to natural orbital decay and re-entry. This paper describes the use of small commercial electro-explosive devices (EEDs), produced for use as parachute tether-cutters in reserve chute deployment systems, as low-cost but high-reliability release mechanisms for space applications. A testing campaign, including thermal vacuum and mechanical vibration, is described, which demonstrates the suitability of these CYPRES™ cutters, with a flexible Kevlar clamp band, for use as a hold-down and release mechanism (HDRM) for a deployable de-orbit sail. The HDRM is designed to be three-failure-tolerant, highly reliable, yet simple and low-cost.

  12. The Managerial Transition.

    Kneeland, Steven J.

    1980-01-01

    Having identified the problem of managerial transition in a previous article (CE 510 277), the author outlines a strategy for change which includes performance appraisal, definition of the management structure, and counselling for the individual in transition. (SK)

  13. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... independent producers/consumers to connect to multiple distribution grids in order to optimise the electricity price, as this will vary during the day from one power distribution company to another one. It will be needed to have a load that can smoothly adjust the power consumed from each power grid in order...... these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the grids...

  14. Temas de Física para Ingeniería: Acústica

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  15. Electric field driven mesoscale phase transition in polarized colloids

    Khusid, Boris; Elele, Ezinwa; Lei, Qian

    2016-11-01

    A mesoscale phase transition in a polarized suspension was reported by Kumar, Khusid, Acrivos, PRL95, 2005 and Agarwal, Yethiraj, PRL102, 2009. Following the application of a strong AC field, particles aggregated head-to-tail into chains that bridged the interelectrode gap and then formed a cellular pattern, in which large particle-free domains were enclosed by particle-rich thin walls. Cellular structures were not observed in numerous simulations of field induced phase transitions in a polarized suspension. A requirement for matching the particle and fluid densities to avoid particle settling limits terrestrial experiments to negatively polarized particles. We present data on the phase diagram and kinetics of the phase transition in a neutrally buoyant, negatively polarized suspension subjected to a combination of AC and DC. Surprisingly, a weak DC component drastically speeds up the formation of a cellular pattern but does not affect its key characteristic. However, the application of a strong DC field destroys the cellular pattern, but it restores as the DC field strength is reduced. We also discuss the design of experiments to study phase transitions in a suspension of positively polarized, non-buoyancy-matched particles in the International Space Station. Supported by NASA's Physical Science Research Program, NNX13AQ53G.

  16. Transitivity of Preferences

    Regenwetter, Michel; Dana, Jason; Davis-Stober, Clintin P.

    2011-01-01

    Transitivity of preferences is a fundamental principle shared by most major contemporary rational, prescriptive, and descriptive models of decision making. To have transitive preferences, a person, group, or society that prefers choice option "x" to "y" and "y" to "z" must prefer "x" to "z". Any claim of empirical violations of transitivity by…

  17. 一种简单新型拓扑Cuk AC/AC变换器及其仿真研究%A New Simple Topology of Cuk AC/AC Converter and Its Simulation

    陈溪; 刘韬; 谭光慧; 纪延超

    2006-01-01

    由Cuk DC/DC变换器的拓扑结构导出一种只具有两个开关的PWM AC/AC变换器的简单新型拓扑--Cuk AC/AC变换器.给出单相和三相Cuk AC/AC变换器的拓扑结构,分析Cuk AC/AC变换器的外特性及小信号特性.仿真结果验证了所提的Cuk AC/AC变换器的合理性和可行性.

  18. Modelling ac ripple currents in HTS coated conductors

    Xu, Zhihan; Grilli, Francesco

    2015-10-01

    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  19. CosmoTransitions: Computing cosmological phase transition temperatures and bubble profiles with multiple fields

    Wainwright, Carroll L.

    2012-09-01

    I present a numerical package (CosmoTransitions) for analyzing finite-temperature cosmological phase transitions driven by single or multiple scalar fields. The package analyzes the different vacua of a theory to determine their critical temperatures (where the vacuum energy levels are degenerate), their supercooling temperatures, and the bubble wall profiles which separate the phases and describe their tunneling dynamics. I introduce a new method of path deformation to find the profiles of both thin- and thick-walled bubbles. CosmoTransitions is freely available for public use.Program summaryProgram Title: CosmoTransitionsCatalogue identifier: AEML_v1_0Program summary URL: http://cpc.cs.qub.ac.uk/summaries/AEML_v1_0.htmlProgram obtainable from: CPC Program Library, Queen's University, Belfast, N. IrelandLicensing provisions: Standard CPC licence, http://cpc.cs.qub.ac.uk/licence/licence.htmlNo. of lines in distributed program, including test data, etc.: 8775No. of bytes in distributed program, including test data, etc.: 621096Distribution format: tar.gzProgramming language: Python.Computer: Developed on a 2009 MacBook Pro. No computer-specific optimization was performed.Operating system: Designed and tested on Mac OS X 10.6.8. Compatible with any OS with Python installed.RAM: Approximately 50 MB, mostly for loading plotting packages.Classification: 1.9, 11.1.External routines: SciPy, NumPy, matplotLibNature of problem: I describe a program to analyze early-Universe finite-temperature phase transitions with multiple scalar fields. The goal is to analyze the phase structure of an input theory, determine the amount of supercooling at each phase transition, and find the bubble-wall profiles of the nucleated bubbles that drive the transitions.Solution method: To find the bubble-wall profile, the program assumes that tunneling happens along a fixed path in field space. This reduces the equations of motion to one dimension, which can then be solved using the overshoot

  20. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  1. AC losses in circular arrangements of parallel superconducting tapes

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;

    1998-01-01

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  2. AC propulsion system for an electric vehicle, phase 2

    Slicker, J. M.

    1983-01-01

    A second-generation prototype ac propulsion system for a passenger electric vehicle was designed, fabricated, tested, installed in a modified Mercury Lynx vehicle and track tested at the Contractor's site. The system consisted of a Phase 2, 18.7 kw rated ac induction traction motor, a 192-volt, battery powered, pulse-width-modulated, transistorized inverter packaged for under rear seat installation, a 2-axis, 2-speed, automatically-shifted mechanical transaxle and a microprocessor-based powertrain/vehicle controller. A diagnostics computer to assist tuning and fault finding was fabricated. Dc-to-mechanical-system efficiency varied from 78% to 82% as axle speed/torque ranged from 159 rpm/788 nm to 65 rpm/328 nm. Track test efficiency results suggest that the ac system will be equal or superior to dc systems when driving urban cycles. Additional short-term work is being performed under a third contract phase (AC-3) to raise transaxle efficiency to predicted levels, and to improve starting and shifting characteristics. However, the long-term challenge to the system's viability remains inverter cost. A final report on the Phase 2 system, describing Phase 3 modifications, will be issued at the conclusion of AC-3.

  3. Impedance, AC conductivity and dielectric behavior Adeninium Trichloromercurate (II)

    Fersi, M. Amine; Chaabane, I.; Gargouri, M.

    2016-09-01

    In this work, we report the measurements impedance spectroscopy technique for the organic-inorganic hybrid compound (C5H6N5) HgCl3, 11/2H2O measured in the 209 Hz-5 MHz frequency range from 378 to 428 K. Besides, the Cole-Cole (Z″ versus Z‧) plots were well fitted to an equivalent circuit built up by a parallel combination of resistance (R), fractal capacitance (CPE) and capacitance (C). Furthermore, the AC conductivity was investigated as a function of temperature and frequency in the same range. The experiment results indicated that AC conductivity (σac) was proportional to σdc + A ωS . The obtained results are discussed in terms of the correlated barrier hopping (CBH) model. An agreement between the experimental and theoretical results suggests that the AC conductivity behavior of Adeninium Trichloromercurate (II) can be successfully explained by CBH model. The contribution of single polaron hopping to AC conductivity in a present alloy was also studied.

  4. COMPARISON OF BACTERIAL ADSORPTION AND ANTIBACTERIAL PROPERTIES BETWEEN AC AND AC(Ag)%AC及AC(Ag)对细菌的吸附及灭菌功能的对比研究

    万怡灶; 王玉林; 董向红; 周福刚; 成国祥; 温廷益; 韩森

    2000-01-01

    测定了活性碳(AC)及载银活性碳(AC(Ag))的比表面积和孔径分布曲线,对比研究了AC及AC(Ag))对大肠杆菌的吸附能力和灭菌性能.结果表明,载银后,虽然AC(Ag)的比表面积下降,但由于银的存在,使其吸附的大肠杆菌数量高于AC,而吸附速率低于AC.灭菌试验表明,AC对大肠杆菌没有杀灭能力,而AC(Ag)对大肠杆菌有较好的灭菌功能.

  5. Measurement and comparison of AC parameters of silicon (BSR and BSFR) and gallium arsenide (GaAs/Ge) solar cells used in space applications

    Anil Kumar, R.; Suresh, M.S. [ISRO Satellite Centre, ISRO, Bangalore 560, 017 Kolhapur (India); Nagaraju, J. [Department of Instrumentation, Indian Institute of Science, Bangalore 560, 012 Kolhapur (India)

    2000-01-15

    The AC parameters of silicon (BSR and BSFR) solar cells and GaAs/Ge solar cell have been measured using impedance spectroscopy. Each cell capacitance, dynamic resistance and series resistance were measured and compared. GaAs/Ge solar cell has shown only the transition capacitance throughout its operating range while silicon (BSR and BSFR) solar cells exhibited both transition and diffusion capacitance. The theoretical and experimental values of dynamic resistance were compared and found in good agreement while the diode factor in silicon solar cells varies from 2 to 1, where as in GaAs/Ge solar cell it varies from 4 to 2 to 1.

  6. Transitive spaces of operators

    Davidson, K R; Radjavi, H

    2007-01-01

    We investigate algebraic and topological transitivity and, more generally, k-transitivity for linear spaces of operators. In finite dimensions, we determine minimal dimensions of k-transitive spaces for every k, and find relations between the degree of transitivity of a product or tensor product on the one hand and those of the factors on the other. We present counterexamples to some natural conjectures. Some infinite dimensional analogues are discussed. A simple proof is given of Arveson's result on the weak-operator density of transitive spaces that are masa bimodules.

  7. Variable transposition of eight maize activator (ac) elements located on the short arm of chromosome 1.

    Sheridan, William F

    2011-09-01

    Eight Activator (Ac) transposable elements mapped to the maize chromosome arm 1S were assessed for Ac transposition rates. For each of the Ac stocks, plants homozygous for the single Ac element and the Ds reporter r1-sc:m3 on chromosome 10 were crossed as females by a homozygous r1-sc:m3 tester color-converted W22 line. The resulting ears produced mostly coarsely spotted kernels and a low frequency of either near-colorless fine-spotted kernels or nonspotted kernels. The relative frequency of these two types of near-colorless kernels differed among the eight Ac stocks. The extent to which increased Ac dosage results in nonspotted kernels may be Ac-specific. Although all of the Ac elements are in near-isogenic inbred W22 lines, they varied to a large extent in their transposition frequency. These differences might possibly result from structural differences among the Ac elements. Because one pair of Ac elements derived from Ac33 on chromosome arm 5S differed about 13-fold in transposition frequency and a second pair of Ac elements derived from Ac12 on chromosome arm 1S differed about 3-fold in transposition frequency, this is not a likely explanation for all eight Ac elements. The data presented here support the notion that the differences in transposition frequency of the eight Ac elements may be a reflection of variability in Ac transcription or accessibility of the transposase to the Ac element, resulting from differences in the chromatin environments wherein the Ac elements are located. This is the first report of variability in transposition rates among different Ac donor lines.

  8. An ac susceptibility study in capped Ni/Ni(OH)2 core-shell nanoassemblies: dual peak observations

    Godsell, Jeffrey F.; Bala, Tanushree; Ryan, Kevin M.; Roy, Saibal

    2011-08-01

    In this study, the ac susceptibility (χ' and χ'') variation with temperature (10-100 K) for oleic acid (OA) capped Ni/Ni(OH)2 core-shell nanoparticle assemblies are reported at frequencies varying from 0.1 to 1000 Hz. Nanoparticle assemblies, with two average particle diameters of ~34 nm and ~14 nm, were synthesized using a wet chemical synthesis approach. Two peaks in the ac susceptibility versus temperature curves are clearly discernable for each of the samples. The first, occurring at ~22 K was attributed to the paramagnetic/antiferromagnetic transition of the Ni(OH)2 present in the shell. The second higher temperature peak was attributed to the superparamagnetic blocking of the pure Ni situated at the core of the nanoparticles. The higher temperature peaks in both the χ' and χ'' curves were observed to increase with increasing frequency. Thus the Néel and the blocking temperatures for such core-shell nanoassemblies were clearly identified from the ac analysis, whereas they were not discernible (superimposed) even from very low dc (FC/ZFC) field measurements. Interparticle interactions within the assemblies were studied through the fitting of phenomenological laws to the experimental datasets. It is observed that even with an OA capping layer, larger Ni/Ni(OH)2 nanoparticles experience a greater degree of sub-capping layer oxidation thus producing lower magnetic interaction strengths.

  9. An ac susceptibility study in capped Ni/Ni(OH){sub 2} core-shell nanoassemblies: dual peak observations

    Godsell, Jeffrey F; Roy, Saibal [Microsystems Centre, Tyndall National Institute, Lee Maltings, Dyke Parade, Cork (Ireland); Bala, Tanushree; Ryan, Kevin M., E-mail: saibal.roy@tyndall.ie [Materials and Surface Science Institute and the Department of Chemical and Environmental Sciences, University of Limerick, Limerick, Ireland. (Ireland)

    2011-08-17

    In this study, the ac susceptibility ({chi}' and {chi}'') variation with temperature (10-100 K) for oleic acid (OA) capped Ni/Ni(OH){sub 2} core-shell nanoparticle assemblies are reported at frequencies varying from 0.1 to 1000 Hz. Nanoparticle assemblies, with two average particle diameters of {approx}34 nm and {approx}14 nm, were synthesized using a wet chemical synthesis approach. Two peaks in the ac susceptibility versus temperature curves are clearly discernable for each of the samples. The first, occurring at {approx}22 K was attributed to the paramagnetic/antiferromagnetic transition of the Ni(OH){sub 2} present in the shell. The second higher temperature peak was attributed to the superparamagnetic blocking of the pure Ni situated at the core of the nanoparticles. The higher temperature peaks in both the {chi}' and {chi}'' curves were observed to increase with increasing frequency. Thus the Neel and the blocking temperatures for such core-shell nanoassemblies were clearly identified from the ac analysis, whereas they were not discernible (superimposed) even from very low dc (FC/ZFC) field measurements. Interparticle interactions within the assemblies were studied through the fitting of phenomenological laws to the experimental datasets. It is observed that even with an OA capping layer, larger Ni/Ni(OH){sub 2} nanoparticles experience a greater degree of sub-capping layer oxidation thus producing lower magnetic interaction strengths.

  10. F2AC: A Lightweight, Fine-Grained, and Flexible Access Control Scheme for File Storage in Mobile Cloud Computing

    Wei Ren

    2016-01-01

    Full Text Available Current file storage service models for cloud servers assume that users either belong to single layer with different privileges or cannot authorize privileges iteratively. Thus, the access control is not fine-grained and flexible. Besides, most access control methods at cloud servers mainly rely on computationally intensive cryptographic algorithms and, especially, may not be able to support highly dynamic ad hoc groups with addition and removal of group members. In this paper, we propose a scheme called F2AC, which is a lightweight, fine-grained, and flexible access control scheme for file storage in mobile cloud computing. F2AC can not only achieve iterative authorization, authentication with tailored policies, and access control for dynamically changing accessing groups, but also provide access privilege transition and revocation. A new access control model called directed tree with linked leaf model is proposed for further implementations in data structures and algorithms. The extensive analysis is given for justifying the soundness and completeness of F2AC.

  11. Transition Theory – Sustainable Transition of Socio-Technical Systems

    Søndergård, Bent; Holm, Jesper; Stauning, Inger

    2015-01-01

    Theories of transition management, transition studies and social practise theory Applied to studies of hosuing and construction......Theories of transition management, transition studies and social practise theory Applied to studies of hosuing and construction...

  12. Transitive and anti-transitive emergent relations in pigeons: support for a theory of stimulus-class formation.

    Urcuioli, Peter J; Swisher, Melissa J

    2015-03-01

    Stimulus class formation is inferred when conditional discrimination training yields new (emergent) conditional relations between the training stimuli. The present experiments demonstrated two such relations in pigeons after successive matching-to-sample training. Experiment 1 showed that transitivity (AC matching) emerged after training on AB and BC arbitrary matching plus BB identity matching: pigeons responded relatively more to the comparisons on AC test trials in which both the A samples and C comparisons were elements of reinforced arbitrary baseline relations involving the same nominal B stimulus. Experiment 2 showed the opposite effect ("anti-transitivity") after training on the same arbitrary relations but with BB oddity instead: pigeons responded relatively more to the comparisons on AC test trials in which the A sample was an element of a reinforced baseline relation and the C comparison was an element of a non-reinforced baseline relation, or vice versa. Experiment 2 also showed that AB and BC training alone generally does not yield an emergent effect. These findings extend the range of emergent phenomena observed in non-human animals and are consistent with predictions from Urcuioli's (2008) theory of pigeons' stimulus class formation. This article is part of a Special Issue entitled: Tribute to Tom Zentall.

  13. On the Application of TLS Techniques to AC Electrical Drives

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  14. Reliability of emergency ac power systems at nuclear power plants

    Battle, R E; Campbell, D J

    1983-07-01

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project.

  15. Security analysis of interconnected AC/DC systems

    Eriksson, Robert

    2015-01-01

    This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid. The red......This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid....... The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...

  16. Harmonic-free line-commutated ac/dc rectifiers

    Villablanca, Miguel E. [Electrical Engineering Department, University of Santiago, P.O. Box 10233, Santiago (Chile)

    2009-11-15

    In this paper both a method and apparatus are applied to different configurations of line-commutated ac/dc rectifiers to reduce the distortion of currents flowing from the ac supply. The load may be either inductive or capacitive. The technology involves an accurate shaping of the dc current by using two self-commutated switches. This dc-current shaping is reflected back into the shaping of the ac input currents, which become pure sine waves. Thyristor-based rectifying operation is possible with a simple control circuit, which is able to deal with both rapid load variations and failures in the self-commutated switches. Furthermore, the overlap conduction of bridge thyristors is eliminated completely. Experimental verification is provided from a 400-V 30-kVA 50-Hz laboratory prototype. (author)

  17. Neural network based PWM AC chopper fed induction motor drive

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  18. Superconducting shielded core reactor with reduced AC losses

    Cha, Yung S.; Hull, John R.

    2006-04-04

    A superconducting shielded core reactor (SSCR) operates as a passive device for limiting excessive AC current in a circuit operating at a high power level under a fault condition such as shorting. The SSCR includes a ferromagnetic core which may be either closed or open (with an air gap) and extends into and through a superconducting tube or superconducting rings arranged in a stacked array. First and second series connected copper coils each disposed about a portion of the iron core are connected to the circuit to be protected and are respectively wound inside and outside of the superconducting tube or rings. A large impedance is inserted into the circuit by the core when the shielding capability of the superconducting arrangement is exceeded by the applied magnetic field generated by the two coils under a fault condition to limit the AC current in the circuit. The proposed SSCR also affords reduced AC loss compared to conventional SSCRs under continuous normal operation.

  19. Modeling and Correcting the Time-Dependent ACS PSF

    Rhodes, Jason; Massey, Richard; Albert, Justin; Taylor, James E.; Koekemoer, Anton M.; Leauthaud, Alexie

    2006-01-01

    The ability to accurately measure the shapes of faint objects in images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST) depends upon detailed knowledge of the Point Spread Function (PSF). We show that thermal fluctuations cause the PSF of the ACS Wide Field Camera (WFC) to vary over time. We describe a modified version of the TinyTim PSF modeling software to create artificial grids of stars across the ACS field of view at a range of telescope focus values. These models closely resemble the stars in real ACS images. Using 10 bright stars in a real image, we have been able to measure HST s apparent focus at the time of the exposure. TinyTim can then be used to model the PSF at any position on the ACS field of view. This obviates the need for images of dense stellar fields at different focus values, or interpolation between the few observed stars. We show that residual differences between our TinyTim models and real data are likely due to the effects of Charge Transfer Efficiency (CTE) degradation. Furthermore, we discuss stochastic noise that is added to the shape of point sources when distortion is removed, and we present MultiDrizzle parameters that are optimal for weak lensing science. Specifically, we find that reducing the MultiDrizzle output pixel scale and choosing a Gaussian kernel significantly stabilizes the resulting PSF after image combination, while still eliminating cosmic rays/bad pixels, and correcting the large geometric distortion in the ACS. We discuss future plans, which include more detailed study of the effects of CTE degradation on object shapes and releasing our TinyTim models to the astronomical community.

  20. Introducing high performance distributed logging service for ACS

    Avarias, Jorge A.; López, Joao S.; Maureira, Cristián; Sommer, Heiko; Chiozzi, Gianluca

    2010-07-01

    The ALMA Common Software (ACS) is a software framework that provides the infrastructure for the Atacama Large Millimeter Array and other projects. ACS, based on CORBA, offers basic services and common design patterns for distributed software. Every properly built system needs to be able to log status and error information. Logging in a single computer scenario can be as easy as using fprintf statements. However, in a distributed system, it must provide a way to centralize all logging data in a single place without overloading the network nor complicating the applications. ACS provides a complete logging service infrastructure in which every log has an associated priority and timestamp, allowing filtering at different levels of the system (application, service and clients). Currently the ACS logging service uses an implementation of the CORBA Telecom Log Service in a customized way, using only a minimal subset of the features provided by the standard. The most relevant feature used by ACS is the ability to treat the logs as event data that gets distributed over the network in a publisher-subscriber paradigm. For this purpose the CORBA Notification Service, which is resource intensive, is used. On the other hand, the Data Distribution Service (DDS) provides an alternative standard for publisher-subscriber communication for real-time systems, offering better performance and featuring decentralized message processing. The current document describes how the new high performance logging service of ACS has been modeled and developed using DDS, replacing the Telecom Log Service. Benefits and drawbacks are analyzed. A benchmark is presented comparing the differences between the implementations.

  1. System and method for determining stator winding resistance in an AC motor using motor drives

    Lu, Bin; Habetler, Thomas G; Zhang, Pinjia

    2013-02-26

    A system and method for determining the stator winding resistance of AC motors is provided. The system includes an AC motor drive having an input connectable to an AC source and an output connectable to an input terminal of an AC motor, a pulse width modulation (PWM) converter having switches therein to control current flow and terminal voltages in the AC motor, and a control system connected to the PWM converter. The control system generates a command signal to cause the PWM converter to control an output of the AC motor drive corresponding to an input to the AC motor, selectively generates a modified command signal to cause the PWM converter to inject a DC signal into the output of the AC motor drive, and determines a stator winding resistance of the AC motor based on the DC signal of at least one of the voltage and current.

  2. Study of AC/RF properties of SRF ingot niobium

    Dhakal, Pashupati; Tsindlekht, Menachem I; Genkin, Valery M; Ciovati, Gianluigi; Myneni, Ganapati Rao

    2013-09-01

    In an attempt to correlate the performance of superconducting radiofrequency cavities made of niobium with the superconducting properties, we present the results of the magnetization and ac susceptibility of the niobium used in the superconducting radiofrequency cavity fabrication. The samples were subjected to buffer chemical polishing (BCP) surface and high temperature heat treatments, typically applied to the cavities fabrications. The analysis of the results show the different surface and bulk ac conductivity for the samples subjected to BCP and heat treatment. Furthermore, the RF surface impedance is measured on the sample using a TE011 microwave cavity for a comparison to the low frequency measurements.

  3. AC and Phase Sensing of Nanowires for Biosensing.

    Crescentini, Marco; Rossi, Michele; Ashburn, Peter; Lombardini, Marta; Sangiorgi, Enrico; Morgan, Hywel; Tartagni, Marco

    2016-04-19

    Silicon nanowires are label-free sensors that allow real-time measurements. They are economical and pave the road for point-of-care applications but require complex readout and skilled personnel. We propose a new model and technique for sensing nanowire sensors using alternating currents (AC) to capture both magnitude and phase information from the sensor. This approach combines the advantages of complex impedance spectroscopy with the noise reduction performances of lock-in techniques. Experimental results show how modifications of the sensors with different surface chemistries lead to the same direct-current (DC) response but can be discerned using the AC approach.

  4. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig

    2016-01-01

    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling. The vol......This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling...

  5. Development of an AC Module System: Final Technical Report

    Suparna Kadam; Miles Russell

    2012-06-15

    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  6. Active Power Regulation based on Droop for AC Microgrid

    Li, Chendan; Coelho, Ernane A. A.; Firoozabadi, Mehdi Savaghebi

    2015-01-01

    In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed to succes......In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed...

  7. Power converters and AC electrical drives with linear neural networks

    Cirrincione, Maurizio

    2012-01-01

    The first book of its kind, Power Converters and AC Electrical Drives with Linear Neural Networks systematically explores the application of neural networks in the field of power electronics, with particular emphasis on the sensorless control of AC drives. It presents the classical theory based on space-vectors in identification, discusses control of electrical drives and power converters, and examines improvements that can be attained when using linear neural networks. The book integrates power electronics and electrical drives with artificial neural networks (ANN). Organized into four parts,

  8. Protective effect of Ac-SDKP on alveolar epithelial cells through inhibition of EMT via TGF-β1/ROCK1 pathway in silicosis in rat.

    Deng, Haijing; Xu, Hong; Zhang, Xianghong; Sun, Yue; Wang, Ruimin; Brann, Darrell; Yang, Fang

    2016-03-01

    The epithelial-mesenchymal transition (EMT) is a critical stage during the development of silicosis fibrosis. In the current study, we hypothesized that the anti-fibrotic tetrapeptide, N-acetyl-seryl-aspartyl-lysyl-proline (Ac-SDKP) may exert its anti-fibrotic effects via activation of the TGF-β1/ROCK1 pathway, leading to inhibition of EMT. To address this hypothesis, we first examined the effect of Ac-SDKP upon EMT using an in vivo rat silicosis model, as well as in an in vitro model of TGF-β1-induced EMT. Confocal laser scanning microscopy was used to examine colocalization of surfactant protein A (SP-A), fibroblast specific protein-1 (FSP-1) and α-smooth muscle actin (α-SMA) in vivo. Western blot analysis was used to examine for changes in the protein levels of E-cadherin (E-cad) and SP-A (epithelial cell markers), vimentin (mesenchymal cell marker), α-SMA (active myofibroblast marker), and collagen I and III in both in vivo and in vitro experiments. Secondly, we utilized Western blot analysis and confocal laser scanning microscopy to examine the protein expression of TGF-β1 and ROCK1 in in vivo and in vitro studies. The results revealed that Ac-SDKP treatment prevented increases in the expression of mesenchymal markers as well as TGF-β1, ROCK1, collagen I and III. Furthermore, Ac-SDKP treatment prevented decreases in the expression of epithelial cell markers in both in vivo and in vitro experiments. Based on the results, we conclude that Ac-SDKP inhibits the transition of epithelial cell-myofibroblast in silicosis via activation of the TGF-β1/ROCK1 signaling pathway, which may serve as a novel mechanism by which it exerts its anti-fibrosis properties.

  9. Temperature-driven spin reorientation transition of magnetron sputtered nickel thin film

    Song Xiao-Hui; Zhang Dian-Lin

    2008-01-01

    The temperature-driven spin reorientation transition of magnetron sputtered Ni/Si(111)systems has been studied.The relationship between ac initial susceptibility and temperature of nickel films with different thicknesses shows that the magnetization orientation changes from in-plane to out-of-plane with the increase of temperature.The temperature dependence of magnetoelastic,magneto-crystalline,and magnetostatic anisotropies determines the direction of the reorientation transition.The temperature-driven spin reorientation transition is supported by Hall coefficient measurements which show that its temperature dependence is similar to that of susceptibility.

  10. AC stabilities in superconducting magnetic shielding body with shorted low AC loss Nb{sub 3}Sn coil; Nb{sub 3}Sn kansen jiki shaheitai no koryu anteisei

    Aizawa, N.; Nii, A.; Ito, Y.; Onishi, T. [Hokkaido Univ., Hokkaido (Japan); Shibuya, M. [Engineering Research Association for Superconductive Genertion Equipment and Materials, Osaka (Japan)

    1999-06-07

    In this study, the superconducting magnetic shielding body conductively cooled by the small refrigerating machine at the intermediate temperature (10K-14K) was examined with the aim of a magnetic shielding type superconducting current limiter as closed as maintenance-free. Nb{sub 3}Sn coil closed the two ends was an object as a magnetic shielding body. In case of such a cooling system, the research of the stability was indispensable because of possible normal conduction transition in addition of disturbance into tapes. Then, the method to use the thyristor bypass circuit was examined in order to establish the stabilization method. As for the simulation, the normal conduction transition of the low AC loss Nb{sub 3}Sn coil which AC transferred in the constant-voltage power source, and the recovery characteristics of superconductivity were analyzed in the liquid helium. As a result of evaluating the stability in the constant-voltage power source, it was shown that the current attenuated by the resistance, and the exothermic reaction was controlled even if the disturbance happened and quenched. From these results, it was clarified that the stabilization method to establish the thyristor bypass circuit was effective for improvement on the stability of the superconductor. (NEDO)

  11. AC1MMYR2 impairs high dose paclitaxel-induced tumor metastasis by targeting miR-21/CDK5 axis.

    Ren, Yu; Zhou, Xuan; Yang, Juan-Juan; Liu, Xia; Zhao, Xiao-hui; Wang, Qi-xue; Han, Lei; Song, Xin; Zhu, Zhi-yan; Tian, Wei-ping; Zhang, Lun; Mei, Mei; Kang, Chun-sheng

    2015-07-01

    Paclitaxel (taxol) is a widely used chemo-drug for many solid tumors, while continual taxol treatment is revealed to stimulate tumor dissemination. We previously found that a small molecule inhibitor of miR-21, termed AC1MMYR2, had the potential to impair tumorigenesis and metastasis. The aim of this study was to investigate whether combining AC1MMYR2 with taxol could be explored as a means to limit tumor metastasis. Here we showed that abnormal activation of miR-21/CDK5 axis was associated with breast cancer lymph node metastasis, which was also contribute to high dose taxol-induced invasion and epithelial mesenchymal transition (EMT) in both breast cancer cell line MDA-MB-231 and glioblastoma cell line U87VIII. AC1MMYR2 attenuated CDK5 activity by functional targeting CDK5RAP1, CDK5 activator p39 and target p-FAK(ser732). A series of in vitro assays indicated that treatment of AC1MMYR2 combined with taxol suppressed tumor migration and invasion ability in both MDA-MB-231 and U87VIII cell. More importantly, combination therapy impaired high-dose taxol induced invadopodia, and EMT markers including β-catenin, E-cadherin and vimentin. Strikingly, a significant reduction of lung metastasis in mice was observed in the AC1MMYR2 plus taxol treatment. Taken together, our work demonstrated that AC1MMYR2 appeared to be a promising strategy in combating taxol induced cancer metastasis by targeting miR-21/CDK5 axis, which highlighted the potential for development of therapeutic modalities for better clinic taxol application.

  12. 升降式交流斩波器%Buck-Boost AC/AC Direct Converter

    孙刚; 洪峰

    2009-01-01

    介绍了一种新颖的Buck-Boost型交流斩波器.该交流斩波器将Buck-Boost型DC/DC变换器的开关管双向化,可实现单级降压或升压的AC/AC直接变换和能量双向流动.该变换器使用较少的功率器件实现了单级功率变换和能量双向流动,有利于提高变换器的功率密度和变换效率.详细研究了其工作模态和原理.分析了该变换器的两种PWM调制策略,并指出采用第2种调制策略可降低开关损耗.采用滞环电流控制的Buck/Boost型交流斩波器可对输入电压畸变进行有效抑制,保持了输出电压波形的高度正弦化.仿真和实验验证了分析的正确性.

  13. Learning-by-doing, population pressure, and the theory of demographic transition.

    Strulik, H

    1997-01-01

    The long-term effects of two interdependent relations between economic growth and population growth are discussed. The empirical work of Boserup (1981) was utilized, which focused on rural, sparsely populated economies with low income per capita. According to the formulation of the population-push hypothesis, learning-by-doing effects in production lead to increasing returns to scale and, therefore, to a positive correlation between economic and population growth. In accordance with the theory of demographic transition, the population growth rate initially increases with rising income levels and then declines. The approach originating from Cigno (1984) modified the economic model, which allowed the establishment of two different stable equilibria. Regarding this relationship, the existence and stability of low-income and high-income equilibrium was shown in a neoclassical growth model. Under plausible conditions a demo-economic transition from the first to the second steady-state took place. The instability of the Malthusian steady-state is also possible when a country develops along a path of economic growth which is compatible with the demographic transition. In this context, learning means the application of new techniques of agrarian production. In developed economies with a stable population the learning-or-doing decision lead to accumulation of human capital and the invention of new technologies and goods. The interdependence of income-determined population growth and learning-by-doing may serve as an explanation for the weak and partly controversial empirical support for an overall correlation between income and population growth. The result yielded a meaningful interpretation of the population-push hypothesis, which is consistent with the empirical findings on the correlation between economic and population growth.

  14. Impacts on Power Factor of AC Voltage Controllers Under Non-Sinusoidal Conditions

    Mukhtiar Ahmed Mahar

    2012-04-01

    Full Text Available AC-AC conversion is obtained with the help of Cyclo-converters, DC Link converters and AC Voltage Controllers. AC voltage controllers are also referred to as voltage regulators. Main issue concerned to these converters is that they generate harmonics due to periodic variable structure system. The generated harmonics create disturbances and degrade the performance of converter. The power factor of supply side is affected due to these harmonics. This paper focuses on source side power factor of ac voltage controllers under nonsinusoidal conditions. In order to observe the power factor, measurement tool of power factor and simulation model of ac voltage controller is also developed in MATLAB software.

  15. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  16. BOLD signal effects of transcranial alternating current stimulation (tACS) in the alpha range: A concurrent tACS-fMRI study.

    Vosskuhl, Johannes; Huster, René J; Herrmann, Christoph S

    2016-10-15

    Many studies have proven transcranial alternating current stimulation (tACS) to manipulate brain activity. Until now it is not known, however, how these manipulations in brain activity are represented in brain metabolism or how spatially specific these changes are. Alpha-tACS has been shown to enhance the amplitude of the individual alpha frequency (IAF) and a negative correlation between alpha amplitude and occipital BOLD signal was reported in numerous EEG/fMRI experiments. Thus, alpha-tACS was chosen to test the effects of tACS on the BOLD signal. A reduction thereof was expected during alpha-tACS which shows the spatial extent of tACS effects beyond modeling studies. Three groups of subjects were measured in an MRI scanner, receiving tACS at either their IAF (N=11), 1Hz (control; N=12) or sham (i.e., no stimulation - a second control; N=11) while responding to a visual vigilance task. Stimulation was administered in an interleaved pattern of tACS-on runs and tACS-free baseline periods. The BOLD signal was analyzed in response to tACS-onset during resting state and in response to seldom target stimuli. Alpha-tACS at 1.0mA reduced the task-related BOLD response to visual targets in the occipital cortex as compared to tACS-free baseline periods. The deactivation was strongest in an area where the BOLD signal was shown to correlate negatively with alpha amplitude. A direct effect of tACS on resting state BOLD signal levels could not be shown. Our findings suggest that tACS-related changes in BOLD activity occur only as a modulation of an existing BOLD response.

  17. Predictability of Critical Transitions

    Zhang, Xiaozhu; Hallerberg, Sarah

    2015-01-01

    Critical transitions in multistable systems have been discussed as models for a variety of phenomena ranging from the extinctions of species to socio-economic changes and climate transitions between ice-ages and warm-ages. From bifurcation theory we can expect certain critical transitions to be preceded by a decreased recovery from external perturbations. The consequences of this critical slowing down have been observed as an increase in variance and autocorrelation prior to the transition. However especially in the presence of noise it is not clear, whether these changes in observation variables are statistically relevant such that they could be used as indicators for critical transitions. In this contribution we investigate the predictability of critical transitions in conceptual models. We study the the quadratic integrate-and-fire model and the van der Pol model, under the influence of external noise. We focus especially on the statistical analysis of the success of predictions and the overall predictabil...

  18. Gravitationally induced quantum transitions

    Landry, A.; Paranjape, M. B.

    2016-06-01

    In this paper, we calculate the probability for resonantly inducing transitions in quantum states due to time-dependent gravitational perturbations. Contrary to common wisdom, the probability of inducing transitions is not infinitesimally small. We consider a system of ultracold neutrons, which are organized according to the energy levels of the Schrödinger equation in the presence of the Earth's gravitational field. Transitions between energy levels are induced by an oscillating driving force of frequency ω . The driving force is created by oscillating a macroscopic mass in the neighborhood of the system of neutrons. The neutron lifetime is approximately 880 sec while the probability of transitions increases as t2. Hence, the optimal strategy is to drive the system for two lifetimes. The transition amplitude then is of the order of 1.06 ×10-5, and hence with a million ultracold neutrons, one should be able to observe transitions.

  19. Gravitationally induced quantum transitions

    Landry, A

    2016-01-01

    In this letter, we calculate the probability for resonantly induced transitions in quantum states due to time dependent gravitational perturbations. Contrary to common wisdom, the probability of inducing transitions is not infinitesimally small. We consider a system of ultra cold neutrons (UCN), which are organized according to the energy levels of the Schr\\"odinger equation in the presence of the earth's gravitational field. Transitions between energy levels are induced by an oscillating driving force of frequency $\\omega$. The driving force is created by oscillating a macroscopic mass in the neighbourhood of the system of neutrons. The neutrons decay in 880 seconds while the probability of transitions increase as $t^2$. Hence the optimal strategy is to drive the system for 2 lifetimes. The transition amplitude then is of the order of $1.06\\times 10^{-5}$ hence with a million ultra cold neutrons, one should be able to observe transitions.

  20. Modulation schemes with enhanced switch thermal distribution for single-phase AC-DC-AC reduced-switch converters

    Qin, Zian; Loh, Poh Chiang; Blaabjerg, Frede

    2015-01-01

    ulation schemes can significantly change the performance of a power converter in steady state, and they have been extensively studied, but mostly directed to three-phase topologies, where triplen offsets are added. Single-phase systems, including ac-dc-ac systems, are less widely pursued, even...... among their switches, while keeping their dc-link voltages low. Single points of failure are thus minimized, allowing the converters to have longer lifetimes. Simulation and experimental results have demonstrated the intended performances and hence verifying the idea....

  1. Turning Forbidden Transitions into Dominant Transitions

    Rivera, Nicholas; Soljacic, Marin

    2016-01-01

    Surface phonon polaritons are hybrid modes of photons and optical phonons that can propagate on the surface of a polar dielectric. In this work, we show that the precise combination of confinement and bandwidth offered by surface phonon polaritons allows for the ability to take forbidden transitions and turn them into the primary means by which an electron emits light. We show that high-order multipolar transitions and two-photon emission processes can be over an order of magnitude faster than competing dipole transitions, as opposed to being as much as eight to ten orders of magnitude slower in free space. Our results have direct implications for the design of fundamentally new types of emitters in the mid and far IR: ones which prefer to change their angular momentum by large amounts and also ones that prefer to emit a relatively broad spectrum of entangled photons - potentially allowing for new sources of both single and multiple photons.

  2. Frequency-dependent electrodeformation of giant phospholipid vesicles in AC electric field

    Peterlin, Primoz

    2010-01-01

    A model of vesicle electrodeformation is described which obtains a parametrized vesicle shape by minimizing the sum of the membrane bending energy and the energy due to the electric field. Both the vesicle membrane and the aqueous media inside and outside the vesicle are treated as leaky dielectrics, and the vesicle itself is modelled as a nearly spherical shape enclosed within a thin membrane. It is demonstrated (a) that the model achieves a good quantitative agreement with the experimentally determined prolate-to-oblate transition frequencies in the kHz range, and (b) that the model can explain a phase diagram of shapes of giant phospholipid vesicles with respect to two parameters: the frequency of the applied AC electric field and the ratio of the electrical conductivities of the aqueous media inside and outside the vesicle, explored in a recent paper (S. Aranda et al., Biophys. J. 95:L19--L21, 2008). A possible use of the frequency-dependent shape transitions of phospholipid vesicles in conductometry of m...

  3. Transit Benefit Program Data -

    Department of Transportation — This data set contains information about any US government agency participating in the transit benefits program, funding agreements, individual participating Federal...

  4. Strongly nonlinear dynamics of electrolytes in large ac voltages

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasiequilibrium structure of the double layers. The former leads to the prediction of “ac capacitive desalination” since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion...

  5. Recommended ACS Syllabus for Introductory Courses in Polymer Chemistry.

    Seymour, Raymond B.

    1982-01-01

    Provides syllabus for courses in introductory polymer chemistry (including major topics and recommended time allotments) and currently available textbooks and audio courses which may be used with the syllabus. Syllabus topics are congruent with those used in American Chemical Society (ACS) standardized examination in polymer chemistry. (Author/JN)

  6. Stretched exponential relaxation and ac universality in disordered dielectrics

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    are stretched exponential character of dielectric relaxation, power-law power spectral density, and anomalous dependence of ac conduction coefficient on frequency. We propose a self-consistent model of dielectric relaxation in which the relaxations are described by a stretched exponential decay function...

  7. Current Control of Grid Converters Connected with Series AC Capacitor

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang;

    2015-01-01

    The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...

  8. Study of ac electrical properties of aluminium-epoxy composites

    Elimat, Z M [Applied Science Department, Ajloun University College, Al-Balqa Applied University, Amman (Jordan); Zihlif, A M [Physics Department, University of Jordan, Amman (Jordan); Ragosta, G [Institute of Chemistry and Polymer Technology (ICTP), CNR-Possouli, Napoli (Italy)], E-mail: adzh@ju.edu.jo

    2008-08-21

    Ac electrical properties of aluminium flakes-epoxy composites were studied as a function of the composition, frequency and temperature. The dielectric constant increased smoothly with an increase in the concentration of aluminium. An increase in the dielectric constant was observed with the temperature as well as with a decrease in the frequency. The observed increase in the values of the dielectric constant with the aluminium concentration was attributed to interfacial polarization. It was found that ac electrical conductivity increases with increasing content of aluminium, temperature and frequency. The observed enhancement in ac conductivity is attributed to the increase in the number of conduction paths created by the aluminium flake contacts in the composite to give a higher electrical conductivity. Also, the activation energy of aluminium flakes-epoxy composites was determined, as well as the values of the dielectric constant. Compared with various theoretical models, Bruggman's formula gives a better fit. The universal power-law model of ac conductivity is observed in epoxy-aluminium composites. The calculated power exponent (about unity) is physically acceptable within this applied model.

  9. Soliton ratchetlike dynamics by ac forces with harmonic mixing

    Salerno, Mario; Zolotaryuk, Yaroslav

    2002-01-01

    The possibility of unidirectional motion of a kink (topological soliton) of a dissipative sine-Gordon equation in the presence of ac forces with harmonic mixing (at least biharmonic) and of zero mean, is presented. The dependence of the kink mean velocity on system parameters is investigated...

  10. Acústica, fluidos y termodinámica

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica. Estática de fluidos. Dinámica de fluidos y fluidos reales. Temperatura y propagación del calor. Primer principio de la Termodinámica. Gases ideales. Segundo principio de la Termodinámica.

  11. Heat Transfer Analysis for Industrial AC Electric Arc Furnace

    (U)nal (C)amdali; Murat Tun(c)

    2005-01-01

    The heat transfer analysis was performed for an AC electric arc furnace (EAF). Heat losses by conduction, convection and radiation from outer surface, roof, bottom and electrodes of EAF were determined in detail. Some suggestions about decreasing heat losses were presented.

  12. Equivalent Circuits For AC-Impedance Analysis Of Corrosion

    Danford, M. D.

    1992-01-01

    Report presents investigation of equivalent circuits for ac-impedance analysis of corrosion. Impedance between specimen and electrolyte measured as function of frequency. Data used to characterize corrosion electrochemical system in terms of equivalent circuit. Eleven resistor/capacitor equivalent-circuit models were analyzed.

  13. Introducing AC Inductive Reactance with a Power Tool

    Bryant, Wesley; Baker, Blane

    2016-01-01

    The concept of reactance in AC electrical circuits is often non-intuitive and difficult for students to grasp. In order to address this lack of conceptual understanding, classroom exercises compare the predicted resistance of a power tool, based on electrical specifications, to measured resistance. Once students discover that measured resistance…

  14. An overview of the ALMA Common Software (ACS) .

    Di Marcantonio, P.; Cirami, R.; Caproni, A.; Chiozzi, G.; Jeram, B.; Sommer, H.; Harrington, S.; Zagar, K.; Plesko, M.; Sekoranja, M.

    The ALMA Common Software (ACS) is an application framework designed to provide a common and homogeneous software architecture and infrastructure, spanning the end to end needs of an Astronomical observatory, from the Telescope Control system to high-level data flow management. ACS offers, at the lower level, several basic services needed for object-oriented distributed computing like transparent remote object invocation, object deployment and location, distributed error, alarm handling, logging and events. On top of this it provides an application architecture based on the Component/Container paradigm that fosters sharing and reusing of software components. Although developed for the ALMA project, ACS is now used by several other projects worldwide, among which the Italian Sardinia Radio Telescope (SRT). Besides, there is an active community that shares ideas, concepts and actual software components. Major drivers for this diffusion were the choice of adopting the LGPL public license and the adoption of CORBA, a free but reliable and widely used middleware software. In this paper we present an overview of the main features of ACS, emphasizing in particular the role of INAF-OAT in this project.

  15. Container-component model and XML in ALMA ACS

    Sommer, Heiko; Chiozzi, Gianluca; Zagar, Klemen; Voelter, Markus

    2004-09-01

    ALMA software, from high-level data flow applications down to instrument control, is built using the ACS framework. To meet the challenges of developing distributed software in distributed teams, ACS offers a container/component model that integrates the use of XML transfer objects. ACS containers are built on top of CORBA and are available for C++, Java, and Python, so that ALMA software can be written as components in any of these languages. The containers perform technical aspects of the software system, while components can focus on the implementation of functional requirements. Like Web services, components can use XML to exchange structured data by value. For Java components, the container seamlessly integrates the use of XML binding classes, which are Java classes that encapsulate access to XML data through type-safe methods. Binding classes are generated from XML schemas, allowing the Java compiler to enforce compliance of application code with the XML schemas. This presentation will explain the capabilities of the ACS container/component model, and how it relates to other middleware technologies that are popular in industry.

  16. Dielectric relaxation and ac conductivity of sodium tungsten phosphate glasses

    B Singh; P S Tarsikka; L Singh

    2002-10-01

    Studies of dielectric relaxation and ac conductivity have been made on three samples of sodium tungsten phosphate glasses over a temperature range of 77–420 K. Complex relative permittivity data have been analyzed using dielectric modulus approach. Conductivity relaxation frequency increases with the increase of temperature. Activation energy for conductivity relaxation has also been evaluated. Measured ac conductivity (m()) has been found to be higher than dc at low temperatures whereas at high temperature m() becomes equal to dc at all frequencies. The ac conductivity obeys the relation ac() = A over a considerable range of low temperatures. Values of exponent are nearly equal to unity at about 78 K and the values decrease non-linearly with the increase of temperature. Values of the number density of states at Fermi level ((F)) have been evaluated at 80 K assuming values of electron wave function decay constant to be 0.5 (Å)-1. Values of (F) have the order 1020 which are well within the range suggested for localized states. Present values of (F) are smaller than those for tungsten phosphate glasses.

  17. Calculated characteristics of an ac plasma display panel cell

    Boeuf, J.P.; Pitchford, L.C. [Universite Paul Sabatier, Toulouse (France)

    1996-02-01

    Equipotential contours and contours of constant power deposition into excitation of xenon, calculated from a two-dimensional (2-D) fluid model, are presented at times during the evolution of a single discharge event in an ac plasma display panel cell with a dielectric barrier rib geometry.

  18. Calculation of AC losses in large HTS stacks and coils

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad;

    2012-01-01

    In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting and su...

  19. Novel dielectric reduces corona breakdown in ac capacitors

    Loehner, J. L.

    1972-01-01

    Dielectric system was developed which consists of two layers of 25-gage paper separated by one layer of 50-gage polypropylene to reduce corona breakdown in ac capacitors. System can be used in any alternating current application where constant voltage does not exceed 400 V rms. With a little research it could probably be increased to 700 to 800 V rms.

  20. A simple technique for a.c. conductivity measurements

    R Padma Suvarna; K Raghavendra Rao; K Subbarangaiah

    2002-12-01

    An inexpensive, indigenous and a simple electronic instrument based on voltage follower, current–to–voltage converter, zero crossing detector and a phase detector has been developed for measurement of a.c. conductivity. Real and imaginary parts of complex impedance are determined for a given sample as a function of frequency and the given sample is represented by a pure electronic model.