WorldWideScience

Sample records for ac transit demos

  1. Alameda-Contra Costa Transit District (AC Transit) Fuel Cell Transit Buses: Preliminary Evaluation Results

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2007-03-01

    This report provides an evaluation of three prototype fuel cell-powered transit buses operating at AC Transit in Oakland, California, and six baseline diesel buses similar in design to the fuel cell buses.

  2. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  3. National Fuel Cell Bus Program: Accelerated Testing Evaluation Report and Appendices, Alameda-Contra Costa Transit District (AC Transit)

    Energy Technology Data Exchange (ETDEWEB)

    Chandler, K.; Eudy, L.

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 through October 2008. Evaluation results include implementation experience, fueling station operation, fuel cell bus operations at Golden Gate Transit, and evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and roadcalls).

  4. Breeding blanket for DEMO

    International Nuclear Information System (INIS)

    This paper presents the main design features, their rationale, and the main critical issues for the development, of the four DEMO-relevant blanket concepts presently being investigated within the framework of the European Test-Blanket Development Programme. (orig.)

  5. Breeding blanket for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Proust, E. (Commissariat a l' Energie Atomique (CEA), DRN/DMT/SERMA, CE, Saclay (France)); Anzidei, L. (ENEA/FUS, C.R.E., Frascati (Italy)); Casini, G. (Commission of the European Communities, Joint Research Center, Ispara (Italy)); Dalle Donne, M. (Kernforschungszentrum Karlsruhe GmbH (Germany)); Giancarli, L. (Commissariat a l' Energie Atomique (CEA), DRN/DMT/SERMA, CE, Saclay (France)); Malang, S. (Kernforschungszentrum Karlsruhe GmbH (Germany))

    1993-03-01

    This paper presents the main design features, their rationale, and the main critical issues for the development, of the four DEMO-relevant blanket concepts presently being investigated within the framework of the European Test-Blanket Development Programme. (orig.)

  6. Breeding blanket for Demo

    Energy Technology Data Exchange (ETDEWEB)

    Proust, E.; Giancarli, L. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. de Mecanique et de Technologie; Anzidei, L. [ENEA, Frascati (Italy). Centro Ricerche Energia; Casini, G. [Commission of the European Communities, Ispra (Italy). Joint Research Centre; Dalle Donne, M.; Malang, S. [Kernforschungszentrum Karlsruhe GmbH (Germany)

    1992-12-31

    This paper presents the main design features, their rationale, and the main critical issues for the development, of the four DEMO-relevant blanket concepts presently investigated within the framework of the European Test-Blanket Development Programme.

  7. Assessment of DEMO challenges in technology and physics

    International Nuclear Information System (INIS)

    Highlights: ► It is very important to respect the interlinks between physics and technology when developing designs for DEMO. ► Pulsed operation of a tokamak DEMO should seriously be considered in conservative DEMO designs. ► Optimization of both plasma CD efficiency as well as wall plug efficiency of the CD system is important. ► Exhaust requirements lead to an unprecedented high level of core radiation loss by impurity seeding in DEMO. -- Abstract: The challenges that DEMO designs encounter in both technology and physics are reviewed. It is shown that it is very important to respect the interlinks between these fields when developing designs for DEMO. Examples for areas where such interlinks put very strict requirements are the development of a steady state tokamak operation scenario and the question of power exhaust taking into account the boundary conditions set by materials questions. Concerning steady state operation, we find that demands on the physics scenario are so high that pulsed operation of a tokamak DEMO should seriously be considered in conservative DEMO designs. Alternatively, the device could foresee a large fraction of externally driven current which calls for optimization of both plasma CD efficiency as well as wall plug efficiency of the CD system. In the exhaust area, a realistic estimate of the admissable time averaged peak heat flux at the target is of the order of 5 MW/m2, leading to strict requirements for the operational scenario, which has to rely on an unprecedented high level of radiation loss by impurity seeding and the facilitation of partial detachment. Thus, exhaust scenarios along these lines have to be developed which are compatible with the confinement needs and the H-L back transition power for DEMO. In both areas, we discuss possible risk mitigation strategies based on conceptually different approaches

  8. DEMO diagnostics and burn control

    NARCIS (Netherlands)

    Biel, W.; de M. Baar,; Dinklage, A.; Felici, F.; Konig, R.; Meister, H.; Treutterer, W.; Wenninger, R.

    2015-01-01

    The development of the control system for a tokamak demonstration fusion reactor (DEMO) faces unprecedented challenges. First, the requirements for control reliability and accuracy are more stringent than on existing fusion devices: any loss of plasma control on DEMO may result in a disruption which

  9. International Perspectives on a Path to MFE DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Neilson, George H.; Abdou, M.; Federici, Gianfranco; Garofalo, A. M.; Kamendje, R.; Kaw, Predhiman K.; Kim, Keeman; Kurtz, Richard J.; Kuteev, Boris V.; Ward, David; Yamada, Hiroshi; Zohm, Hartmut

    2013-01-07

    The establishment of the ITER project marks a transition in the world fusion program to one increasingly focused on the demonstration of electricity generation from fusion, or DEMO. In recent years, planning and design activities for next steps toward DEMO have intensified in many countries, and international discussions have identified both needs and opportunities for greater international collaboration in developing a DEMO Programme. The scientific and technical issues for fusion are well known and, while there is no agreement on a single roadmap to fusion, there is substantial scope to add value through international cooperation, particularly in promoting a coordinated DEMO programme. The International Atomic Energy Agency, as a world organization dedicated to fostering international collaboration in the development of nuclear energy for peaceful purposes, is well suited to provide auspices for an activity promoting an international exchange of technical information and strategic thinking that would benefit all parties. Accordingly, an IAEA DEMO Programme Workshop series focus on the scientific and technical issues for fusion development toward DEMO has been established. The first workshop will be held 15-18 October 2012 in the U.S.A.

  10. Calculation of transition probabilities and ac Stark shifts in two-photon laser transitions of antiprotonic helium

    OpenAIRE

    HORI, MASAKI; Korobov, Vladimir I.

    2010-01-01

    Numerical ab initio variational calculations of the transition probabilities and ac Stark shifts in two-photon transitions of antiprotonic helium atoms driven by two counter-propagating laser beams are presented. We found that sub-Doppler spectroscopy is in principle possible by exciting transitions of the type (n,L)->(n-2,L-2) between antiprotonic states of principal and angular momentum quantum numbers n~L-1~35, first by using highly monochromatic, nanosecond laser beams of intensities 10^4...

  11. DemoCensus_BLCK2000

    Data.gov (United States)

    Vermont Center for Geographic Information — DemoCensus_BLCK2000 includes Census 2000 Block boundaries and SF1 attributes. The data was downloaded (http://arcdata.esri.com/data/tiger2000/tiger_download.cfm) by...

  12. DemoCensus_BLCKGR1990

    Data.gov (United States)

    Vermont Center for Geographic Information — The DemoCensus_BLCKGR1990 TIGER/Line File is an extract of selected geographic and cartographic information from the Census Bureau's 1990 TIGER (Topologically...

  13. Calculation of transition probabilities and ac Stark shifts in two-photon laser transitions of antiprotonic helium

    International Nuclear Information System (INIS)

    Numerical ab initio variational calculations of the transition probabilities and ac Stark shifts in two-photon transitions of antiprotonic helium atoms driven by two counter-propagating laser beams are presented. We found that sub-Doppler spectroscopy is, in principle, possible by exciting transitions of the type (n,L)→(n-2,L-2) between antiprotonic states of principal and angular momentum quantum numbers n∼L-1∼35, first by using highly monochromatic, nanosecond laser beams of intensities 104-105 W/cm2, and then by tuning the virtual intermediate state close (e.g., within 10-20 GHz) to the real state (n-1,L-1) to enhance the nonlinear transition probability. We expect that ac Stark shifts of a few MHz or more will become an important source of systematic error at fractional precisions of better than a few parts in 109. These shifts can, in principle, be minimized and even canceled by selecting an optimum combination of laser intensities and frequencies. We simulated the resonance profiles of some two-photon transitions in the regions n=30-40 of the p4He+ and p3He+ isotopes to find the best conditions that would allow this.

  14. DEMO blanket testing in ITER. Influence on reaching DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Shatalov, G. E-mail: geshat@nfi.kiae.ru

    2001-10-01

    ITER goal was specified as one step between now and the DEMO fusion reactor. One of the major issues is the tritium breeding blankets test relevant to future reactors. The major objectives of blanket modules (TBM) experiments in ITER are reduced in comparison with proposed test objectives in ITER-FDR. Thus, results of DEMO blanket designs testing in ITER will provide limited (but still useful) information that will need strong support from non-fusion facilities testing. The role of non-fusion tests is increased now to provide additional data required for DEMO blanket construction and qualification. A strategy of testing steps to DEMO blanket qualifications has to include parallel testing in ITER and in non-fusion devices. Experiments in fission reactors are able to provide essential data on materials radiation properties; tritium release, inventory and permeation; and thermomechanical behavior of the blanket breeder/multiplier. However, the volume in fission reactors is rather small and neutron spectra differ from the fusion reactor one. Nonetheless in the near future one depends primarily on fission reactor irradiation. The powerful accelerator based neutron source IFMIF could also provide useful information on radiation material properties. Plasma based neutron sources of different fusion devices could be the best choice for testing DEMO materials and blanket mock-ups. Timetable and costs of these devices are not clear now.

  15. The DEMO quasisymmetric stellarator

    Energy Technology Data Exchange (ETDEWEB)

    Garabedian, P. R. [New York University, 251 Mercer St., New York, NY 10012 (United States); McFadden, G. B. [National Institute of Standards and Technology, Gaithersburg, MD 20899 (United States)

    2010-07-01

    The NSTAB nonlinear stability code solves differential equations in conservation form, and the TRAN Monte Carlo test particle code tracks guiding center orbits in a fixed background, to provide simulations of equilibrium, stability, and transport in tokamaks and stellarators. These codes are well correlated with experimental observations and have been validated by convergence studies. Bifurcated 3D solutions of the 2D tokamak problem have been calculated that model persistent disruptions, neoclassical tearing modes (NTMs) and edge localized modes (ELMs) occurring in the International Thermonuclear Experimental Reactor (ITER), which does not pass the NSTAB simulation test for nonlinear stability. So we have designed a quasi axially symmetric (QAS) stellarator with similar proportions as a candidate for the demonstration (DEMO) fusion reactor that does pass the test [1]. The configuration has two field periods and an exceptionally accurate 2D symmetry that furnishes excellent thermal confinement and good control of the prompt loss of alpha particles. Robust coils are found from a filtered form of the Biot-Savart law based on a distribution of current over a control surface for the coils and the current in the plasma defined by the equilibrium calculation. Computational science has addressed the issues of equilibrium, stability, and transport, so it remains to develop an effective plan to construct the coils and build a diverter. (author)

  16. The DEMO Quasisymmetric Stellarator

    Directory of Open Access Journals (Sweden)

    Geoffrey B. McFadden

    2010-02-01

    Full Text Available The NSTAB nonlinear stability code solves differential equations in conservation form, and the TRAN Monte Carlo test particle code tracks guiding center orbits in a fixed background, to provide simulations of equilibrium, stability, and transport in tokamaks and stellarators. These codes are well correlated with experimental observations and have been validated by convergence studies. Bifurcated 3D solutions of the 2D tokamak problem have been calculated that model persistent disruptions, neoclassical tearing modes (NTMs and edge localized modes (ELMs occurring in the International Thermonuclear Experimental Reactor (ITER, which does not pass the NSTAB simulation test for nonlinear stability. So we have designed a quasiaxially symmetric (QAS stellarator with similar proportions as a candidate for the demonstration (DEMO fusion reactor that does pass the test [1]. The configuration has two field periods and an exceptionally accurate 2D symmetry that furnishes excellent thermal confinement and good control of the prompt loss of alpha particles. Robust coils are found from a filtered form of the Biot-Savart law based on a distribution of current over a control surface for the coils and the current in the plasma defined by the equilibrium calculation. Computational science has addressed the issues of equilibrium, stability, and transport, so it remains to develop an effective plan to construct the coils and build a diverter.

  17. Influence of the ac Stark effect on multiphoton transitions in molecules

    Science.gov (United States)

    Meerts, W. Leo; Ozier, Irving; Hougen, Jon T.

    1989-05-01

    A multiphoton mechanism for molecular beam transitions is presented which relies on a large first-order ac Stark effect to modulate the energy separation of the initial and final states of the multiphoton transition, but which does not require the presence of any intermediate level(s). The theoretical formalism uses ideas from the laser multiphoton literature for a two-level system interacting with a monochromatic electromagnetic radiation field, together with a close analog of the rotating wave approximation. The diagonal matrix elements of the Hamiltonian operator corresponding to the large ac Stark effect are removed by a mathematical substitution which in effect transforms appropriate differences of these diagonal elements into transition moments involving higher harmonics of the frequency of the monochromatic radiation field. The electric field strength of the true monochromatic radiation field is ``distributed'' among the higher harmonics of the effective field according to an expression involving Bessel functions. Because these Bessel functions are bounded, there exists for a given time t of exposure to the radiation, a threshold for the magnitude of the transition dipole matrix element coupling the two levels: Below this threshold, the transition probability in a traditional one-photon molecular beam electric resonance experiment cannot be made unity simply by increasing the amplitude of the radiation field. In fact, if the coupling matrix element is small enough, the molecular beam electric resonance signal cannot be detected within exposure time t. The algebraic formalism described above is checked by computer solution of an initial value problem involving four real coupled linear differential equations. It is then used to explain the multiphoton transitions previously observed in molecular beam electric resonance studies on the two symmetric top molecules OPF3 and CH3 CF3, where the number of photons involved in a given transition varies from 1

  18. Demo of Gaze Controlled Flying

    DEFF Research Database (Denmark)

    Alapetite, Alexandre; Hansen, John Paulin; Scott MacKenzie, I.

    2012-01-01

    Development of a control paradigm for unmanned aerial vehicles (UAV) is a new challenge to HCI. The demo explores how to use gaze as input for locomotion in 3D. A low-cost drone will be controlled by tracking user’s point of regard (gaze) on a live video stream from the UAV.......Development of a control paradigm for unmanned aerial vehicles (UAV) is a new challenge to HCI. The demo explores how to use gaze as input for locomotion in 3D. A low-cost drone will be controlled by tracking user’s point of regard (gaze) on a live video stream from the UAV....

  19. Russian DEMO-S reactor with continuous plasma burn

    Energy Technology Data Exchange (ETDEWEB)

    Shatalov, G. E-mail: geshat@qq.nfi.kiae.su; Kirillov, I.; Sokolov, Yu.; Strebkov, Yu.; Vasiliev, N

    2000-11-01

    A conceptual study of DEMO-S steady state reactor is being carried out in RF. The main goals of the study are aimed at establishing physics and engineering basis and limitations of the reactor. It was assumed that DEMO is a next step after international thermonuclear experimental reactors (ITER) operation, and so conservative assumptions were used in the study based on ITER engineering. A steady state operation mode is recommended with fusion power of 2-3 GW and maximum first wall (FW) neutron load of 3-4 MW m{sup -2}. The reactor has to operate in advance plasma mode with high fraction of bootstrap current. The reversed shear regime and operation in H-mode are evaluated. A lifetime of 30-40 MW m{sup -2} is assumed for the DEMO plant, with three to four changes of plasma facing components. The general reactor layout is determined. Two options of breeding blanket with ceramic and liquid lithium breeders are presented, supported by neutronic, thermalhydraulic and mechanical calculations. A conventional type of water or Li cooling divertor targets with maximum heat load of {approx}10 MW m{sup -2} was chosen. Heat to electricity conversion schemes are analysed for both helium and liquid metal coolant with net efficiency of 35-40%. Aspects of radioactive waste management are considered.

  20. The ac Stark shifts of the terahertz clock transitions of barium

    Institute of Scientific and Technical Information of China (English)

    余庚华; 耿鹰鸽; 李隆; 周超; 段丞博; 柴瑞鹏; 杨永明

    2015-01-01

    Wavelength-dependent AC Stark shifts and magic wavelengths of the terahertz clock transitions between the metastable triplet states 6s5d 3D1 and 6s5d 3D2 are investigated with considering the optical lattice trapping of barium atoms with the linearly polarized laser. The trap depths and the slopes of light shift difference with distinct magic wave-lengths of the optical lattices are also discussed in detail. Several potentially suitable working points for the optical lattice trapping laser are recommended and selected from these magic wavelengths.

  1. Investigation of the hydrogen release incident at the AC Transit Emeryville Facility.

    Energy Technology Data Exchange (ETDEWEB)

    Harris, Aaron P.; San Marchi, Christopher W.; Levin, Jamie; Butler, Dennis

    2012-06-01

    This report summarizes the investigation of the release of approximately 300kg of hydrogen at the AC Transit Facility in Emeryville, CA. The hydrogen release was avoidable in both the root cause and contributing factors. The report highlights the need for communication in all phases of project planning and implementation. Apart from the failed valve, the hydrogen system functioned as designed, venting the hydrogen gas a safe distance above surrounding structures and keeping the subsequent fire away from personnel and equipment. The Emeryville Fire Department responded appropriately given the information provided to the Incident Commander. No injuries or fatalities resulted from the incident.

  2. PSO-Ensemble Demo Application

    DEFF Research Database (Denmark)

    2004-01-01

    Within the framework of the PSO-Ensemble project (FU2101) a demo application has been created. The application use ECMWF ensemble forecasts. Two instances of the application are running; one for Nysted Offshore and one for the total production (except Horns Rev) in the Eltra area. The output is...

  3. AC-field-induced quantum phase transitions in density of states

    Science.gov (United States)

    Yang, Kai-Hua; Liu, Kai-Di; Wang, Huai-Yu; Qin, Chang-Dong

    2016-02-01

    We investigate the joint effects of the intralead electron interaction and an external alternating gate voltage on the time-averaged local density of states (DOSs) of a quantum dot coupled to two Luttinger-liquid leads in the Kondo regime. A rich dependence of the DOSs on the driving amplitude and intralead interaction is demonstrated. We show that the feature is quite different for different interaction strengths in the presence of the ac field. It is shown that the photon-assisted transport processes cause an additional splitting of the Kondo peak or dip, which exhibits photon-assisted single-channel (1CK) or two-channel Kondo (2CK) physics behavior. The phase transition between photon-assisted 1CK and 2CK physics occurs when the interaction strength is moderately strong. The inelastic channels associated with photon-assisted electron tunneling can dominate electron transport for weak interaction when the ac amplitude is greater than the frequency by one order of magnitude. In the limit of strong interaction the DOSs scale as a power-law behavior which is strongly affected by the ac field.

  4. Investigation of the Interfacial Transition Zone between Aggregate-Cement Paste by AC Impedance Spectroscopy

    Institute of Scientific and Technical Information of China (English)

    KONG Lijuan; HOU Lirong; WANG Yuhua; SUN Guowen

    2016-01-01

    Three different types and sizes of coarse aggregate were chosen, and the alternating current (AC) impedance of cement paste samples with and without aggregate was measured at different curing ages. Based on Song’s equivalent circuit model, the electrical properties from the AC impedance results were obtained, and the resistance of connected pores RCCP was used to characterize the microstructure of the interfacial transition zone (ITZ). The results show that the RCCP of concrete sample with aggregate is lower than that of cement paste sample, which indicates that the introduction of aggregate in cement paste makes the ITZ porous. Furthermore, for the same type of aggregate, an increase in particle size leads to a more porous ITZ, which accounts for the “water effect” and a larger aggregate would accumulate a thicker water iflm around it. In addition, for the same size of aggregate, the physical interaction between aggregate and cement paste is dominant in early age, and the microstructure of the ITZ around limestone aggregate is denser, which mainly depends on its rough surface and high water absorption. However, the microstructures of the ITZ around granite and basalt aggregates are denser in later age, which may be due to their higher chemical activity, and the chemical interaction between them and cement paste resulting in the generation of more hydrates. AC impedance spectroscopy thus proves to be powerful for evaluation of the microstructure of the ITZ.

  5. RF H and CD systems for DEMO - Challenges and opportunities

    International Nuclear Information System (INIS)

    The aim of driving a sufficient amount of plasma current with an appropriate radial current density profile is considered as one of the key challenges for a tokamak fusion power plant in steady state operation. Furthermore, efficient heating to enable transition to regime of enhanced confinement and to achieve breakeven plasma temperatures as well as MHD control and plasma breakdown assistance are required. In the framework of the EFDA Power Plant Physics and Technology (PPPT) activities, the ability of the Electron cyclotron (EC), Ion Cyclotron (IC) and Lower Hybrid (LH) systems to fulfil these requirements, was studied for a demonstration fusion power plant (DEMO). As boundary condition, a 1D description of the plasma for a pulsed DEMO based on system code studies combined with transport analysis was developed. The predicted 1D plasma parameters were used to calculate the current drive (CD) efficiency of each system and eventually optimised it. As an example, the EC current drive efficiency could be increased strongly by top launch compared to equatorial launch at least by a factor of two. For the IC system, two possible windows of operation for standard and higher frequencies were highlighted, whereby again top launch leads to higher CD-efficiencies. The efficiencies predicted for DEMO for the RF current drive systems will be presented. Finally, gaps in the feasibility of RF systems under DEMO relevant conditions will be identified

  6. Stick-Slip to Sliding Transition of Dynamic Contact Lines under AC Electrowetting.

    Science.gov (United States)

    't Mannetje, D J C M; Mugele, F; van den Ende, D

    2013-12-01

    We show that at low velocities the dynamics of a contact line of a water drop moving over a Teflon-like surface under ac electrowetting must be described as stick-slip motion, rather than one continuous movement. At high velocities we observe a transition to a slipping regime. In the slipping regime the observed dependence of the contact angle is well described by a linearization of both the hydrodynamic and the molecular-kinetic model for the dynamic contact line behavior. The overall geometry of the drop also has a strong influence on the contact angle: if the drop is confined to a disk-like shape with radius R, much larger than the capillary length, and height h, smaller than the capillary length, the advancing angle increases steeper with velocity as the aspect ratio h/R is smaller. Although influence of the flow field near a contact line on the contact angle behavior has also been observed in other experiments, these observations do not fit either model. Finally, in our ac experiments no sudden increase of the hysteresis beyond a certain voltage and velocity was observed, as reported by other authors for a dc voltage, but instead we find with increasing voltage a steady decrease of the hysteresis. PMID:24219094

  7. FWCD technology issues for DEMO

    Science.gov (United States)

    Nightingale, M.; Wooldridge, E.; Monakhov, I.

    2014-02-01

    The technology implications of potential FWCD systems have been assessed at two frequencies of relevance to DEMO as part of a wider study of heating and current drive systems for the EFDA Power Plant Physics and Technology (PPP&T), based upon two reference DEMO designs. Using the results of Van Eester et al [1], systems studies carried out for a 62MHz mid-harmonic system mounted on a 23MA 5.74T 8.5m major radius DEMO suggested that antenna voltages close to 50kV, and the handling of the resultant sheath power loadings, are likely to be required if all of the 12.9MA non-bootstrap current drive is to be provided by FWCD. The "wall plug" electrical efficiency of the midharmonic option of 0.18A/W.m2, potentially rising to 0.23A/W.m2 with the future development of solid state generators, however, looks very attractive, and the coupling is less sensitive to plasma edge parameters than for existing antennas, due to the low k// of 2.8m-1. The design could be based upon that presently under consideration for ITER, except for the replacement of insulating vacuum windows located relatively close to the plasma with all-metal designs [2]. A 352MHz high-harmonic option also looks technologically feasible, using a waveguide-based design and a port plug layout has been provided. This option might bring sheath effect and voltage hold-off benefits, but this is far from proven. In this case, systems studies were not feasible due to a lack of firm results from the physics studies. For both options: (a) the RF generators, power supplies and transmission line components required are either already available, or are under development for ITER, and (b) mechanical and material issues associated with the proposed FWCD antenna structures appear challenging, but will need solving on a wider basis across DEMO.

  8. A Demo Processor as an Educational Tool

    NARCIS (Netherlands)

    van Moergestel, L.; van Nieuwland, K.; Vermond, L.; Meyer, John-Jules Charles

    2014-01-01

    Explaining the workings of a processor can be done in several ways. Just a written explanation, some pictures, a simulator program or a real hardware demo. The research presented here is based on the idea that a slowly working hardware demo could be a nice tool to explain to IT students the inner wo

  9. Compact Stellarator Path to DEMO

    Science.gov (United States)

    Lyon, J. F.

    2007-11-01

    Issues for a DEMO reactor are sustaining an ignited/high-Q plasma in steady state, avoiding disruptions and large variations in power flux to the wall, adequate confinement of thermal plasma and alpha-particles, control of a burning plasma, particle and power handling, etc. Compact stellarators have key advantages -- steady-state high-plasma-density operation without external current drive or disruptions, stability without a close conducting wall or active feedback systems, and low recirculating power -- in addition to moderate plasma aspect ratio, good confinement, and high-beta potential. The ARIES-CS study established that compact stellarators can be competitive with tokamaks as reactors. Many of the issues for a compact stellarator DEMO can be answered using results from large tokamaks, ITER D-T experiments and fusion materials, technology and component development programs, in addition to stellarators in operation, under construction or in development. However, a large next-generation stellarator will be needed to address some physics issues: size scaling and confinement at higher parameters, burning plasma issues, and operation with a strongly radiative divertor. Technology issues include simpler coils, structure, and divertor fabrication, and better cost information.

  10. Spin density wave (SDW) transition in Ru doped BaFeAs2 investigated by AC steady state calorimetry

    International Nuclear Information System (INIS)

    Heat capacity measurements were done on sub-micron sized BaFe2−xRuxAs2 single crystals using thin film membrane based the AC steady state calorimetry technique. Noticeable thermal hysteresis is observed in the heat capacity of the BaFe2−xRuxAs2 during cooling and warming cycles, indicating first order nature of the SDW transition

  11. Diagnostic systems in DEMO: engineering design issues

    CERN Document Server

    Todd, T N

    2014-01-01

    The diagnostic systems of DEMO that are mounted on or near the torus, whether intended for the monitoring and control functions of the engineering aspects or the physics behaviour of the machine, will have to be designed to suit the hostile nuclear environment. This will be necessary not just for their survival and correct functioning but also to satisfy the pertinent regulatory bodies, especially where any of them relate to machine protection or the prevention or mitigation of accidents foreseen in the safety case. This paper aims to indicate the more important of the reactor design considerations that are likely to apply to diagnostics for DEMO, drawn from experience on JET, the provisions in hand for ITER and modelling results for the wall erosion and neutron damage effects in DEMO.

  12. Versatile Desktop Experiment Module (DEMo) on Heat Transfer

    Science.gov (United States)

    Minerick, Adrienne R.

    2010-01-01

    This paper outlines a new Desktop Experiment Module (DEMo) engineered for a chemical engineering junior-level Heat Transfer course. This new DEMo learning tool is versatile, fairly inexpensive, and portable such that it can be positioned on student desks throughout a classroom. The DEMo system can illustrate conduction of various materials,…

  13. ac hopping magnetotransport across the spin-flop transition in lightly doped La2CuO4

    Science.gov (United States)

    Sushkov, Oleg P.; Kotov, Valeri N.

    2008-02-01

    The weak ferromagnetism present in insulating La2CuO4 at low doping leads to a spin flop transition, and to transverse (interplane) hopping of holes in a strong external magnetic field. This results in a dimensional crossover 2D→3D for the in-plane transport, which in turn leads to an increase of the hole’s localization length and increased conduction. We demonstrate theoretically that as a consequence of this mechanism, a frequency-dependent jump of the in-plane ac hopping conductivity occurs at the spin flop transition. We predict the value and the frequency dependence of the jump. Experimental studies of this effect would provide important confirmation of the emerging understanding of lightly doped insulating La2-xSrxCuO4 .

  14. ac Stark shift measurements of the clock transition in cold Cs atoms: Scalar and tensor light shifts of the D2 transition

    Science.gov (United States)

    Costanzo, G. A.; Micalizio, S.; Godone, A.; Camparo, J. C.; Levi, F.

    2016-06-01

    The ac Stark shift, or light shift, is a physical phenomenon that plays a fundamental role in many applications ranging from basic atomic physics to applied quantum electronics. Here, we discuss experiments testing light-shift theory in a cold-atom cesium fountain clock for the Cs D2 transition (i.e., 6 2S1 /2→6 2P3 /2 at 852 nm). Cold-atom fountains represent a nearly ideal system for the study of light shifts: (1) The atoms can be perturbed by a field of arbitrary character (e.g., coherent field or nonclassical field); (2) there are no trapping fields to complicate data interpretation; (3) the probed atoms are essentially motionless in their center-of-mass reference frame, T ˜ 1 μK; and (4) the atoms are in an essentially collisionless environment. Moreover, in the present work the resolution of the Cs excited-state hyperfine splittings implies that the D2 ac Stark shift contains a nonzero tensor polarizability contribution, which does not appear in vapor phase experiments due to Doppler broadening. Here, we test the linearity of the ac Stark shift with field intensity, and measure the light shift as a function of field frequency, generating a "light-shift curve." We have improved on the previous best test of theory by a factor of 2, and after subtracting the theoretical scalar light shift from the experimental light-shift curves, we have isolated and tested the tensor light shift for an alkali D2 transition.

  15. New aspects in the Bragg Glass-Disordered phase transition: an analysis based on the 3rd harmonics of the AC magnetic susceptibility

    OpenAIRE

    Adesso*, M. G.; Flukiger, R.; Giamarchi, T.; Goldacker, W.; H.; Kupfer; Pace, S.; Polichetti, M.; Uglietti, D.

    2007-01-01

    We analyse the phase transition between the Bragg Glass and the Disordered phase in the vortex lattice in type-II superconductors, both by analytical computations and experimental investigations. It is known that if the Peak Effect can be detected, a Bragg Glass/Disordered phase transition takes place. We show that, in some conditions, this transition can occur without the observation of the Peak Effect Phenomenon. We introduce a method based on the 3rd harmonics of the AC magnetic susceptibi...

  16. Contribution to DEMO reactor RH maintenance assessment

    International Nuclear Information System (INIS)

    The scope of this paper is a preliminary assessment of the maintenance scheme in support of the European study for the next generation of fusion reactor: DEMO. Despite other fusion machine requiring remote handling maintenance operations, DEMO is supposed to work under steady state operational conditions. Therefore, requirement on the maintenance scheme is stronger. To target a good availability of the machine along machine operation plan, it is necessary to draw an adequate maintenance scheme. Indeed, due to the high fluxes generated by the plasma in the vacuum vessel, the first wall lifetime is limited, so the frequent replacement is necessary. On current fusion experimental machine, as first wall load conditions are less severe, DEMO condition implies high level of requirement on maintenance time. During DEMO lifetime, several full first wall replacements are expected. To provide access to the vacuum vessel machine for first wall removal, preparatory work is required to set the machine to adequate maintenance conditions and to open the machine properly, the same situation at the end of the maintenance period. Shutdown duration for first wall replacement should be as short as possible to reach the availability target of the machine. From this statement, the maintenance duration should not exceed 20% of the total lifetime of the reactor operation. First wall segmentation (i.e. total number of component to replace) has a high impact onto the replacement time. Considering the number of feasible designs for the first wall segmentation, we concentrate remote handling concept assessments one type of segmentation, the one minimizing the numbers of modules to replace . Assumption on Divertor segmentation for these DEMO studies have similarities with Divertor ITER design; therefore ITER design output is relevant . We assume divertor removal performed in shadow time, while removing the other first wall modules.

  17. Contribution to DEMO reactor RH maintenance assessment

    Energy Technology Data Exchange (ETDEWEB)

    Bonnemason, Julie [CEA, LIST, Service de Robotique Interactive 18 route du Panorama, BP6, FONTENAY AUX ROSES, F-92265 (France)], E-mail: julie.bonnemason@cea.fr; Friconneau, Jean-Pierre [CEA, LIST, Service de Robotique Interactive 18 route du Panorama, BP6, FONTENAY AUX ROSES, F-92265 (France); Maisonnier, David [EFDA, Boltzmannstrasse 2, 85748 Garching (Germany); Perrot, Yann [CEA, LIST, Service de Robotique Interactive 18 route du Panorama, BP6, FONTENAY AUX ROSES, F-92265 (France)

    2009-06-15

    The scope of this paper is a preliminary assessment of the maintenance scheme in support of the European study for the next generation of fusion reactor: DEMO. Despite other fusion machine requiring remote handling maintenance operations, DEMO is supposed to work under steady state operational conditions. Therefore, requirement on the maintenance scheme is stronger. To target a good availability of the machine along machine operation plan, it is necessary to draw an adequate maintenance scheme. Indeed, due to the high fluxes generated by the plasma in the vacuum vessel, the first wall lifetime is limited, so the frequent replacement is necessary. On current fusion experimental machine, as first wall load conditions are less severe, DEMO condition implies high level of requirement on maintenance time. During DEMO lifetime, several full first wall replacements are expected. To provide access to the vacuum vessel machine for first wall removal, preparatory work is required to set the machine to adequate maintenance conditions and to open the machine properly, the same situation at the end of the maintenance period. Shutdown duration for first wall replacement should be as short as possible to reach the availability target of the machine. From this statement, the maintenance duration should not exceed 20% of the total lifetime of the reactor operation. First wall segmentation (i.e. total number of component to replace) has a high impact onto the replacement time. Considering the number of feasible designs for the first wall segmentation, we concentrate remote handling concept assessments one type of segmentation, the one minimizing the numbers of modules to replace . Assumption on Divertor segmentation for these DEMO studies have similarities with Divertor ITER design; therefore ITER design output is relevant . We assume divertor removal performed in shadow time, while removing the other first wall modules.

  18. Modelling of pulsed and steady-state DEMO scenarios

    Science.gov (United States)

    Giruzzi, G.; Artaud, J. F.; Baruzzo, M.; Bolzonella, T.; Fable, E.; Garzotti, L.; Ivanova-Stanik, I.; Kemp, R.; King, D. B.; Schneider, M.; Stankiewicz, R.; Stępniewski, W.; Vincenzi, P.; Ward, D.; Zagórski, R.

    2015-07-01

    Scenario modelling for the demonstration fusion reactor (DEMO) has been carried out using a variety of simulation codes. Two DEMO concepts have been analysed: a pulsed tokamak, characterized by rather conventional physics and technology assumptions (DEMO1) and a steady-state tokamak, with moderately advanced physics and technology assumptions (DEMO2). Sensitivity to impurity concentrations, radiation, and heat transport models has been investigated. For DEMO2, the impact of current driven non-inductively by neutral beams has been studied by full Monte Carlo simulations of the fast ion distribution. The results obtained are a part of a more extensive research and development (R&D) effort carried out in the EU in order to develop a viable option for a DEMO reactor, to be adopted after ITER for fusion energy research.

  19. Superconducting transition in ruthenocuprate RuSr2GdCu2O8 viewed from the studies of the imaginary part of ac susceptibility

    Science.gov (United States)

    Zivkovic, I.; Drobac, D.; Ariosa, D.; Berger, H.; Pavuna, D.; Prester, M.

    2002-12-01

    We have measured two structurally similar superconducting systems, RuSr2GdCu2O8 and GdBa2Cu3O7 by means of high-resolution ac susceptibility. The real and the imaginary part of ac susceptibility of both bulk-ceramic and powdered samples have been studied down to the very small magnetic-field levels. We show that there are significant differences in the evolution of superconductivity in the two studied superconducting systems. In particular, we show that the superconducting transition in the grains in RuSr2GdCu2O8 system is masked with intrinsic magnetism of complex origin.

  20. Diagnostics for plasma control on DEMO: challenges of implementation

    NARCIS (Netherlands)

    Donne, A. J. H.; Costley, A. E.; Morris, A. W.

    2012-01-01

    As a test fusion power plant, DEMO will have to demonstrate reliability and very long pulse/steady-state operation, which calls for unprecedented robustness and reliability of all diagnostic systems (also requiring adequate redundancy). But DEMO will have higher levels of neutron and gamma fluxes, a

  1. DEMO Active Maintenance Facility concept progress 2012

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Justin, E-mail: Justin.Thomas@ccfe.ac.uk [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Loving, Antony; Crofts, Oliver; Morgan, Robert [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Harman, Jon [EFDA, PPP and T, Boltzmannstraße 2, 85748 Garching (Germany)

    2014-10-15

    The DEMO Active Maintenance Facility (AMF) would be used for the storage, handling and processing of In-Vessel Components (IVC) throughout their time on site, the only exception being the time that they are installed in the vessel. It is anticipated that all handling operations associated with used components will have to be carried out using remote handling techniques. During plasma operations the In-Vessel Components are exposed to high levels of neutron activation. This activation results in high radiation dose rates and decay heating. This presents a significant problem for Remote Handling Equipment (RHE) in the AMF. The high dose rates require the equipment to be sufficiently radiation tolerant to allow it to work reliably for long periods. The decay heating requires forced cooling of newly removed IVC's while they are in storage. The duration of the storage is dependent on the decay heating reducing to a level that has been nominally set at <50 °C without active cooling in room temperature air. This paper summarises the progress made in 2012 on the conceptual design of the AMF and its facilities. The layout and proposed function of the main areas will be described along with the principles applied. The design of the AMF has evolved from a simple representation of the required facilities in 2011 to a concept that can be developed to support maintenance of DEMO.

  2. Energy storage system for a pulsed DEMO

    International Nuclear Information System (INIS)

    Several designs have been proposed for the DEMO fusion reactor. Some of them are working in a non-steady state mode. Since a power plant should be able to deliver to the grid a constant power, this challenge must be solved. Energy storage is required at a level of 250 MWhe with the capability of delivering a power of 1 GWe. A review of different technologies for energy storage is made. Thermal energy storage (TES), fuel cells and other hydrogen storage, compressed air storage, water pumping, batteries, flywheels and supercapacitors are the most promising solutions to energy storage. Each one is briefly described in the paper, showing its basis, features, advantages and disadvantages for this application. The conclusion of the review is that, based on existing technology, thermal energy storage using molten salts and a system based on hydrogen storage are the most promising candidates to meet the requirements of a pulsed DEMO. These systems are investigated in more detail together with an economic assessment of each

  3. Overview of EU DEMO design and R and D activities

    Energy Technology Data Exchange (ETDEWEB)

    Federici, G., E-mail: gianfranco.federici@efda.org [EFDA PPPT, Boltzmannstr. 2, Garching 85748 (Germany); Kemp, R.; Ward, D. [CCFE Culham, EURATOM Association, Oxfordshire OX14 3DB (United Kingdom); Bachmann, C.; Franke, T.; Gonzalez, S.; Lowry, C.; Gadomska, M.; Harman, J.; Meszaros, B.; Morlock, C.; Romanelli, F.; Wenninger, R. [EFDA PPPT, Boltzmannstr. 2, Garching 85748 (Germany)

    2014-10-15

    Highlights: • An important objective of the new EU fusion roadmap is to lay the foundation of a DEMO Fusion Power Reactor to follow ITER. • DEMO should be capable of generating several 100 MW of net electricity and operating with a closed fuel-cycle by 2050. • The paper outlines the DEMO design and R and D approach recently being undertaken in Europe. • The paper presents some preliminary design options that are under evaluation as well as the most urgent R and D work needed. • The R and D on materials for a near-term DEMO is discussed in detail elsewhere. - Abstract: One important objective of the EU fusion roadmap Horizon 2020 is to lay the foundation of a Demonstration Fusion Power Reactor (DEMO) to follow ITER, with the capability of generating several 100 MW of net electricity to the grid and operating with a closed fuel-cycle by 2050. This is currently viewed by many of the nations engaged in the construction of ITER as the remaining crucial step towards the exploitation of fusion power. This paper outlines the DEMO design and R and D approach that is being adopted in Europe and presents some of the preliminary design options that are under evaluation as well as the most urgent R and D work that is expected to be launched in the near-future. The R and D on materials for a near-term DEMO is discussed in detail elsewhere.

  4. Immune modelling and programming of a mobile robot demo

    Institute of Scientific and Technical Information of China (English)

    GONG Tao; CAI Zi-xing; HE Han-gen

    2006-01-01

    An artificial immune system was modelled with self/non-self selection to overcome abnormity in a mobile robot demo. The immune modelling includes the innate immune modelling and the adaptive immune modelling. The self/non-self selection includes detection and recognition, and the self/non-self detection is based on the normal model of the demo. After the detection, the non-self recognition is based on learning unknown non-self for the adaptive immunization. The learning was designed on the neural network or on the learning mechanism from examples. The last step is elimination of all the non-self and failover of the demo. The immunization of the mobile robot demo is programmed with Java to test effectiveness of the approach. Some worms infected the mobile robot demo, and caused the abnormity. The results of the immunization simulations show that the immune program can detect 100% worms,recognize all known Worms and most unknown worms, and eliminate the worms. Moreover, the damaged files of the mobile robot demo can all be repaired through the normal model and immunization. Therefore, the immune modelling of the mobile robot demo is effective and programmable in some anti-worms and abnormity detection applications.

  5. European DEMO BOT solid breeder blanket

    International Nuclear Information System (INIS)

    The BOT (Breeder Outside Tube) Solid Breeder Blanket for a fusion DEMO reactor is presented. This is one of the four blanket concepts under development in the frame of the European fusion technology program with the aim to select in 1995 the two most promising ones for further development. In the paper the reference blanket design and external loops are described as well as the results of the theoretical and experimental work in the fields of neutronics, thermohydraulics, mechanical stresses, tritium control and extraction, development and irradiation of the ceramic breeder material, beryllium development, ferromagnetic forces caused by disruptions, safety and reliability. An outlook is given on the remaining open questions and on the required R and D program. (orig.)

  6. Advances in the physics basis for the European DEMO design

    Science.gov (United States)

    Wenninger, R.; Arbeiter, F.; Aubert, J.; Aho-Mantila, L.; Albanese, R.; Ambrosino, R.; Angioni, C.; Artaud, J.-F.; Bernert, M.; Fable, E.; Fasoli, A.; Federici, G.; Garcia, J.; Giruzzi, G.; Jenko, F.; Maget, P.; Mattei, M.; Maviglia, F.; Poli, E.; Ramogida, G.; Reux, C.; Schneider, M.; Sieglin, B.; Villone, F.; Wischmeier, M.; Zohm, H.

    2015-06-01

    In the European fusion roadmap, ITER is followed by a demonstration fusion power reactor (DEMO), for which a conceptual design is under development. This paper reports the first results of a coherent effort to develop the relevant physics knowledge for that (DEMO Physics Basis), carried out by European experts. The program currently includes investigations in the areas of scenario modeling, transport, MHD, heating & current drive, fast particles, plasma wall interaction and disruptions.

  7. Demonstration tokamak-power-plant study (DEMO)

    International Nuclear Information System (INIS)

    A study of a Demonstration Tokamak Power Plant (DEMO) has been completed. The study's objective was to develop a conceptual design of a prototype reactor which would precede commercial units. Emphasis has been placed on defining and analyzing key design issues and R and D needs in five areas: noninductive current drivers, impurity control systems, tritium breeding blankets, radiation shielding, and reactor configuration and maintenance features. The noninductive current drive analysis surveyed a wide range of candidates and selected relativistic electron beams for the reference reactor. The impurity control analysis considered both a single-null poloidal divertor and a pumped limiter. A pumped limiter located at the outer midplane was selected for the reference design because of greater engineering simplicity. The blanket design activity focused on two concepts: a Li2O solid breeder with high pressure water cooling and a lead-rich Li-Pb eutectic liquid metal breeder (17Li-83Pb). The reference blanket concept is the Li2O option with a PCA structural material. The first wall concept is a beryllium-clad corrugated panel design. The radiation shielding effort concentrated on reducing the cost of bulk and penetration shielding; the relatively low-cost outborad shield is composed of concrete, B4C, lead, and FE 1422 structural material

  8. System analysis study for Korean fusion DEMO reactor

    International Nuclear Information System (INIS)

    Highlights: ► A conceptual design study for a steady-state K-DEMO has been initiated. ► The major radius is designed to be below 6.5 m, considering engineering feasibilities. ► Magnetic field at the plasma center around 8 T is achieved by using Nb3Sn technology. ► Feasibility of near-future DEMO reactor is studied with a system analysis code. ► A net electric generation on the order of 300 MWe can be achieved below the βN of 5. -- Abstract: A conceptual design study for a steady-state Korean fusion DEMO reactor (K-DEMO) has been initiated. Two peculiar features need to be noted. First, the major radius is designed to be just below 6.5 m, considering practical engineering feasibilities. But still, high magnetic field at the plasma center around 8 T is expected to be achieved by using current state-of-the-art high performance Nb3Sn strand technology. Second, a two-stage development plan is being considered. In the first stage, K-DEMO will demonstrate a net electricity generation but will also act as a component test facility. Then, after a major upgrade, K-DEMO is expected to show a net electric generation on the order of 300 MWe and the competitiveness in cost of electricity (COE). Feasibility of such a practical, near-future demonstration reactor is studied in this paper, based on a zero dimensional system analysis code study. It was shown that a net electric generation on the order of 300 MWe can be achieved below the optimistic βN limit of 5. The elongation of K-DEMO is around 1.8 with single null configuration. Detailed optimization process and the resultant various plasma parameters are described

  9. Availability Considerations in the Design of K-DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Thomas [PPPL; Im, Kim [NFRI, Korea; Kessel, Charles [PPPL; Kim, K. [NFRI, Korea; Neilson, George H. [PPPL; Park, J-S. [NFRI, Korea; Titus, Peter [PPPL

    2014-09-01

    A DEMO device has been considered the next step following ITER as a near-term prototypical reactor design that is tritium self-sufficient and produces a limited amount of net electricity. The machine maintenance approach and planned configuration concept plays a major role in establishing the design point. DEMO will also need to show that adequate operating availability can be achieved over a reasonable time period, as a last step before full-scale electricity production. The ability to operate with high availability/reliability plays a key ingredient in defining the DEMO configuration, fostering the need for rapid removal/replacement of limited-life in-vessel components. DEMO pre-conceptual studies are being carried out by South Korea (with US participation) and other countries. The device designs span a range of maintenance approaches from full radial extraction of large in-vessel modules through all TF horizontal openings to vertical maintenance of segmented in-vessel components. Progress made on the S. Korea's K-DEMO design will be provided with emphasis on the design choices identified to promote high availability.

  10. A preliminary conceptual design study for Korean fusion DEMO reactor

    International Nuclear Information System (INIS)

    Highlights: ► Perform a preliminary conceptual study for a steady-state Korean DEMO reactor. ► Present design guidelines and requirements of Korean DEMO reactor. ► Present a preliminary design of TF (toroidal field) and CS (central solenoid) magnet. ► Present a preliminary result of the radial build scheme of Korean DEMO reactor. -- Abstract: As the ITER is being constructed, there is a growing anticipation for an earlier realization of fusion energy, so called fast-track approach. Korean strategy for fusion energy can be regarded as a fast-track approach and one special concept discussed in this paper is a two-stage development plan. At first, a steady-state Korean DEMO Reactor (K-DEMO) is designed not only to demonstrate a net electricity generation and a self-sustained tritium cycle, but also to be used as a component test facility. Then, at its second stage, a major upgrade is carried out by replacing in-vessel components in order to show a net electric generation on the order of 300 MWe and the competitiveness in cost of electricity (COE). The major radius is designed to be just below 6.5 m, considering practical engineering feasibilities. By using high performance Nb3Sn-based superconducting cable currently available, high magnetic field at the plasma center above 8 T can be achieved. A design concept for TF magnets and radial builds for the K-DEMO considering a vertical maintenance scheme, are presented together with preliminary design parameters

  11. A preliminary systems assessment of the Starlite Demo candidates

    Energy Technology Data Exchange (ETDEWEB)

    Bathke, C.G.

    1995-12-01

    The Starlite project has evaluated the following five tokamaks as candidates for the US Demo Power Plant: (1) steady state, first stability regime; (2) pulsed, first stability regime; (3) steady state, second stability regime; (4) steady state, reversed shear; and (5) steady state, low aspect ratio. Systems analysis of these candidates has played an important role in the selection of a reversed-shear tokamak for further conceptual design as a US Demo Power Plant. The cost-based systems analysis that led to the selection of a reversed-shear tokamak is described herein.

  12. DEMO-SOCIAL DETERMINANTS OF EUROPEAN CONSUMER BEHAVIOUR

    Directory of Open Access Journals (Sweden)

    Danu Marcela-Cornelia

    2010-07-01

    Full Text Available The components of demo-social macroeconomic level but especially in the continental context were decisive action on both exponents of the supply and the demand; the businessman need to know features, character and effects of these variables on the functionality they produce while the European market and national. From the range of the demo-social components, I referred to the social classes, the reference groups, the area of residence, taking into consideration reality that these components carries on business in general, particularly on the consumer, a long-term determination so, their knowledge as fair provides managers can develop policies and strategies consistent with these conditions.

  13. Demo: Using RapidMiner for Text Mining

    OpenAIRE

    Shterev, Yordan

    2013-01-01

    In this demo the basic text mining technologies by using RapidMining have been reviewed. RapidMining basic characteristics and operators of text mining have been described. Text mining example by using Navie Bayes algorithm and process modeling have been revealed.

  14. DEMO hot cell and ex-vessel remote handling

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Justin, E-mail: justin.thomas@ccfe.ac.uk [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Loving, Antony [Euratom/CCFE Fusion Association, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Bachmann, Christian; Harman, Jon [EFDA, PPP and T, Boltzmannstraße 2, 85748 Garching (Germany)

    2013-10-15

    Highlights: ► Overview of current DEMO maintenance concepts. ► Comparison of current dextrous remote handling technologies and their rebalance to DEMO. ► Presentation of some ideas to improve the productivity and reliability of the DEMO ex-vessel transport system. ► A description of the size and type facilities that might be required in the DEMO hot cell. ► Identification of some areas that need to be developed further to meet the requirements of DEMO. -- Abstract: In Europe the work on the specification and design of a demonstration power plant (DEMO) is being carried out by EFDA in the power plant physics and technology (PPP and T) programme. DEMO will take fusion from experimental research into showing the potential for commercial power generation. During the fusion reaction, components in the tokamak become highly activated. The estimated dose rate levels after shutdown (zero decay time) due to 60 dpa accumulation in steel (blanket) and 30 dpa (divertor) are 13.1–17.4 kGy/h (blanket); 8.8–11.6 kGy/h (divertor) [1], much higher than those to be encountered at ITER. Upon removal from the tokamak, components would be transported to the hot cell facility with attention to minimizing the spread of activated dust and tritium contamination. It is proposed to use a sealed cask of ∼20 tonnes, running on air castors with 50% lifting capability redundancy. Due to the number and complexity of the routes taken by this transporter it would have to be an un-tethered semi-autonomous system. This poses some technical challenges, including providing sufficient battery capacity, reliable guidance and a fail safe un-tethered control system. The mass of the components being moved is assumed here to range from a few tonnes to in excess of one hundred tonnes. Before the removed in-vessel components can be processed in the hot cell, they would require a period of cooling, approximately 2.5 years, to allow dose rate and decay heating to reduce. This reduces the decay

  15. Overview of physics results from MAST towards ITER/DEMO and the MAST Upgrade

    DEFF Research Database (Denmark)

    Meyer, H.; Abel, I.G.; Akers, R.J.;

    2013-01-01

    New diagnostic, modelling and plant capability on the Mega Ampère Spherical Tokamak (MAST) have delivered important results in key areas for ITER/DEMO and the upcoming MAST Upgrade, a step towards future ST devices on the path to fusion currently under procurement. Micro-stability analysis...... of 9, compatible with pellet fuelling. The peak heat flux of mitigated and natural ELMs follows the same linear trend with ELM energy loss and the first ELM-resolved Ti measurements in the divertor region are shown. Measurements of flow shear and turbulence dynamics during L–H transitions show...... assuming specific models for the heat flux. Other results include the discrepancy of the current profile evolution during the current ramp-up with solutions of the poloidal field diffusion equation, studies of the anomalous Doppler resonance compressional Alfvén eigenmodes, disruption mitigation studies...

  16. DEMO and fusion power plant conceptual studies in Europe

    International Nuclear Information System (INIS)

    Within the European Power Plant Conceptual Study (PPCS) four fusion power plant 'models' have been developed. Two of these models were developed considering limited extrapolations both in physics and in technology. For the two other models, advanced physics scenarios have been identified and combined with advanced blanket concepts that allow higher thermodynamic efficiencies of the power conversion systems. For all the PPCS models, systems analyses were used to integrate the plasma physics and technology constraints to produce self-consistent plant parameter sets. The broad features of the conclusions of previous studies on safety, environmental impact and economics have been confirmed for the new models and demonstrated with increased confidence. The PPCS also helps in the definition of the objectives and in the identification of the design drivers of DEMO, i.e. the device between the next step (ITER) and a first-of-a-kind reactor. These will constitute the basis of the European DEMO Conceptual Study that has recently started

  17. Reel success creating demo reels and animation portfolios

    CERN Document Server

    Cabrera, Cheryl

    2013-01-01

    Are you an animator looking to get your foot in the door to the top studios?It's tough if you don't have a demo reel and portfolio that reflects your unique style and incredible talents.  The reception of that reel will make or break you; so it's no wonder that creating a demo reel can be such a daunting task.  Reel Success by Cheryl Cabrera can help.  This book guides you into putting the right content into your portfolio, how to cater to the right audience, and how to harness the power of social media and network effectively.  Accompanied by case studies of actual students

  18. LOW POWER SOFTWARE HEVC DECODER DEMO FOR MOBILE DEVICES

    OpenAIRE

    Nogues, Erwan; Lacour, Morgan; Raffin, Erwan; Pelcat, Maxime; Menard, Daniel

    2015-01-01

    Demo session International audience Video on mobile devices is a must-have feature with the prominence of new services and applications using video like streaming or conferencing. By improving the compression performance by a factor of two with a similar quality, the new video standard High Efficiency Video Coding (HEVC) is an appealing technology for service providers. Besides, with the recent progress of Systems-on-Chip (SoC) for mobile devices, software video decoders is now a realit...

  19. Development of the Helium Cooled Lithium Lead blanket for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Aiello, G., E-mail: giacomo.aiello@cea.fr [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Aubert, J.; Jonquères, N. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Li Puma, A. [CEA-Saclay, DEN/DANS/DM2S/SERMA/LPEC, 91191 Gif Sur Yvette Cedex (France); Morin, A.; Rampal, G. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France)

    2014-10-15

    Highlights: • The HCLL blanket design has been modified to adapt it to the 2012 EFDA DEMO specifications. • The new design has been developed with the aim to capitalize on TBM experience in ITER. • A new attachment system for the modules has been proposed. - Abstract: The Helium Cooled Lithium Lead (HCLL) blanket is one of the candidate European blanket concepts selected for the DEMOnstration fusion power plant that should follow ITER. In a fusion power plant, the blanket is one of the key components because of its impact on the plant performance, availability, safety and economics. In 2012, the European Fusion Development Agreement (EFDA) agency issued new specifications for DEMO: this paper describes the work performed to adapt the previous 2007 HCLL-DEMO blanket design to those specifications. A new segmentation has been defined assuming straight surfaces for all blanket modules. Following the Multi Module Segment (MMS) option, all modules are attached to a common back supporting structure which also serves as manifold for Helium and PbLi distribution. A detailed CAD design of the central outboard module has been defined. Thermo-hydraulic and thermo-mechanical analyses on of the First Wall and Breeder Zone have been carried out. For the attachment of the modules to the common backplate, a new solution based on the use of Tie Rods, derived from the design of the corresponding HCLL Test Blanket Module for ITER, has been proposed. This paper also identifies the priorities for further development of the HCLL blanket design.

  20. Study of safety features and accident scenarios in a fusion DEMO reactor

    International Nuclear Information System (INIS)

    Highlights: •This paper reports progress in the fusion DEMO safety research conducted under the Broader Approach DEMO Design Activities. •Hazards of a reference DEMO concept have been assessed. •Reference accident event sequences in the reference DEMO in this study have been analyzed based on the master logic diagram (MLD) and the functional failure mode and effect analysis (FFMEA) techniques. •Accident events of particular concern in the DEMO have been selected based on the MLD and FFMEA analysis. -- Abstract: After the Fukushima Dai-ichi nuclear accident, a need for assuring safety of fusion energy has grown in the Japanese (JA) fusion research community. DEMO safety research has been launched as a part of Broader Approach DEMO Design Activities (BA-DDA). This paper reports progress in the fusion DEMO safety research conducted under BA-DDA. Safety requirements and evaluation guidelines have been, first of all, established based on those established in the Japanese ITER site invitation activities. The radioactive source terms and energies that can mobilize such source terms have been assessed for a reference DEMO concept. This concept employs in-vessel components that are cooled by pressurized water and built of a low activation ferritic steel (F82H), contains solid pebble beds made of lithium-titanate (Li2TiO3) and beryllium–titanium (Be12Ti) for tritium breeding and neutron multiplication, respectively. It is shown that unlike the energies expected in ITER, the enthalpy in the first wall/blanket cooling loops is large compared to the other energies expected in the reference DEMO concept. Reference accident event sequences in the reference DEMO in this study have been analyzed based on the Master Logic Diagram and Functional Failure Mode and Effect Analysis techniques. Accident events of particular concern in the DEMO have been selected based on the event sequence analysis and the hazard assessment

  1. P-DEMO for demonstration of fast spectrum transmutator PEACER

    International Nuclear Information System (INIS)

    The concept of proliferation-resistant, environment-friendly, accident-tolerant, continual and economical reactors (PEACER) has been developed by the NUTRECK, aiming at converting all spent nuclear fuels (SNF) into Low and Intermediate Level Waste (LILW) by integrating an advanced pyrochemical recycling and heavy liquid metal cooled fast reactor technology into a multi-national transmutation facility. It is proposed that the PEACER mandate - transmutation leaving no high level waste behind - can be demonstrated by a multinational facility designated as P-DEMO. P-DEMO is an integral pool-type reactor cooled by LBE coolant in primary cooling system with approximately 8m in height and 4m in diameter. P-DEMO will be started up with initial 19.75% enriched U-Zr (38-62 w/o) metallic fuels and its normal operation entirely relies on the natural circulation capability of liquid LBE. Total power of P-DEMO is 100MW thermal equivalent to 35MW electric power rating and is to be located within an underground containment facilities with strict security control and physical protection. One of the most important design features of P-DEMO is a central test assembly for fuel and materials qualifications which is cooled by LBE forced convection in the independent square assembly. As shown, the primary heat transport system is sealed by double wall reactor vessel for excluding the loss of coolant accidents from potential accident scenarios. Natural circulation also eliminates potential risk of loss of flow accident scenarios in primary cooling system. Double containment also protects the emission of radioactive isotopes in the case of significant abnormal conditions. If the hypothetical core melting accidents, the molten core distribution and cooling structure designated as COASIS will spread and solidify the molten core to curb the situation into stable long-term cooling mode with the help of RVACS. This COASIS is placed in the bottom of reactor vessel. Twelve helical type steam

  2. Development of the water cooled lithium lead blanket for DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, J., E-mail: julien.aubert@cea.fr [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Aiello, G.; Jonquères, N. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France); Li Puma, A. [CEA-Saclay, DEN/DANS/DM2S/SERMA/LPEC, 91191 Gif Sur Yvette Cedex (France); Morin, A.; Rampal, G. [CEA-Saclay, DEN/DANS/DM2S/SEMT/BCCR, 91191 Gif Sur Yvette Cedex (France)

    2014-10-15

    Highlights: • The WCLL blanket design has been modified to adapt it to the 2012 EFDA DEMO specifications. • Preliminary CAD design of the equatorial outboard module of the WCLL blanket has been developed for DEMO. • Finite elements analyses have been carried out in order to assess the module thermal behavior in the straight part of the module. - Abstract: The water cooled lithium lead (WCLL) blanket, based on near-future technology requiring small extrapolation from present-day knowledge both on physical and technological aspect, is one of the breeding blanket concepts considered as possible candidates for the EU DEMOnstration power plant. In 2012, the EFDA agency issued new specifications for DEMO: this paper describes the work performed to adapt the WCLL blanket design to those specifications. Relatively small modules with straight surfaces are attached to a common Back Supporting Structure housing feeding pipes. Each module features reduced activation ferritic-martensitic steel as structural material, liquid Lithium-Lead as breeder, neutron multiplier and carrier. Water at typical Pressurized Water Reactors (PWR) conditions is chosen as coolant. A preliminary design of the equatorial outboard module has been achieved. Finite elements analyses have been carried out in order to assess the module thermal behavior. Two First Wall (FW) concepts have been proposed, one favoring the thermal efficiency, the other favoring the manufacturability. The Breeding Zone has been designed with C-shaped Double-Walled Tubes in order to minimize the Water/Pb-15.7Li interaction likelihood. The priorities for further development of the WCLL blanket concept are identified in the paper.

  3. Review of stellarator/heliotron design issues towards MFE DEMO

    International Nuclear Information System (INIS)

    The first review is presented for the recent stellarator designs of FFHR, HSR, ARIES-CS, which are based on the experimental device projects of LHD, W-7X, NCSX, respectively. The main advantageous features of those designs are common on (1) current-free plasmas, which leads to steady, high Q and disruption-free reactors and (2) high density operations, which largely reduces the diverter heat load. Design optimization and engineering feasibility are highlighted including maintainability, fabricability and showing future R and D key issues with prospect towards DEMO.

  4. Demos as an Explanatory Lens in Teacher Educators' Elusive Search for Social Justice

    Science.gov (United States)

    Oikonomidoy, Eleni M.; Brock, Cynthia H.; Obenchain, Kathryn M.; Pennington, Julie L.

    2013-01-01

    Borrowing insights from the Ancient Greek ideal conceptions of a democratic civic space (demos), this article examines the applicability of this framework to four teacher educators' journey to implement social justice in their programs. It is proposed that the three constitutive dimensions of demos (freedom of speech, equality to vote and…

  5. The Role of Community Colleges in Advancing Upward Mobility: A Demos Perspective

    Science.gov (United States)

    Huelsman, Mark

    2015-01-01

    This article provides a short background on Demos, a public policy organization that works on issues of political and economic inequality. Demos views community colleges as a linchpin in the American higher education system, and it has worked over several years to research ways to increase state support for higher education and direct support…

  6. An FPGA computing demo core for space charge simulation

    International Nuclear Information System (INIS)

    In accelerator physics, space charge simulation requires large amount of computing power. In a particle system, each calculation requires time/resource consuming operations such as multiplications, divisions, and square roots. Because of the flexibility of field programmable gate arrays (FPGAs), we implemented this task with efficient use of the available computing resources and completely eliminated non-calculating operations that are indispensable in regular micro-processors (e.g. instruction fetch, instruction decoding, etc.). We designed and tested a 16-bit demo core for computing Coulomb's force in an Altera Cyclone II FPGA device. To save resources, the inverse square-root cube operation in our design is computed using a memory look-up table addressed with nine to ten most significant non-zero bits. At 200 MHz internal clock, our demo core reaches a throughput of 200 M pairs/s/core, faster than a typical 2 GHz micro-processor by about a factor of 10. Temperature and power consumption of FPGAs were also lower than those of micro-processors. Fast and convenient, FPGAs can serve as alternatives to time-consuming micro-processors for space charge simulation.

  7. An FPGA computing demo core for space charge simulation

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Jinyuan; Huang, Yifei; /Fermilab

    2009-01-01

    In accelerator physics, space charge simulation requires large amount of computing power. In a particle system, each calculation requires time/resource consuming operations such as multiplications, divisions, and square roots. Because of the flexibility of field programmable gate arrays (FPGAs), we implemented this task with efficient use of the available computing resources and completely eliminated non-calculating operations that are indispensable in regular micro-processors (e.g. instruction fetch, instruction decoding, etc.). We designed and tested a 16-bit demo core for computing Coulomb's force in an Altera Cyclone II FPGA device. To save resources, the inverse square-root cube operation in our design is computed using a memory look-up table addressed with nine to ten most significant non-zero bits. At 200 MHz internal clock, our demo core reaches a throughput of 200 M pairs/s/core, faster than a typical 2 GHz micro-processor by about a factor of 10. Temperature and power consumption of FPGAs were also lower than those of micro-processors. Fast and convenient, FPGAs can serve as alternatives to time-consuming micro-processors for space charge simulation.

  8. Neutronic analyses and tools development efforts in the European DEMO programme

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, U., E-mail: ulrich.fischer@kit.edu [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Bachmann, C. [European Fusion Development Agreement (EFDA), Garching (Germany); Bienkowska, B. [Association IPPLM-Euratom, IPPLM Warsaw/INP Krakow (Poland); Catalan, J.P. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Drozdowicz, K.; Dworak, D. [Association IPPLM-Euratom, IPPLM Warsaw/INP Krakow (Poland); Leichtle, D. [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Fusion for Energy (F4E), Barcelona (Spain); Lengar, I. [MESCS-JSI, Ljubljana (Slovenia); Jaboulay, J.-C. [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Lu, L. [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Moro, F. [Associazione ENEA-Euratom, ENEA Fusion Division, Frascati (Italy); Mota, F. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (CIEMAT), Madrid (Spain); Sanz, J. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Szieberth, M. [Budapest University of Technology and Economics (BME), Budapest (Hungary); Palermo, I. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas (CIEMAT), Madrid (Spain); Pampin, R. [Fusion for Energy (F4E), Barcelona (Spain); Porton, M. [Euratom/CCFE Fusion Association, Culham Science Centre for Fusion Energy (CCFE), Culham (United Kingdom); Pereslavtsev, P. [Association KIT-Euratom, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Ogando, F. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Rovni, I. [Budapest University of Technology and Economics (BME), Budapest (Hungary); and others

    2014-10-15

    Highlights: •Evaluation of neutronic tools for application to DEMO nuclear analyses. •Generation of a DEMO model for nuclear analyses based on MC calculations. •Nuclear analyses of the DEMO reactor equipped with a HCLL-type blanket. -- Abstract: The European Fusion Development Agreement (EFDA) recently launched a programme on Power Plant Physics and Technology (PPPT) with the aim to develop a conceptual design of a fusion demonstration reactor (DEMO) addressing key technology and physics issues. A dedicated part of the PPPT programme is devoted to the neutronics which, among others, has to define and verify requirements and boundary conditions for the DEMO systems. The quality of the provided data depends on the capabilities and the reliability of the computational tools. Accordingly, the PPPT activities in the area of neutronics include both DEMO nuclear analyses and development efforts on neutronic tools including their verification and validation. This paper reports on first neutronics studies performed for DEMO, and on the evaluation and further development of neutronic tools.

  9. Automatic demand response referred to electricity spot price. Demo description

    International Nuclear Information System (INIS)

    This report presents background, technical solution and results from a test project (Demo I) developed in the DRR Norway) project. Software and technology from two different vendors, APAS and Powel ASA, are used to demonstrate a scheme for Automatic Demand Response (ADR) referred to spot price level and a system for documentation of demand response and cost savings. Periods with shortage of energy supply and hardly any investments in new production capacity have turned focus towards the need for increased price elasticity on the demand side in the Nordic power market. The new technology for Automatic Meter Reading (AMR) and Remote Load Control (RLC) provides an opportunity to improve the direct market participation from the demand side by introducing automatic schemes that reduce the need for customer attention to hourly market prices. The low prioritized appliances, and not the total load, are in this report defined as the Demand Response Objects, based on the assumption that there is a limit for what the customers are willing to pay for different uses of electricity. Only disconnection of residential water heaters is included in the demo, due to practical limitations. The test was performed for a group of single family houses over a period of 2 months. All the houses were equipped with a radio controlled 'Ebox' unit attached to the water heater socket. The settlement and invoicing were based on hourly metered values (kWh/h), which means that the customer benefit is equivalent to the accumulated changes in the electricity cost per hour. The actual load reduction is documented by comparison between the real meter values for the period and a reference curve. The curves show significant response to the activated control in the morning hours. In the afternoon it is more difficult to register the response, probably due to 'disturbing' activities like cooking etc. Demo I shows that load reduction referred to spot price level can be done in a smooth way. The experiences

  10. Beyond ITER: neutral beams for a demonstration fusion reactor (DEMO) (invited).

    Science.gov (United States)

    McAdams, R

    2014-02-01

    In the development of magnetically confined fusion as an economically sustainable power source, International Tokamak Experimental Reactor (ITER) is currently under construction. Beyond ITER is the demonstration fusion reactor (DEMO) programme in which the physics and engineering aspects of a future fusion power plant will be demonstrated. DEMO will produce net electrical power. The DEMO programme will be outlined and the role of neutral beams for heating and current drive will be described. In particular, the importance of the efficiency of neutral beam systems in terms of injected neutral beam power compared to wallplug power will be discussed. Options for improving this efficiency including advanced neutralisers and energy recovery are discussed.

  11. Recursive Learning through Demos: Using Public Demonstrations of Technology as Project Management Tools

    OpenAIRE

    Rosental, Claude

    2015-01-01

    This paper shows how public demonstrations of technology ('demos') are used within various institutions as tools for high-tech project management, and more particularly for recursive learning. My argument is based on the results of surveys I have carried out in recent years in several European and US institutions of the use of demos for the development of technological devices, such as computer software. Demos are not simply used as ways to promote or sell products in the vein of Steve Jobs'f...

  12. A study on the gaps and pathways to a fusion DEMO

    International Nuclear Information System (INIS)

    An exploratory study on gaps and pathways to a fusion demonstration plant of Korea (K-DEMO) has been carried out by referring to the frame of references developed based on the postulation of the commonalities of a fusion power plant with the nuclear power plants (NPPs) in the design process and methodologies, and operational characteristics. In the pathways to K-DEMO, cross-cuttings with the fusion R&D activities of the other countries and utilizing the commonalities with the NPPs are discussed with the provision of open-innovation strategy that is one of the key strategies of K-DEMO program. (author)

  13. Recent ASDEX Upgrade research in support of ITER and DEMO

    DEFF Research Database (Denmark)

    Zohm, H.; Ahn, J.; Aho-Mantila, L.;

    2015-01-01

    and wave number show that an increase of R/LTe introduced by off-axis electron cyclotron resonance heating (ECRH) mainly increases the large scale fluctuations. The radial variation of the fluctuation level is in agreement with simulations using the GENE code. Fast particles are shown to undergo classical...... slowing down in the absence of large scale magnetohydrodynamic (MHD) events and for low heating power, but show signs of anomalous radial redistribution at large heating power, consistent with a broadened off-axis neutral beam current drive current profile under these conditions. Neoclassical tearing mode...... of radiated power during MGI mitigation. Concerning power exhaust, the partially detached ITER divertor scenario has been demonstrated at Psep/R = 10 MW m−1 in ASDEX Upgrade, with a peak time averaged target load around 5 MW m−2, well consistent with the component limits for ITER. Developing this towards DEMO...

  14. NEXT-DEMO: a prototype for the NEXT experiment

    CERN Document Server

    Ferrario, Paola

    2012-01-01

    NEXT is a high-pressure (10-15 bar) xenon Time Projection Chamber dedicated to neutrinoless double beta decay searches. NEXT-DEMO is a large prototype of the NEXT experiment, constructed to demonstrate the feasibility of the NEXT detector concept, in particular the capability of the TPC to achieve an optimal energy resolution at the Xe Qbb energy (2.458 MeV). It has been operating at IFIC, in Valencia, for one year and a half and a number of results has been achieved. Recently, the reflector panels of the prototype have been coated with a wavelength shifter (TPB), in order to improve light collection. We have obtained an energy resolution of 2.3% FWHM at 511 keV, using Na-22 radioactive sources, corresponding to 1% FWHM once extrapolated to Qbb.

  15. NEXT-DEMO: a prototype for the NEXT experiment

    Science.gov (United States)

    Ferrario, P.

    2012-11-01

    NEXT is a high-pressure (10-15 bar) xenon Time Projection Chamber dedicated to neutrinoless double beta decay searches. NEXT-DEMO is a large prototype of the NEXT experiment, constructed to demonstrate the feasibility of the NEXT detector concept, in particular the capability of the TPC to achieve an optimal energy resolution at the Xe Qββ energy (2.458 MeV). It has been operating at IFIC, in Valencia, for one year and a half and a number of results has been achieved. Recently, the reflector panels of the prototype have been coated with a wavelength shifter (TPB), in order to improve light collection. We have obtained an energy resolution of 2.3% FWHM at 511 keV, using Na-22 radioactive sources, corresponding to 1% FWHM once extrapolated to Qββ.

  16. Pre-conceptual Design Assessment of DEMO Remote Maintenance

    CERN Document Server

    Loving, A; Sykes, N; Iglesias, D; Coleman, M; Thomas, J; Harman, J; Fischer, U; Sanz, J; Siuko, M; Mittwollen, M; others,

    2013-01-01

    EDFA, as part of the Power Plant Physics and Technology programme, has been working on the pre-conceptual design of a Demonstration Power Plant (DEMO). As part of this programme, a review of the remote maintenance strategy considered maintenance solutions compatible with expected environmental conditions, whilst showing potential for meeting the plant availability targets. A key finding was that, for practical purposes, the expected radiation levels prohibit the use of complex remote handling operations to replace the first wall. In 2012/13, these remote maintenance activities were further extended, providing an insight into the requirements, constraints and challenges. In particular, the assessment of blanket and divertor maintenance, in light of the expected radiation conditions and availability, has elaborated the need for a very different approach from that of ITER. This activity has produced some very informative virtual reality simulations of the blanket segments and pipe removal that are exceptionally ...

  17. Demo III: Department of Defense testbed for unmanned ground mobility

    Science.gov (United States)

    Shoemaker, Chuck M.; Bornstein, Jonathan A.; Myers, Scott D.; Brendle, Bruce E., Jr.

    1999-07-01

    Robotics has been identified by numerous recent Department of Defense (DOD) studies as a key enabling technology for future military operational concepts. The Demo III Program is a multiyear effort encompassing technology development and demonstration on testbed platforms, together with modeling simulation and experimentation directed toward optimization of operational concepts to employ this technology. Primary program focus is the advancement of capabilities for autonomous mobility through unstructured environments, concentrating on both perception and intelligent control technology. The scout mission will provide the military operational context for demonstration of this technology, although a significant emphasis is being placed upon both hardware and software modularity to permit rapid extension to other military missions. The Experimental Unmanned Vehicle (XUV) is a small (approximately 1150 kg, V-22 transportable) technology testbed vehicle designed for experimentation with multiple military operational concepts. Currently under development, the XUV is scheduled for roll-out in Summer 1999, with an initial troop experimentation to be conducted in September 1999. Though small, and relatively lightweight, modeling has shown the chassis capable of automotive mobility comparable to the current Army lightweight high-mobility, multipurpose, wheeled vehicle (HMMWV). The XUV design couples multisensor perception with intelligent control to permit autonomous cross-country navigation at speeds of up to 32 kph during daylight and 16 kph during hours of darkness. A small, lightweight, highly capable user interface will permit intuitive control of the XUV by troops from current-generation tactical vehicles. When it concludes in 2002, Demo III will provide the military with both the technology and the initial experience required to develop and field the first generation of semi-autonomous tactical ground vehicles for combat, combat support, and logistics applications.

  18. DEMO design activities in the broader approach under Japan/EU collaboration

    Energy Technology Data Exchange (ETDEWEB)

    Okano, Kunihiko, E-mail: okano-k@z2.keio.jp [International Fusion Energy Research Centre (IFERC) for Broader Approach, Rokkasho (Japan); Federici, Gianfranco [Power Plant Physics and Technology, European Fusion Development Agreement (EFDA), Garching (Germany); Tobita, Kenji [Fusion Research and Development Directorate, Japan Atomic Energy Agency (JAEA), Rokkasho (Japan)

    2014-10-15

    The DEMO design studies in the BA (broader approach in the field of fusion energy) are being conducted by the DEMO Design Activity unit of International Fusion Energy Research Centre for the broader approach (BA) and the Home Teams in EU and Japan since 2011. The activity covers most of the critical issues on the DEMO design. Emphasis during the last two years was on studies to develop the best embodiment of a tokamak as a power reactor consistent with credible operating scenarios and feasible engineering solutions to critical design issues. The technical activities have focused on, for example, plasma physics for DEMO plants, divertor physics and technology, in-vessel components, maintenance schemes and safety research.

  19. Effect on the Tritium Breeding Ratio for a distributed ICRF antenna in a DEMO reactor

    OpenAIRE

    Garcia Perez, Albert

    2015-01-01

    This thesis reports results of MCNP-5 calculations, with the nuclear data library FENDL-2.1, to assess the effect on the Tritium Breeding Ratio (TBR) when integrating a distributed Ion Cyclotron Range of Frequencies (ICRF) antenna in the blanket of a DEMO fusion power reactor. Apart from a representative final configuration of both the antenna and the DEMO reactor, a parametric analysis is done on the parameters which most strongly affect the TBR. These are the type of breeding blanket (Heliu...

  20. Conceptual Design of Electron Density Measurement System for DEMO-Relevant Helical Plasmas

    OpenAIRE

    Akiyama, Tsuyoshi; YASUHARA, Ryo; TOKUZAWA, Tokihiko; ISOBE Mitsutaka; KAWAHATA, Kazuo; NAKAYAMA, Kazuya; OKAJIMA, Shigeki

    2012-01-01

    Electron density measurement remains indispensable to control fueling on a DEMO reactor. For steady-state operation of the DEMO reactor, density measurement should be highly reliable and accurate. A dispersion interferometer and a Faraday polarimeter are free from measurement errors caused by mechanical vibrations. Hence combination of the two diagnostics yields a suitable system for density measurement on future steady-state fusion reactors. A wavelength around 1 µm is one of the desirable c...

  1. Demo board for a DALI router system (Helvar) : Extended capabilities of basic DALI

    OpenAIRE

    Gimenez, Juan

    2014-01-01

    In this project, a demo board to introduce DALI lighting control protocol in a learning environment was constructed. The core of the demo system is a Helvar router that provides several extra capabilities to basic DALI installations. Thus, the aim was to create an arrangement that could help students to get an insight and experiment with DALI systems, extending its scope to non-DALI devices. With this approach, the system is able to provide full integration of different lighting installations...

  2. Tritium production assessment for the DCLL EUROfusion DEMO

    Science.gov (United States)

    Palermo, Iole; Rapisarda, David; Fernández-Berceruelo, Iván; Ibarra, Angel

    2016-10-01

    The viability of a fusion reactor is preeminently conditioned by the tritium self-sufficiency. An assessment of different parameters representing the tritium production, as the tritium breeding ratio (TBR), the tritium production rate (TPR) density and their poloidal and radial variations along the PbLi breeder zones has been performed for the last DCLL DEMO designs developed in the frame of the EUROfusion Programme. The final overall value of 1.104 obtained allows accomplishing the fuel self-sufficiency requirement. This TBR value includes not only the contribution of the breeding blanket (BB) modules but also of the back supporting structure (BSS). The BSS design resulted fundamental to reach the 1.1 criterion. Lastly, the influence of the integration in the reactor of the heating and current drive (H&CD) systems that will penetrate the breeder volume has been evaluated. Assuming different configurations for them, the TBR loss has been determined. All the calculations have entailed the use of the particle transport Monte Carlo code MCNP5.

  3. Engineering options for the U.S. Fusion Demo

    Energy Technology Data Exchange (ETDEWEB)

    Tillack, M.S. [Univ. of California, San Diego, La Jolla, CA (United States). Fusion Energy Research Program; Billone, M.; Sze, D.K. [Argonne National Lab., IL (United States); El-Guebaly, L. [Univ. of Wisconsin, Madison, WI (United States). Fusion Technology Inst.; Waganer, L.M. [McDonnell Douglas Aerospace, St. Louis, MO (United States); Wong, C. [General Atomics, San Diego, CA (United States)

    1995-12-31

    Through its successful operation, the US Fusion Demo must be sufficiently convincing that a utility or independent power producer will choose to purchase one as its next electric generating plant. A fusion power plant which is limited to the use of currently-proven technologies is unlikely to be sufficiently attractive to a utility unless fuel shortages and regulatory restrictions are far more crippling to competing energy sources than currently anticipated. In that case, the task of choosing an appropriate set of engineering technologies today involves trade-offs between attractiveness and technical risk. The design space for an attractive tokamak fusion power core is not unlimited; previous studies have shown that advanced low-activation ferritic steel, vanadium alloy, or SiC/SiC composites are the only candidates the authors have for the primary in-vessel structural material. An assessment of engineering design options has been performed using these three materials and the associated in-vessel component designs which are compatible with them.

  4. Engineering options for the U.S. Fusion Demo

    Energy Technology Data Exchange (ETDEWEB)

    Tillack, M.S. [Univ. of California, San Diego, CA (United States). Fusion Energy Research Program; Billone, M.; Sze, D.K. [Argonne National Lab., IL (United States); El-Guebaly, L. [Univ. of Wisconsin, Madison, WI (United States). Fusion Technology Inst.; Waganer, L.M. [McDonnell Douglas Aerospace, St. Louis, MO (United States); Wong, C. [General Atomics, San Diego, CA (United States)

    1996-10-01

    Through its successful operation, the US Fusion Demo must be sufficiently convincing that a utility or independent power producer will choose to purchase one as its next electric generating plant. A fusion power plant which is limited to the use of currently-proven technologies is unlikely to be sufficient attractive to a utility unless fuel shortages and regulatory restrictions are far more crippling to competing energy sources than currently anticipated. In that case, the task of choosing an appropriate set of engineering technologies today involves trade-offs between attractiveness and technical risk. The design space for an attractive tokamak fusion power core is not unlimited; previous studies have shown that advanced low-activation ferritic steel, vanadium alloy, or SiC/SiC composites are the only candidates they have for the primary in-vessel structural material. An assessment of engineering design options has been performed using these three materials and the associated in-vessel component designs which are compatible with them.

  5. Optical modeling of the Jefferson Laboratory IR demo FEL

    Science.gov (United States)

    Neil, George R.; Benson, Stephen V.; Shinn, Michelle D.; Davidson, Paul C.; Kloeppel, Peter K.

    1997-05-01

    The Thomas Jefferson National Accelerator Facility (formerly known as CEBAF) has embarked on the construction of a 1 kW free-electron laser operating initially at 3 microns that is designed for laser-material interaction experiments and to explore the feasibility of scaling the system in power and wavelength for industrial and Navy defense applications. The accelerator system for this IR demo includes a 10 MeV photocathode-based injector, a 32 MeV CEBAF-style superconducting radio-frequency linac, and single-pass transport which accelerates the beam from injector to wiggler, followed by energy-recovery deceleration to a dump. The electron and optical beam time structure in the design consists of a train of picosecond pulses at 37.425 MHz pulse repetition rate. The initial optical configuration is a conventional near-concentric resonator with transmissive outcoupling. Future upgrades of the system will increase the power and shorten the operating wavelength, and utilize a more advanced resonator system capable of scaling to high powers. The optical system of the laser has been modeled using the GLADR code by using a Beer's-law region to mimic the FEL interaction. Effects such as mirror heating have been calculated and compared with analytical treatments. The magnitude of the distortion for several materials and wavelengths has been estimated. The advantages as well as the limitations of this approach are discussed.

  6. Scoping Studies for NBI Launch Geometries on DEMO

    CERN Document Server

    Jenkins, I; Keeling, D L; Surrey, E

    2014-01-01

    Scans of Neutral Beam Injection (NBI) tangency radii and elevation on two possible DEMO scenarios have been performed with two beam energies, 1.5MeV and 1.0MeV, in order to determine the most favourable options for Neutral Beam Current Drive (NBCD) efficiency. In addition, a method using a genetic algorithm has been used to seek optimised solutions of NBI source locations and powers to synthesize a target total plasma driven-current profile. It is found that certain beam trajectories may be proscribed by limitations on shinethrough onto the vessel wall. This may affect the ability of NBCD to extend the duration of a pulse in a scenario where it must complement the induced plasma current. Operating at the lower beam energy reduces the restrictions due to shinethrough and is attractive for technical reasons, but in the scenarios examined here this results in a spatial broadening of the NBCD profile, which may make it more challenging to achieve desired total driven-current profiles.

  7. Study on containment safety systems for Korean fusion DEMO plant

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Kyemin; Kang, Myoung-suk [Kyung Hee University, Yongin-si, Gyeonggi-do 446-701 (Korea, Republic of); Heo, Gyunyoung, E-mail: gheo@khu.ac.kr [Kyung Hee University, Yongin-si, Gyeonggi-do 446-701 (Korea, Republic of); Lee, Young-seok; Kim, Hyoung-chan [National Fusion Research Institute, Daejeon-si 305-333 (Korea, Republic of); Moon, Young Tae [KEPCO Engineering and Construction Company, Inc., Yongin-si, Gyeonggi-do 446-713 (Korea, Republic of)

    2013-10-15

    The purpose of this study is to review the strategy for radiation barriers in the fusion power plants and to produce simulation data for the conceptual design of safety features to maintain the integrity of such barriers as a part of R and D program through the National Fusion Research Institute of Korea. Even though the amount of radioactive source term in fusion power plants should be much less than that of fission power plants, internal as well as external events can result in damage to facilities such that public can be critically exposed by radiation. In the first part of this study, we reviewed and compared the multiple defenses to protect radioactive hazard in fission and fusion power plants. Containment was characterized as an indispensable physical barrier and the integrity of containment particularly enveloping a fuel cycle which is a major radioactive source term, tritium, should be secured. Since water is assumed as one of the coolant options in the Korean fusion DEMO plant, the thermo-hydraulic analysis was carried out using computer simulations to produce key parameters related with the integrity of containment in the second part. The performance of both of active and passive safety features to control the key parameters was compared to take recent fission technologies into account.

  8. Pre-conceptual design assessment of DEMO remote maintenance

    Energy Technology Data Exchange (ETDEWEB)

    Loving, A., E-mail: antony.loving@ccfe.ac.uk [EURATOM/Culham Center Fusion Energy, Culham Science Centre, OX14 3DB, Abingdon (United Kingdom); Crofts, O.; Sykes, N.; Iglesias, D.; Coleman, M.; Thomas, J. [EURATOM/Culham Center Fusion Energy, Culham Science Centre, OX14 3DB, Abingdon (United Kingdom); Harman, J. [EFDA Close Support Unit Garching, Boltzmannstaße 2, D-85748 Garching Bei München (Germany); Fischer, U. [Karlsruhe Institute of Technology, Institute for Neutron Physics and Reactor Technology, Hermann-von-Helmholtz-Platz 1, D-76344 Eggenstein-Leopoldshafen (Germany); Sanz, J. [Instituto de Fusión Nuclear/UPM, Madrid (Spain); Siuko, M. [VTT Technical Research Centre of Finland, P.O. Box 1000, FI-02044 VTT (Finland); Mittwollen, M. [Karlsruhe Institute of Technology, Institut für Fördertechnik und Logistiksysteme, Gotthard-Franz-Straße 8, Geb.50.38, 76131 Karlsruhe (Germany)

    2014-10-15

    EDFA, as part of the Power Plant Physics and Technology programme, has been working on the pre-conceptual design of a Demonstration Power Plant (DEMO). As part of this programme, a review of the remote maintenance strategy considered maintenance solutions compatible with expected environmental conditions, whilst showing potential for meeting the plant availability targets. A key finding was that, for practical purposes, the expected radiation levels prohibit the use of complex remote handling operations to replace the first wall. In 2012/2013, these remote maintenance activities were further extended, providing an insight into the requirements, constraints and challenges. In particular, the assessment of blanket and divertor maintenance, in light of the expected radiation conditions and availability, has elaborated the need for a very different approach from that of ITER. This activity has produced some very informative virtual reality simulations of the blanket segments and pipe removal that are exceptionally valuable in communicating the complexity and scale of the required operations. Through these simulations, estimates of the maintenance task durations have been possible demonstrating that a full replacement of the blankets within 6 months could be achieved. The design of the first wall, including the need to use sacrificial limiters must still be investigated. In support of the maintenance operations, a first indication of the requirements of an Active Maintenance Facility (AMF) has been elaborated.

  9. UAS-NAS Project Demo - Mini HITL Week 2 Stats

    Science.gov (United States)

    Murphy, James R.; Fern, Lisa C.; Rorie, Robert C.; Shively, Robert; Jovic, Srboljub

    2016-01-01

    The UAS-NAS Project demo will showcase recent research efforts to ensure the interoperability between proposed UAS detect and avoid (DAA) human machine interface requirements (developed within RTCA SC-228) and existing collision avoidance displays. Attendees will be able to view the current state of the art of the DAA pilot traffic, alerting and guidance displays integrated with Traffic advisory and Collision Avoidance (TCAS) II in the UAS-NAS Project's research UAS ground control station (developed in partnership with the Air Force Research Laboratory). In addition, attendees will have the opportunity to interact with the research UAS ground control station and "fly" encounters, using the DAA and TCAS II displays to avoid simulated aircraft. The display of the advisories will be hosted on a laptop with an external 30" monitor, running the Vigilant Spirit system. DAA advisories will be generated by the JADEM software tool, connected to the system via the LVC Gateway. A repeater of the primary flight display will be shown on a 55" monitor mounted on a stand at the back of the booth to show the pilot interaction to the passersby.

  10. Pre-conceptual design assessment of DEMO remote maintenance

    International Nuclear Information System (INIS)

    EDFA, as part of the Power Plant Physics and Technology programme, has been working on the pre-conceptual design of a Demonstration Power Plant (DEMO). As part of this programme, a review of the remote maintenance strategy considered maintenance solutions compatible with expected environmental conditions, whilst showing potential for meeting the plant availability targets. A key finding was that, for practical purposes, the expected radiation levels prohibit the use of complex remote handling operations to replace the first wall. In 2012/2013, these remote maintenance activities were further extended, providing an insight into the requirements, constraints and challenges. In particular, the assessment of blanket and divertor maintenance, in light of the expected radiation conditions and availability, has elaborated the need for a very different approach from that of ITER. This activity has produced some very informative virtual reality simulations of the blanket segments and pipe removal that are exceptionally valuable in communicating the complexity and scale of the required operations. Through these simulations, estimates of the maintenance task durations have been possible demonstrating that a full replacement of the blankets within 6 months could be achieved. The design of the first wall, including the need to use sacrificial limiters must still be investigated. In support of the maintenance operations, a first indication of the requirements of an Active Maintenance Facility (AMF) has been elaborated

  11. Phase transition between the Bragg Glass and a disordered Phase in Nb3Sn, detected by 3rd harmonics of the AC magnetic susceptibility

    OpenAIRE

    Adesso, Maria G.; Uglietti, Davide; Flukiger, Rene; Polichetti, Massimiliano; Pace, Sandro

    2005-01-01

    We report additional experimental evidences about the presence of an universal behavior in the Field-Temperature Phase Diagram of Type II Superconductors. This behavior is characterized by a phase transition in the vortex matter between the disordered and the Bragg Glass phase. The experimental detection of a Peak Effect phenomenon has been proved to be strictly connected to the existence of this phase transition. In this paper, we show the first observation of a Peak Effect in the compound N...

  12. Safety studies on Korean fusion DEMO plant using integrated safety assessment methodology

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Kyemin; Kang, Myoung-suk [Kyung Hee University, Youngin-si, Gyeonggi-do 446-701 (Korea, Republic of); Heo, Gyunyoung, E-mail: gheo@khu.ac.kr [Kyung Hee University, Youngin-si, Gyeonggi-do 446-701 (Korea, Republic of); Kim, Hyoung-chan [National Fusion Research Institute, Daejeon-si 305-333 (Korea, Republic of)

    2014-10-15

    Highlights: •The purpose of this paper is to suggest methodology that can investigate safety issues and provides a case study for Korean fusion DEMO plant. •The concepts of integrated safety assessment methodology (ISAM) that can be applied in addressing regulatory requirements and recognizing safety issues for K-DEMO were emphasized. •Phenomena identification and ranking table (PIRT) was proposed. It can recognize vulnerabilities of systems and identify the gaps in technical areas requiring additional researches. •This work is expected to contribute on the conceptual design of safety features for K-DEMO to design engineers and the guidance for regulatory requirements to licensers. -- Abstract: The purpose of this paper is to suggest methodology that can investigate safety issues and provides a case study for Korean fusion DEMO plant (K-DEMO) as a part of R and D program through the National Fusion Research Institute of Korea. Even though nuclear regulation and licensing framework is well setup due to the operating and design experience of Pressurized Water Reactors (PWRs) since 1970s, the regulatory authority of South Korea has concerns on the challenge of facing new nuclear facilities including K-DEMO due to the differences in systems, materials, and inherent safety feature from conventional PWRs. Even though the follow-up of the ITER license process facilitates to deal with significant safety issues of fusion facilities, a licensee as well as a licenser should identify the gaps between ITER and DEMO in terms of safety issues. First we reviewed the methods of conducting safety analysis for unprecedented nuclear facilities such as Generation IV reactors, particularly very high temperature reactor (VHTR), which is called as integrated safety assessment methodology (ISAM). Second, the analysis for the conceptual design of K-DEMO on the basis of ISAM was conducted. The ISAM consists of five analytical tools to develop the safety requirements from licensee

  13. Thermal Analysis on Conceptual K-DEMO Breeding Blanket on parallel flow configuration

    International Nuclear Information System (INIS)

    The feasibility study consists the design guidelines and requirements for the K-DEMO(the Korean Fusion DEMOnstration reactor). It is possible to design flexible and realistic concepts of the demonstration fusion power plant. As a part of the NFRI research, Seoul National University (SNU) is conducting thermal design, evaluation and validation of the breeding blanket for the K-DEMO reactor. Recently, a new breeding blanket concept has been proposed for the K-DEMO reactor, and preliminary feasibility studies are actively ongoing. Design concept of parallel plate-type blanket of K-DEMO and thermal limits on components was identified, in this study. It was concluded that an acceptable thermal design was achieved in the proposed breeding blanket design. However, some design improvements in the geometry of the breeding blanket are ongoing. In aspect of pressure drop and outlet temperature, some analysis need to be conducted. Stage of study on the K-DEMO reactor is in the preliminary concept definition

  14. Modeling an unmitigated thermal quench event in a large field magnet in a DEMO reactor

    International Nuclear Information System (INIS)

    The superconducting magnet systems of future fusion reactors, such as a Demonstration Power Plant (DEMO), will produce magnetic field energies in the 10 s of GJ range. The release of this energy during a fault condition could produce arcs that can damage the magnets of these systems. The public safety consequences of such events must be explored for a DEMO reactor because the magnets are located near the DEMO's primary radioactive confinement barrier, the reactor's vacuum vessel (VV). Great care will be taken in the design of DEMO's magnet systems to detect and provide a rapid field energy dump to avoid any accidents conditions. During an event when a fault condition proceeds undetected, the potential of producing melting of the magnet exists. If molten material from the magnet impinges on the walls of the VV, these walls could fail, resulting in a pathway for release of radioactive material from the VV. A model is under development at Idaho National Laboratory (INL) called MAGARC to investigate the consequences of this accident in a large toroidal field (TF) coil. Recent improvements to this model are described in this paper, along with predictions for a DEMO relevant event in a toroidal field magnet

  15. Concept for a vertical maintenance remote handling system for multi module blanket segments in DEMO

    International Nuclear Information System (INIS)

    Highlights: •A conceptual architectural model for a vertical maintenance DEMO is presented. •Novel concepts for a set of DEMO remote handling equipment are put forward. •Remote maintenance of a multi module segment blanket is found to be feasible. •The criticality of space in the vertical port is highlighted. -- Abstract: The anticipated high neutron flux, and the consequent damage to plasma-facing components in DEMO, results in the need to regularly replace the tritium breeding and radiation shielding blanket. The current European multi module segment (MMS) blanket concept favours a less invasive small port entry maintenance system over large sector transport concepts, because of the reduced impact on other tokamak systems – particularly the magnetic coils. This paper presents a novel conceptual remote maintenance strategy for a Vertical Maintenance Scheme DEMO, incorporating substantiated designs for an in-vessel mover, to detach and attach the blanket segments, and cask-housed vertical maintenance devices to open and close access ports, cut and join service connections, and extract blanket segments from the vessel. In addition, a conceptual architectural model for DEMO was generated to capture functional and spatial interfaces between the remote maintenance equipment and other systems. Areas of further study are identified in order to comprehensively establish the feasibility of the proposed maintenance system

  16. Design concept of K-DEMO for near-term implementation

    Science.gov (United States)

    Kim, K.; Im, K.; Kim, H. C.; Oh, S.; Park, J. S.; Kwon, S.; Lee, Y. S.; Yeom, J. H.; Lee, C.; Lee, G.-S.; Neilson, G.; Kessel, C.; Brown, T.; Titus, P.; Mikkelsen, D.; Zhai, Y.

    2015-05-01

    A Korean fusion energy development promotion law (FEDPL) was enacted in 2007. As a following step, a conceptual design study for a steady-state Korean fusion demonstration reactor (K-DEMO) was initiated in 2012. After the thorough 0D system analysis, the parameters of the main machine characterized by the major and minor radii of 6.8 and 2.1 m, respectively, were chosen for further study. The analyses of heating and current drives were performed for the development of the plasma operation scenarios. Preliminary results on lower hybrid and neutral beam current drive are included herein. A high performance Nb3Sn-based superconducting conductor is adopted, providing a peak magnetic field approaching 16 T with the magnetic field at the plasma centre above 7 T. Pressurized water is the prominent choice for the main coolant of K-DEMO when the balance of plant development details is considered. The blanket system adopts a ceramic pebble type breeder. Considering plasma performance, a double-null divertor is the reference configuration choice of K-DEMO. For a high availability operation, K-DEMO incorporates a design with vertical maintenance. A design concept for K-DEMO is presented together with the preliminary design parameters.

  17. Tritium Cycle Design for He-cooled Blankets for Demo

    Energy Technology Data Exchange (ETDEWEB)

    Sedano, L. A.

    2007-09-27

    Final goal of COMPU task is to develop a reliable tritium Process Flow Diagram (PFD) modelling tool for DEMO tritium cycle. With this aim, the COMPU task is devoted to: (1) Review of existing available documentation related on configuration layouts, and systems and tritium control process key technologies. (2) To select those validated and considered relevant as basis for code development. (3) Implement results from (1), and (2) in the PFD TRICICLO. This fi rst deliverable focuses on item (1) and is conceived as a managerial tool to: (1) establish and discuss the correct inputs, (2) to identify existing lack of basic information and (3) to establish the general demands and characteristics for the development of an advanced PFD model. Thus, in order to discuss and determine the basic information required for future new developments of the task, this report presents a review of the documentation of: (1) The outline of total cycle and system configuration with the main tritium system design specifications. (2) The ultimate processing technologies with the associated design of their implementing units. (3) Key parameters needed to describe processes and modes of operation of the system units. (4) An overview of the existing models for cycle and units with a general analysis of their performances and limitations. Thus, this report is a direct review of the base information generated previously in the context of tasks of the EU FT Programmers (reported in EFDA Green Books) and available results in open fields literature provided by parallel Programmes abroad (JP, US, RF). (Author) 102 refs.

  18. Tritium Cycle Design for He-cooled Blankets for Demo

    International Nuclear Information System (INIS)

    Final goal of COMPU task is to develop a reliable tritium Process Flow Diagram (PFD) modelling tool for DEMO tritium cycle. With this aim, the COMPU task is devoted to: (1) Review of existing available documentation related on configuration layouts, and systems and tritium control process key technologies. (2) To select those validated and considered relevant as basis for code development. (3) Implement results from (1), and (2) in the PFD TRICICLO. This fi rst deliverable focuses on item (1) and is conceived as a managerial tool to: (1) establish and discuss the correct inputs, (2) to identify existing lack of basic information and (3) to establish the general demands and characteristics for the development of an advanced PFD model. Thus, in order to discuss and determine the basic information required for future new developments of the task, this report presents a review of the documentation of: (1) The outline of total cycle and system configuration with the main tritium system design specifications. (2) The ultimate processing technologies with the associated design of their implementing units. (3) Key parameters needed to describe processes and modes of operation of the system units. (4) An overview of the existing models for cycle and units with a general analysis of their performances and limitations. Thus, this report is a direct review of the base information generated previously in the context of tasks of the EU FT Programmers (reported in EFDA Green Books) and available results in open fields literature provided by parallel Programmes abroad (JP, US, RF). (Author) 102 refs

  19. Conceptual study of vertical sector transport maintenance for DEMO fusion reactor

    International Nuclear Information System (INIS)

    The maintenance scheme is a critical issue for DEMO design, and requires high availability of the reactor. The SlimCS, designed in JAEA, adopts the horizontal sector transport hot cell maintenance scheme. In order to determine the most appropriate DEMO reactor maintenance scheme, it is important to assess the various maintenance schemes. In this paper the vertical sector transport maintenance concept is proposed for the first time. In the sector maintenance scheme, the amount of cutting/re-welding of the piping is minimized. The sector including blanket modules and a high-temperature shield was divided into 10° segments in a toroidal direction. The sectors are designed to be removed and re-inserted through upper alternate vertical maintenance ports. In the case of the vertical sector transport maintenance scheme, inter-coil structures could be adopted for use against turnover force in toroidal field (TF) coils. This shows an advantage in DEMO maintenance compared with horizontal sector transport.

  20. Research at ITER towards DEMO: Specific reactor diagnostic studies to be carried out on ITER

    Energy Technology Data Exchange (ETDEWEB)

    Krasilnikov, A. V.; Kaschuck, Y. A.; Vershkov, V. A.; Petrov, A. A.; Petrov, V. G.; Tugarinov, S. N. [Institution Project center ITER, Moscow (Russian Federation)

    2014-08-21

    In ITER diagnostics will operate in the very hard radiation environment of fusion reactor. Extensive technology studies are carried out during development of the ITER diagnostics and procedures of their calibration and remote handling. Results of these studies and practical application of the developed diagnostics on ITER will provide the direct input to DEMO diagnostic development. The list of DEMO measurement requirements and diagnostics will be determined during ITER experiments on the bases of ITER plasma physics results and success of particular diagnostic application in reactor-like ITER plasma. Majority of ITER diagnostic already passed the conceptual design phase and represent the state of the art in fusion plasma diagnostic development. The number of related to DEMO results of ITER diagnostic studies such as design and prototype manufacture of: neutron and γ–ray diagnostics, neutral particle analyzers, optical spectroscopy including first mirror protection and cleaning technics, reflectometry, refractometry, tritium retention measurements etc. are discussed.

  1. Research at ITER towards DEMO: Specific reactor diagnostic studies to be carried out on ITER

    Science.gov (United States)

    Krasilnikov, A. V.; Kaschuck, Y. A.; Vershkov, V. A.; Petrov, A. A.; Petrov, V. G.; Tugarinov, S. N.

    2014-08-01

    In ITER diagnostics will operate in the very hard radiation environment of fusion reactor. Extensive technology studies are carried out during development of the ITER diagnostics and procedures of their calibration and remote handling. Results of these studies and practical application of the developed diagnostics on ITER will provide the direct input to DEMO diagnostic development. The list of DEMO measurement requirements and diagnostics will be determined during ITER experiments on the bases of ITER plasma physics results and success of particular diagnostic application in reactor-like ITER plasma. Majority of ITER diagnostic already passed the conceptual design phase and represent the state of the art in fusion plasma diagnostic development. The number of related to DEMO results of ITER diagnostic studies such as design and prototype manufacture of: neutron and γ-ray diagnostics, neutral particle analyzers, optical spectroscopy including first mirror protection and cleaning technics, reflectometry, refractometry, tritium retention measurements etc. are discussed.

  2. Lessons learnt from ITER safety and licensing for DEMO and future nuclear fusion facilities

    International Nuclear Information System (INIS)

    Highlights: •The ITER safety and licensing process successfully reached the stage of the granting of the authorization to construct the facility. •Despite differences between ITER and DEMO, there are lessons to be learned for DEMO safety and licensing. •A number of issues have been identified where development is required for DEMO, strategies to be decided, technical issues to be resolved. -- Abstract: One of the strong motivations for pursuing the development of fusion energy is its potentially low environmental impact and very good safety performance. But this safety and environmental potential can only be fully realized by careful design choices. For DEMO and other fusion facilities that will require nuclear licensing, S and E objectives and criteria should be set at an early stage and taken into account when choosing basic design options and throughout the design process. Studies in recent decades of the safety of fusion power plant concepts give a useful basis on which to build the S and E approach and to assess the impact of design choices. The experience of licensing ITER is of particular value, even though there are some important differences between ITER and DEMO. The ITER project has developed a safety case, produced a preliminary safety report and had it examined by the French nuclear safety authorities, leading to the licence to construct the facility. The key technical issues that arose during this process are recalled, particularly those that may also have an impact on DEMO safety. These include issues related to postulated accident scenarios, environmental releases during operation, occupational radiation exposure, and radioactive waste

  3. Cross-cutting ideas for a fusion DEMO plant with current and generation IV nuclear power plants

    International Nuclear Information System (INIS)

    The fusion DEMO program of Korea has been conceptualized to realize magnetic fusion energy with the tokamak concept at the end of 2030s or early 2040s. In this program, to expedite the development of a fusion DEMO plant, cross-cutting based on the commonalities between the fusion DEMO plant and existing systems. Among the existing systems, the current and generation IV nuclear power plants will have many areas of commonalities with the fusion DEMO plant including regulatory requirements and licensing processes, codes and standards, design methods and computational codes for thermo hydraulic analysis, and safety analysis methods. Theses commonalities will be used for discovering a pathway of resolving the nested logic dilemma incurred by the inherent first-of-a-kind nature of the fusion DEMO plant. This paper presents the result of an exploratory study on the subject cross-cutting. (author)

  4. Breeding blanket design for ITER and prototype (DEMO) fusion reactors and breeding materials issues

    Energy Technology Data Exchange (ETDEWEB)

    Takatsu, H.; Enoeda, M. [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1998-03-01

    Current status of the designs of the ITER breeding blanket and DEMO blankets is introduced placing emphasis on the breeding materials selection and related issues. The former design is based on the up-to-date design activities, as of October 1997, being performed jointly by Joint Central Team (JCT) and Home Teams (HT`s), while the latter is based on the DEMO blanket test module designs being proposed by each Party at the TBWG (Test Blanket Working Group) meetings. (J.P.N.)

  5. Progress in the RAMI analysis of a conceptual LHCD system for DEMO

    Science.gov (United States)

    Mirizzi, F.

    2014-02-01

    Reliability, Availability, Maintainability and Inspectability (RAMI) concepts and techniques, that acquired great importance during the first manned space missions, have been progressively extended to industrial, scientific and consumer equipments to assure them satisfactory performances and lifetimes. In the design of experimental facilities, like tokamaks, mainly aimed at demonstrating validity and feasibility of scientific theories, RAMI analysis has been often left aside. DEMO, the future prototype fusion reactors, will be instead designed for steadily delivering electrical energy to commercial grids, so that the RAMI aspects will assume an absolute relevance since their initial design phases. A preliminary RAMI analysis of the LHCD system for the conceptual EU DEMO reactor is given in the paper.

  6. First adaptation of the European ceramic B. I. T. blanket design to the updated DEMO specifications

    Energy Technology Data Exchange (ETDEWEB)

    Anzidei, L.; Cecchi, P.; Cevolani, S.; Gallina, M.; Petrizzi, L.; Rado, V.; Talarico, C.; Violante, V.; Vettraino, V.; Zampaglione, V. (Associazione Euratom-ENEA sulla Fusione, Frascati (Italy)); Proust, E.; Giancarli, L.; Raepsaet, X.; Szczepanski, J.; Vallette, F.; Baraer, L.; Bielak, B.; Mercier, J. (Commissariat a l' Energie Atomique, DRN/DMT/SERMA, C.E.N. Saclay, 91 - Gif-sur-Yvette (France))

    1991-12-01

    The DEMO specifications defined so as to ensure the consistency of the various blanket conceptual design studies performed within the framework of the European Test Blanket Programme have been recently updated. A very first attempt has been made to adapt the European Ceramic Breeder Inside-Tube DEMO blanket to these new specifications. Two solutions have been investigated. The first would ensure tritium self-sufficiency of the plant with a large safety margin. The other one, which fully preserves the design simplicity and reliability of the initial design, appears to be somewhat marginal from the tritium breeding capability point of view, but to offer good improvement prospects. (orig.).

  7. An analysis of AMTEC, multi-cell ground-demo for the Pluto/Express mission

    International Nuclear Information System (INIS)

    Results of recent tests of an 8-cell, AMTEC ground-demo are analyzed and the performance of individual cells compared. The ground-demo produced a peak electric power of 27 We at an output voltage of 16 V, when tested at hot and cold side temperatures of 1123 K and 553 K. The electric power output and terminal voltage of the individual cells, however, differed by as much as 25%, from 2.94 to 3.76 We, and 1.73 to 2.21 V, respectively. These variations were attributed to differences in: (a) contact resistance between electrode / BASE / current collector; (b) current (or electrons) leakage between anode and cathode electrodes through the metal-ceramic braze joint between BASE tubes and support plate; and (c) the charge-exchange polarization losses. Model's predictions compared very well with measured voltage and electric power output of individual cells and of the ground-demo. At the operating conditions for the Pluto/Express spacecraft (Thot approximately 1200 K, Tcd approximately 573 K), the best performing ground-demo cell would have delivered 5 We at an output voltage of 3 V. These values, however, are still significantly lower than those needed to meet the Pluto/Express mission power requirements (8.2 We at 3.5 V, per cell)

  8. Preliminary concept design of the divertor remote handling system for DEMO power plant

    International Nuclear Information System (INIS)

    Highlights: • Concept design of the RH system for the DEMO fusion power plant. • Divertor Mover: Hydraulic telescopic boom concept design. An alternative solution to ITER rack and pinion divertor mover (CMM). • Divertor cassettes end effector studies. • Transportation cask conceptual studies and logistic. - Abstract: This paper is based on the remote maintenance system project (WPRM) for the demonstration fusion power reactor (DEMO). Following ITER, DEMO aims to confirm the capability of generating several hundred of MW of net electricity by 2050. The main objective of these activities is to develop an efficient and reliable remote handling (RH) system for replacing the divertor cassettes. This paper presents the preliminary results of the concept design of the divertor RH system. The proposed divertor mover is a hydraulic telescopic boom driven from the transportation cask through the maintenance tunnel of the reactor. The boom is divided in three sections of 4 m each, and it is driving an end-effector in order to perform the scheduled operations of maintenance inside the vacuum vessel. Two alternative design of the end effector to grip and manipulate the divertor cassette are also presented in this work. Both the concepts are hydraulically actuated, basing on the ITER previous studies. The divertor cassette end-effector consists of a lifting arm linked to the divertor mover, a tilting plate, a cantilever arm and a hook-plate. The main objective of this paper is to illustrate the feasibility of DEMO divertor remote maintenance operations

  9. Modelling of ICRF heating in DEMO with special emphasis on bulk ion heating

    Energy Technology Data Exchange (ETDEWEB)

    Gallart, Dani, E-mail: daniel.gallart@bsc.es [Barcelona Supercomputing Center, Barcelona (Spain); Mantsinen, Mervi [Barcelona Supercomputing Center, Barcelona (Spain); Catalan Institution for Research and Advanced Studies, Barcelona (Spain); Kazakov, Yevgen [Laboratory for Plasma Physics LPP-ERM/KMS, Brussels (Belgium)

    2015-12-10

    Ion cyclotron resonance frequency (ICRF) heating is one of the auxiliary heating schemes presently envisaged for ITER and DEMO. In this paper we analyse the potential of ICRF waves to heat the fuel ions in DEMO. Our analysis is carried out for the DEMO1 Reference Scenario from October 2013 (B = 6.8 T, I = 18.6 MA, R = 9.25 m, a = 2.64 m) optimized for a maximum pulse length of 2.3 hrs using the ICRF modelling codes PION and TORIC. We focus on second harmonic heating of tritium and fundamental minority heating of {sup 3}He ions (with a few percent of {sup 3}He) in a 50%:50% D-T plasma. The dependence of the ICRF characteristics and the ICRF-accelerated ions on the ICRF and plasma parameters is investigated, giving special attention to the DEMO design point at a core plasma temperature of 30 keV and an electron density of 1.2·10{sup 20} m{sup −3}.

  10. Non-destructive examination of the bonding interface in DEMO divertor fingers

    International Nuclear Information System (INIS)

    Highlights: • SATIR tests on DEMO divertor fingers (integrating or not He cooling system). • Millimeter size artificial defects were manufactured. • Detectability of millimeter size artificial defects was evaluated. • SATIR can detect defect in DEMO divertor fingers. • Simulations are well correlated to SATIR tests. -- Abstract: Plasma facing components (PFCs) with tungsten (W) armor materials for DEMO divertor require a high heat flux removal capability (at least 10 MW/m2 in steady-state conditions). The reference divertor PFC concept is a finger with a tungsten tile as a protection and sacrificial layer brazed to a thimble made of tungsten alloy W – 1% La2O3 (WL10). Defects may be located at the W thimble to W tile interface. As the number of fingers is considerable (>250,000), it is then a major issue to develop a reliable control procedure in order to control with a non-destructive examination the fabrication processes. The feasibility for detecting defect with infrared thermography SATIR test bed is presented. SATIR is based on the heat transient method and is used as an inspection tool in order to assess component heat transfer capability. SATIR tests were performed on fingers integrating or not the complex He cooling system (steel cartridge with jet holes). Millimeter size artificial defects were manufactured and their detectability was evaluated. Results of this study demonstrate that the SATIR method can be considered as a relevant non-destructive technique examination for the defect detection of DEMO divertor fingers

  11. A pilot plant as the next step toward an MFE Demo

    International Nuclear Information System (INIS)

    An assessment of Demo goals and of prerequisites for Demo readiness motivate an examination of a pilot plant: an intermediate facility designed to substantially narrow the technical gap to Demo in a next step. A pilot plant would: 1) test internal components and tritium breeding in a steady-state fusion environment, 2) prototype a maintainable design and maintenance scheme for a power plant, and 3) generate net electricity. Preconceptual designs based on the advanced tokamak (AT), spherical tokamak (ST), and compact stellarator (CS) have been developed in order to compare their relative merits as fusion systems. Any of them would take a large step toward Demo in key performance metrics, e.g. engineering gain QENG (≥1), neutron wall load (> 1 MW/m2 ), tritium breeding ratio (> 1), pulse length (106 -107 s), blanket lifetime fluence (≥ 3 MW-yr/m2), plant lifetime (6-20 MW-yr/m2), and availability (10-30%), but they differ in their associated risks. (author)

  12. Attachment system for helium-cooled blanket of RF DEMO fusion reactor

    Energy Technology Data Exchange (ETDEWEB)

    Leshukov, A. E-mail: leshu@entek.ru; Blinov, Y.; Kovalenko, V.; Shatalov, G.; Strebkov, Y.; Strizhov, A

    2002-11-01

    The development of DEMO thermonuclear reactor is a part of Russian national program on the fusion process mastering. The DEMO-S (stationary thermonuclear reactor) should be the logic continuation of the ITER-type projects (pulse thermonuclear reactors) and the prototype for commercial power plants. DEMO reactor layout suggests to use the segmented blanket with mounting/dismounting procedure through the vacuum vessel vertical ports. Taking into account this layout the blanket attachment system has been developed and the present paper is devoted to this subject. The considered attachment system includes the lower and upper toroidal support assemblies which connect all the blanket segments in the enclosed ring. In it's turn the lower support assemblies attached to the vacuum vessel through the system of hinged support pillars. The heights of support pillars for inboard and outboard blankets are selected so that to indemnify the blanket massif thermal expansions in vertical and radial directions. The support pillars have been calculated on strength taking into account the electromagnetic loads from the plasma disruptions and blanket mass. The selection of high-strength chromium steel as a structural material for the support pillars could be considered as the results of strength analysis. The conclusions on the possibility to apply this attachment system for fusion reactor blanket and the critical issues are contained in this paper too.

  13. Preliminary Estimation of Activated Corrosion Products in the Coolant System of Fusion Demo Reactor

    International Nuclear Information System (INIS)

    The second phase of the national program for fusion energy development in Korea starts from 2012 for design and construction of the fusion DEMO reactor. Radiological assessment for the fusion reactor is one of the key tasks to assure its licensability and the starting point of the assessment is determination of the source terms. As the first effort, the activities of the coolant due to activated corrosion product (ACP) were estimated. Data and experiences from fission reactors were used, in part, in the calculations of the ACP concentrations because of lack of operating experience for fusion reactors. The MCNPX code was used to determine neutron spectra and intensities at the coolant locations and the FISPACT code was used to estimate the ACP activities in the coolant of the fusion DEMO reactor. The calculated specific activities of the most nuclides in the fusion DEMO reactor coolant were 2-15 times lower than those in the PWR coolant, but the specific activities of 57Co and 57Ni were expected to be much higher than in the PWR coolant. The preliminary results of this study can be used to figure out the approximate radiological conditions and to establish a tentative set of radiological design criteria for the systems carrying coolant in the design phase of the fusion DEMO reactor.

  14. ITC18: 18th international Toki conference. Development of physics and technology of stellarators/heliotrons 'en route to DEMO'. Proceedings

    International Nuclear Information System (INIS)

    18th International Toki Conference (ITC18) was held in Toki (Japan) December 9-12 2008 organized by the National Institute for Fusion Science (NIFS). More than 150 experts in fusion research, especially in stellarator/heliotron research from Australia, Belgium, China, France, Germany, Hungary, India, Iran, Italy, Japan, Korea, Serbia, Spain, Sweden, Switzerland, and the United States of America gathered at the conference. The International Organizing Committee (IOC) chaired by O. Motojima, the International Program Committee (IPC) chaired by Y. Ogawa and the Local Organizing Committee (LOC) chaired by T. Mutoh have played the leading role in the elaboration of the scientific program of the conference. NIFS has organized the ITC as an annual meeting for fusion related sciences since its establishment in 1989. The IPC arranged 2 plenary talks, 1 review talk, 34 invited talks in addition to 109 contributed presentations including 6 oral talks. Recent developments in the experimental, theoretical and technical research show the clear route to the realization of a stellarator/heliotron type demo fusion reactor. ITC18 was devoted to review the recent developments and to discuss the next steps forward to the demo reactor realization of stellarator/heliotron type. In the conference, recent experimental results from both tokamak and stellarator/heliotron devices are reviewed and the experimental and theoretical physics of plasma confinement in toroidal devices are also discussed and confirmed that the physical base of the fusion reactor is well developed. The development of steady state operation, heating, fueling, divertors, plasma wall interaction and wall materials, advanced diagnostics for reactor relevant plasma, blanket materials as well as super conducting magnets are discussed as inevitable key physics and technologies for the DEMO reactor. Slides of all oral presentations as well as the proceedings are available at http://itc.nifs.ac.jp/. Extended papers of major

  15. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  16. DEVELOPMENT AND ASSESSMENT OF A SCORE™ DEMO2.1 THERMO-ACOUSTIC ENGINE

    Directory of Open Access Journals (Sweden)

    BAIMAN CHEN

    2013-04-01

    Full Text Available The early low-cost, wood burning Thermo-Acoustic Engine (TAE known as Demo2.0-build-1 was developed by SCORE™ at the UK Centre and was capable of achieving 22.7 Watts of electricity. This prototype was limited to an operating temperature of about 300oC and due to excessive leaks could not operate continuously above ambient pressure. To absorb a thermal heat input of 4.4 kW from the burning wood so as to fulfil the required acoustic power, the Hot Heat Exchanger (HHX requires heating to the highest possible temperature. Therefore, a corrugated stainless steel plate HHX design that maximises heating surface area was adopted to the current Demo2 TAE design. In addition, the system is often pressurised to achieve higher acoustic intensity. Rigorous sealing of the system at high temperature is also required. A Demo2.1 TAE design based on the Demo2 TAE design and its prototype which is developed recently by the SCORE™ Centre in Malaysia was successfully constructed and well integrated with the stove. During the early construction and assembly process, fabrication difficulties and serious leak problems around the HHX’s edges were found when the apparatus operated at high temperatures. This is because the uneven geometrical HHX (convolution profile makes it difficult and relatively costly to be sealed. The Demo2.1 TAE is focused on the sealing efficiency and effective manufacturing cost by meantime to allow further modification variation. The design was made to adopt the local manufacturing technologies and materials available or easy to access in Malaysia. It also aims to minimise the parasitic heat losses to lower the system onset temperature. By removing the Linear Alternator and Tuning Volume from the system, preliminary measurements shown that the apparatus was oscillating at the frequency of 70 Hz. A much lower onset temperature was observed at around 144oC for the new configuration when the apparatus was oscillating at approximately 200 Pa

  17. DemoEnvironment国际合作项目的实践经验与思考%Practice and thinking of DemoEnvironment international cooperation project

    Institute of Scientific and Technical Information of China (English)

    李兵; 李超; 程言君

    2013-01-01

    @@%通过对Biogas Optimizer in China项目管理模式、运行方式和执行经验进行分析,系统总结了瑞典国际开发署(Sida)发起的DemoEnvironment计划的项目管理特点,以期对我国技术示范项目的管理和国际合作项目的申请和执行有所帮助.

  18. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  19. Effect on the tritium breeding ratio for a distributed ICRF antenna in a DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, A., E-mail: albert.garcia.hp@gmail.com [Max-Planck-Institut für Plasmaphysik (IPP), Garching (Germany); Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Polytechnic University of Catalonia (UPC), Barcelona (Spain); Department of Applied Physics, Ghent University, Ghent (Belgium); Noterdaeme, J.-M. [Max-Planck-Institut für Plasmaphysik (IPP), Garching (Germany); Department of Applied Physics, Ghent University, Ghent (Belgium); Fischer, U. [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Dies, J. [Polytechnic University of Catalonia (UPC), Barcelona (Spain)

    2015-12-10

    The paper reports results of MCNP-5 calculations to assess the effect on the Tritium Breeding Ratio (TBR) when integrating a distributed Ion Cyclotron Range of Frequencies (ICRF) antenna in the blanket of DEMO fusion power reactor. The calculations consider different parameters such as the ICRF covering ratio and the type of breeding blanket including the Helium Cooled Pebble Bed (HCPB) and the Helium Cooled Lithium Lead (HCLL) concepts. For an antenna with a full toroidal circumference of 360°, located poloidally at 40° with a poloidal extension of 1 m, the reduction of the TBR is −0.349% for the HCPB blanket and −0.532% for the HCLL blanket. The distributed ICRF antenna is thus shown to have only a marginal effect on the TBR of the DEMO reactor.

  20. Conceptual design of electron density measurement system for DEMO-relevant helical plasmas

    International Nuclear Information System (INIS)

    Electron density measurement remains indispensable to control fueling on a DEMO reactor. For steady-state operation of the DEMO reactor, density measurement should be highly reliable and accurate. A dispersion interferometer and a Faraday polarimeter are free from measurement errors caused by mechanical vibrations. Hence combination of the two diagnostics yields a suitable system for density measurement on future steady-state fusion reactors. A wavelength around 1 μm is one of the desirable candidates in terms of the fringe shift and the Faraday rotation angle, the variety of optical components, and the efficiency of frequency doubling for the dispersion interferometer. This paper presents a conceptual design for the dispersion interferometer and Faraday polarimeter with a 1 μm light source. (author)

  1. Neutronic analyses of the HCPB DEMO reactor using a consistent integral approach

    Energy Technology Data Exchange (ETDEWEB)

    Pereslavtsev, Pavel, E-mail: pavel.pereslavtsev@kit.edu; Lu, Lei; Fischer, Ulrich; Bitz, Oliver

    2014-10-15

    This work is devoted to nuclear design analyses of the new HCPB-type DEMO reactor developed in the frame of the EFDA PPPT program. The neutronic simulations were carried out with the MCNP5 code using a full scale 3D torus sector model of the DEMO reactor. The model was generated with the McCad conversion tool from available CAD models using a consistent integral approach. The neutronic analyses addressed the tritium breeding performance, the nuclear power generation and the shielding capabilities of the reactor. Although tritium self-sufficiency was shown, the tritium breeding performance of the current design calls for further design improvements to arrive at a higher uncertainty margin. The shielding performance of the reactor is close to the limit. Sufficient shielding can be easily provided by a slight increase of the inboard shield thickness.

  2. Effect on the tritium breeding ratio for a distributed ICRF antenna in a DEMO reactor

    Science.gov (United States)

    Garcia, A.; Noterdaeme, J.-M.; Fischer, U.; Dies, J.

    2015-12-01

    The paper reports results of MCNP-5 calculations to assess the effect on the Tritium Breeding Ratio (TBR) when integrating a distributed Ion Cyclotron Range of Frequencies (ICRF) antenna in the blanket of DEMO fusion power reactor. The calculations consider different parameters such as the ICRF covering ratio and the type of breeding blanket including the Helium Cooled Pebble Bed (HCPB) and the Helium Cooled Lithium Lead (HCLL) concepts. For an antenna with a full toroidal circumference of 360°, located poloidally at 40° with a poloidal extension of 1 m, the reduction of the TBR is -0.349% for the HCPB blanket and -0.532% for the HCLL blanket. The distributed ICRF antenna is thus shown to have only a marginal effect on the TBR of the DEMO reactor.

  3. Applicability of tungsten/EUROFER blanket module for the DEMO first wall

    International Nuclear Information System (INIS)

    In this paper we analyse a sandwich-type blanket configuration of W/EUROFER for DEMO first wall under steady-state normal operation and off-normal conditions, such as vertical displacements and runaway electrons. The heat deposition and consequent erosion of the tungsten armour is modelled under condition of helium cooling of the first wall blanket module and by taking into account the conversion of the magnetic energy stored in the runaway electron current into heat through the ohmic dissipation of the return current induced in the metallic armour structure. It is shown that under steady-state DEMO operation the first wall sandwich type module will tolerate heat loads up to ∼14 MW/m2. It will also sustain the off-normal events, apart from the hot vertical displacement events, which will melt the tungsten armour surface

  4. Neutronic analysis of a dual He/LiPb coolant breeding blanket for DEMO

    OpenAIRE

    Catalán, J.P.; Ogando Serrano, Francisco; Sanz Gonzalo, Javier; Palermo, I.; Veredas, G.; Gómez Ros, J. M.; Sedano, L

    2010-01-01

    A conceptual design of a DEMO fusion reactor is being developed under the Spanish Breeding Blanket Technology Programme: TECNO_FUS based on a He/LiPb dual coolant blanket as reference design option. The following issues have been analyzed to address the demonstration of the neutronic reliability of this conceptual blanket design: power amplification capacity of the blanket, tritium breeding capability for fuel self-sufficiency, power deposition due to nuclear heating in superconducting coils ...

  5. Physics and Engineering Assessmetns of the K-DEMO Magnet Configuration

    Energy Technology Data Exchange (ETDEWEB)

    Neilson, George H. [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States); Brown, Thomas [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States)

    2014-09-01

    Increased attention is being given now to studies of next-step fusion facilities with nuclear missions. Among these, South Korea's K DEMO is unique in its focus on a high toroidal magnetic field, large major radius, steady-state tokamak design for the core of a facility to test fusion nuclear components in Phase I and, after upgrades, produce 500 MW of electricity in a Phase II. Innovative features of the K DEMO magnet set include the use of two toroidal field (TF) coil winding packs with conductor grading and a machine configuration designed for vertical maintenance. The magnet arrangement features large TF coils and widely spaced poloidal field (PF) coils to accommodate removal of in-vessel components as large modules. Physics and engineering assessments of the pre-conceptual K-DEMO magnet configuration are reported, including: 1) design point and operating space assessment, 2) conductor assessment, and 3) structural assessment. It is found that a reference design point at 6.8 m major radius and 7.4 T toroidal field provides sufficient operating margins for the 500 MWe Phase II mission. Analyses of candidate cable-in-conduit conductors provide predictions of critical current degradation, both in the initial load cycle and an additionally with cyclic loading. A first-pass global analysis of the magnet system found minimal out-of-plane deformations of the TF coil, but an overstress condition in the inner leg of the TF coil. However an analysis taking into account elastic-plastic behavior, frictional sliding, and displacement shows that the structure can safely carry the load. Although the design evolution is still at an early stage, these assessments support the design point choices to date and the expectation that a feasible solution for the high-field K DEMO magnet system can be found.

  6. Initial results of NEXT-DEMO, a large-scale prototype of the NEXT-100 experiment

    CERN Document Server

    Álvarez, V; Cárcel, S; Castel, J; Cebrián, S; Cervera, A; Conde, C A N; Dafni, T; Dias, T H V T; Díaz, J; Egorov, M; Esteve, R; Evtoukhovitch, P; Fernandes, L M P; Ferrario, P; Ferreira, A L; Freitas, E D C; Gehman, V M; Gil, A; Goldschmidt, A; Gómez, H; Gómez-Cadenas, J J; González-Díaz, D; Gutiérrez, R M; Hauptman, J; Morata, J A Hernando; Herrera, D C; Iguaz, F J; Irastorza, I G; Jinete, M A; Labarga, L; Laing, A; Liubarsky, I; Lopes, J A M; Lorca, D; Losada, M; Luzón, G; Marí, A; Martín-Albo, J; Martínez, A; Miller, T; Moiseenko, A; Monrabal, F; Monteiro, C M B; Mora, F J; Moutinho, L M; Vidal, J Muñoz; da Luz, H Natal; Navarro, G; Nebot, M; Nygren, D; Oliveira, C A B; Palma, R; Pérez, J; Aparicio, J L Pérez; Renner, J; Ripoll, L; Rodríguez, A; Rodríguez, J; Santos, F P; Santos, J M F dos; Segui, L; Serra, L; Shuman, D; Simón, A; Sofka, C; Sorel, M; Toledo, J F; Tomás, A; Torrent, J; Tsamalaidze, Z; Vázquez, D; Veloso, J F C A; Villar, J A; Webb, R; White, J T; Yahlali, N

    2012-01-01

    NEXT-DEMO is a large scale prototype and demonstrator of the NEXT-100 High Pressure Xenon Gas TPC, which will search for the neutrinoless double beta decay of Xe-136 using 100-150 kg of enriched xenon gas. The apparatus was built to prove the expected performance of NEXT-100, namely, energy resolution better than 1% FWHM at 2.5 MeV and event topological reconstruction. In this paper we describe the operation and initial results of the detector.

  7. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  8. A Fusion Nuclear Science Facility for a fast-track path to DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Garofalo, A.M., E-mail: garofalo@fusion.gat.com [General Atomics, San Diego, CA (United States); Abdou, M.A. [University of California, Los Angeles, Los Angeles, CA (United States); Canik, J.M. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Chan, V.S.; Hyatt, A.W. [General Atomics, San Diego, CA (United States); Hill, D.N. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Morley, N.B. [University of California, Los Angeles, Los Angeles, CA (United States); Navratil, G.A. [Columbia University, New York, NY (United States); Sawan, M.E. [University of Wisconsin Madison, Madison, WI (United States); Taylor, T.S.; Wong, C.P.C.; Wu, W. [General Atomics, San Diego, CA (United States); Ying, A. [University of California, Los Angeles, Los Angeles, CA (United States)

    2014-10-15

    Highlights: • A FNSF is needed to reduce the knowledge gaps to a fusion DEMO and accelerate progress toward fusion energy. • FNSF will test and qualify first-wall/blanket components and materials in a DEMO-relevant fusion environment. • The Advanced Tokamak approach enables reduced size and risks, and is on a direct path to an attractive target power plant. • Near term research focus on specific tasks can enable starting FNSF construction within the next ten years. - Abstract: An accelerated fusion energy development program, a “fast-track” approach, requires proceeding with a nuclear and materials testing program in parallel with research on burning plasmas, ITER. A Fusion Nuclear Science Facility (FNSF) would address many of the key issues that need to be addressed prior to DEMO, including breeding tritium and completing the fuel cycle, qualifying nuclear materials for high fluence, developing suitable materials for the plasma-boundary interface, and demonstrating power extraction. The Advanced Tokamak (AT) is a strong candidate for an FNSF as a consequence of its mature physics base, capability to address the key issues, and the direct relevance to an attractive target power plant. The standard aspect ratio provides space for a solenoid, assuring robust plasma current initiation, and for an inboard blanket, assuring robust tritium breeding ratio (TBR) >1 for FNSF tritium self-sufficiency and building of inventory needed to start up DEMO. An example design point gives a moderate sized Cu-coil device with R/a = 2.7 m/0.77 m, κ = 2.3, B{sub T} = 5.4 T, I{sub P} = 6.6 MA, β{sub N} = 2.75, P{sub fus} = 127 MW. The modest bootstrap fraction of ƒ{sub BS} = 0.55 provides an opportunity to develop steady state with sufficient current drive for adequate control. Proceeding with a FNSF in parallel with ITER provides a strong basis to begin construction of DEMO upon the achievement of Q ∼ 10 in ITER.

  9. Materials R and D for a timely DEMO: Key findings and recommendations of the EU Roadmap Materials Assessment Group

    Energy Technology Data Exchange (ETDEWEB)

    Stork, Derek, E-mail: derek.stork@ccfe.ac.uk [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching, 85748 Germany (Germany); Agostini, Pietro [ENEA, Brasimone Research Centre, 40032, Camugnano, Bologna (Italy); Boutard, Jean-Louis [CEA, cab HC, Saclay, F-91191, Gif-sur-Yvette (France); Buckthorpe, Derek [AMEC, Booths Park, Chelford Road, Knutsford, Cheshire, WA16 8QZ (United Kingdom); Diegele, Eberhard [Karlsruhe Institute for Technology, IMF-I, D-7602, Karlsruhe (Germany); Dudarev, Sergei L. [Euratom-CCFE Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); English, Colin [National Nuclear Laboratory, 5th Floor, Chadwick House, Warrington Road, Birchwood Park, WA3 6AE (United Kingdom); Federici, Gianfranco [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching, 85748 Germany (Germany); Gilbert, Mark R. [Euratom-CCFE Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Gonzalez, Sehila [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching, 85748 Germany (Germany); Ibarra, Angel [CIEMAT, Avda. Complutense 40, Madrid (Spain); Linsmeier, Christian [Forschungszentrum Jülich GmbH, Institut für Energie- und Klimaforschung–Plasmaphysik, EURATOM Association, 52425 Jülich (Germany); Puma, Antonella Li [CEA, DEN, Saclay, DM2S, SERMA, F-91191, Gif-sur-Yvette (France); Marbach, Gabriel [CEA, cab HC, Saclay, F-91191, Gif-sur-Yvette (France); Packer, Lee W. [Euratom-CCFE Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Raj, Baldev [Indian National Academy of Engineering, Shaheed Jeet Singh Marg, New Delhi 110016 (India); Rieth, Michael [Karlsruhe Institute for Technology, IMF-I, D-7602, Karlsruhe (Germany); Tran, Min Quang [Ecole Polytechnique Federale de Lausanne—CRPP, Association Euratom-Switzerland, 1015 Lausanne (Switzerland); and others

    2014-10-15

    The findings of the EU Fusion Programme's ‘Materials Assessment Group’ (MAG), assessing readiness of Structural, Plasma Facing (PF) and High Heat Flux (HHF) materials for DEMO, are discussed. These are incorporated into the EU Fusion Power Roadmap [1], with a decision to construct DEMO in the early 2030s. The methodology uses project-based and systems-engineering approaches, the concept of Technology Readiness Levels, and considers lessons learned from Fission reactor material development. ‘Baseline’ materials are identified for each DEMO role, and the DEMO mission risks analysed from the known limitations, or unknown properties, associated with each baseline material. R and D programmes to address these risks are developed. The DEMO assessed has a phase I with a ‘starter blanket’: the blanket must withstand ≥2 MW yr m{sup −2} fusion neutron flux (equivalent to ∼20 dpa front-wall steel damage). The baseline materials all have significant associated risks, so development of ‘Risk Mitigation Materials’ (RMM) is recommended. The R and D programme has parallel development of the baseline and RMM, up to ‘down-selection’ points to align with decisions on the DEMO blanket and divertor engineering definition. ITER licensing experience is used to refine the issues for materials nuclear testing, and arguments are developed to optimise scope of materials tests with fusion neutron (‘14 MeV’) spectra before DEMO design finalisation. Some 14 MeV testing is still essential, and the Roadmap requires deployment of a ≥30 dpa (steels) testing capability by 2026. Programme optimisation by the pre-testing with fission neutrons on isotopically- or chemically-doped steels and with ion-beams is discussed along with the minimum 14 MeV testing programme, and the key role which fundamental and mission-oriented modelling can play in orienting the research.

  10. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  11. Conceptual design for the superconducting magnet system of a pulsed DEMO reactor

    International Nuclear Information System (INIS)

    Highlights: ► A 1D design approach of a pulsed DEMO reactor is presented. ► The main CS and TF conductor design criteria are presented. ► A typical major radius for a 2 GW DEMO is 9 m. ► A typical plasma magnetic field is 4.9 T. ► The pulse duration is 1.85 h for an aspect ratio of 3. -- Abstract: A methodology has been developed to consistently investigate, taking into account main reactor components, possible magnet solutions for a pulsed fusion reactor aiming at a large solenoid flux swing duration within the 2–3 h range. In a conceptual approach, investigations are carried out in the equatorial plane, taking into account the radial extension of the blanket-shielding zone, of the toroidal field magnet system inner leg and of the central solenoid for estimation of the pulsed swing. Design criteria are presented for the radial extension of the superconducting magnets, which is mostly driven by the structures (casings and conductor jacket). Typical available cable current densities are presented as a function of the magnetic field and of the temperature margin. The magnet design criteria have been integrated into SYCOMORE, a code for reactor modeling presently in development at CEA/IRFM in Cadarache, using the tools of the EFDA Integrated Tokamak Modeling task force. Possible solutions are investigated for a 2 GW fusion power reactor with different aspect ratios. The final adjustment of the DEMO pulsed reactor parameters will have to be consistently done, considering all reactor components, when the final goals of the machine will be completely clarified

  12. Conceptual design for the superconducting magnet system of a pulsed DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Duchateau, J.-L., E-mail: jean-luc.duchateau@cea.fr [CEA/IRFM, 13108 St. Paul lez Durance Cedex (France); Hertout, P.; Saoutic, B.; Magaud, P.; Artaud, J.-F.; Giruzzi, G.; Bucalossi, J.; Johner, J.; Sardain, P.; Imbeaux, F.; Ané, J.-M.; Li-Puma, A. [CEA/IRFM, 13108 St. Paul lez Durance Cedex (France)

    2013-10-15

    Highlights: ► A 1D design approach of a pulsed DEMO reactor is presented. ► The main CS and TF conductor design criteria are presented. ► A typical major radius for a 2 GW DEMO is 9 m. ► A typical plasma magnetic field is 4.9 T. ► The pulse duration is 1.85 h for an aspect ratio of 3. -- Abstract: A methodology has been developed to consistently investigate, taking into account main reactor components, possible magnet solutions for a pulsed fusion reactor aiming at a large solenoid flux swing duration within the 2–3 h range. In a conceptual approach, investigations are carried out in the equatorial plane, taking into account the radial extension of the blanket-shielding zone, of the toroidal field magnet system inner leg and of the central solenoid for estimation of the pulsed swing. Design criteria are presented for the radial extension of the superconducting magnets, which is mostly driven by the structures (casings and conductor jacket). Typical available cable current densities are presented as a function of the magnetic field and of the temperature margin. The magnet design criteria have been integrated into SYCOMORE, a code for reactor modeling presently in development at CEA/IRFM in Cadarache, using the tools of the EFDA Integrated Tokamak Modeling task force. Possible solutions are investigated for a 2 GW fusion power reactor with different aspect ratios. The final adjustment of the DEMO pulsed reactor parameters will have to be consistently done, considering all reactor components, when the final goals of the machine will be completely clarified.

  13. Demos Center, Militsiia mezhdu Rossiei i Chechnei. Veterany konflikta v rossiiskom obshchestve

    Directory of Open Access Journals (Sweden)

    Elisabeth Sieca-Kozlowski

    2009-03-01

    Full Text Available The Demos study on policemen who are veterans of the Chechen war is the Centre’s second in-depth study. The first dealt with the phenomenon of arbitrariness (“proizvol” in the police force. This new study focuses on one of the contributing factors of this arbitrariness, the fact of having gone through the Chechen war. Although the two Chechen conflicts (1994-1996 and 1999 to the present involved the dispatch of tens of thousands of military and members of “power” ministries to the combat zo...

  14. Assembling a game development scene? Uncovering Finland’s largest demo party

    Directory of Open Access Journals (Sweden)

    Heikki Tyni

    2014-03-01

    Full Text Available The study takes look at Assembly, a large-scale LAN and demo party founded in 1992 and organized annually in Helsinki, Finland. Assembly is used as a case study to explore the relationship between computer hobbyism – including gaming, demoscene and other related activities – and professional game development. Drawing from expert interviews, a visitor query and news coverage we ask what kind of functions Assembly has played for the scene in general, and on the formation and fostering of the Finnish game industry in particular. The conceptual contribution of the paper is constructed around the interrelated concepts of scene, technicity and gaming capital.

  15. Design Window Analysis for the Helical DEMO Reactor FFHR-d1

    OpenAIRE

    Goto, Takuya; MIYAZAWA, Junichi; TAMURA, Hitoshi; TANAKA, Teruya; Hamaguchi, Shinji; Yanagi, Nagato; SAGARA, Akio; the FFHR Design Group

    2012-01-01

    Conceptual design activity for the LHD-type helical DEMO reactor FFHR-d1 has been conducted at the National Institute for Fusion Science under the Fusion Engineering Research Project since FY2010. In the first step of the conceptual design process, design window analysis was conducted using the system design code HELIOSCOPE by the “Design Integration Task Group”. On the basis of a parametric scan with the core plasma design based on the DPE (Direct Profile Extrapolation) method, a design poin...

  16. Activation Analysis for a He/LiPb dual Coolant Blanket for DEMO Reactor

    OpenAIRE

    Catalán, J.P.; Ogando Serrano, Francisco; Sanz Gonzalo, Javier

    2010-01-01

    The objective of the Spanish national project TECNO_FUS is to generate a conceptual design of a DCLL (Dual-Coolant Lithium-Lead) blanket for the DEMO fusion reactor. The dually-cooled breeding zone is composed of He/Pb-15.7 6Li and SiC as liquid metal flow channel inserts. Structural materials are ferritic-martensitic steel (Eurofer-97) for the blanket and austenitic steel (316LN) for the Vacuum Vessel (VV). The goal of this work is to analyze the radioactive waste production by the neutron-i...

  17. Industrial Frequency Single-Phase AC Traction Power Supply System and Its Key Technologies for Urban Rail Transit%城市轨道交通交流牵引供电系统及其关键技术

    Institute of Scientific and Technical Information of China (English)

    李群湛

    2015-01-01

    To avoid stray current and maintain the benefit of no phase-split in the DC traction power supply system,an AC traction power supply system was proposed for the urban public transport such as metro and light rail transit. The proposed system consists of main substation (MSS)and cable traction network (CTN ). MSS includes a single-phase main traction transformer (MTT ) and a negative sequence compensation device (NCD ),while CTN includes double-core cables (DCC ),traction transformers (TT),overhead catenary system (OCS),rails (R),etc. Three key techniques of the proposed system were discussed. First,power supply principle,equivalent circuit and transmission ability of CNT were introduced and cable-catenary matching technique,catenary voltage level selection were discussed. Second,the segmentation technology,status identification method for traction power supply network,distributed and centralized protection schemes,etc. were discussed. Third,single-line main substation supply scheme,and two or more lines shared main substation scheme were presented. Given that the excellent technical performance,good economy and high reliability of the proposed system,it provides a new alternative for metro and urban rail transit power supply system.%在地铁、轻轨等城市轨道交通中,为了避免现行直流牵引供电系统的迷流,同时发挥其无分相的优势,提出并研究了一种交流牵引供电系统。该系统由主变电所(MSS)和电缆牵引网(CTN)构成,主变电所由单相主牵引变压器(MTT)和负序补偿装置(NCD)组合而成,电缆牵引网由双芯电缆(DCC)、牵引变压器(TT)和接触网(OCS)、钢轨(R)等构成。讨论了该系统的3项关键技术:电缆牵引网的供电原理,等效电路和输电能力,电缆与接触网的匹配技术,接触网电压等级选择等;牵引网分段供电技术,牵引网供电状态辨识方法,分布式保护与集中式

  18. Interview of Tanya Lokshina, President of the Demos center, conducted by Olga Filippova, Moscow, 11 May 2007

    Directory of Open Access Journals (Sweden)

    2007-12-01

    Full Text Available Demos Veterans ProjectPIPSS.ORG – Could you please retrace for us the history of the research program untitled “Veterans of Chechnya” and, inside it, the sub-program “Drawing Public Attention to the Chechen Conflict through the Prism of Issues Associated with Social Adaptation and Professional Activities of Veterans”? Tanya Lokshina: Demos provides informative and expert-analytical work on current issues in Russia. On the basis of our informative work, we carry out in-depth research into the ...

  19. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  20. AC1 Wing

    OpenAIRE

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  1. In-vessel remote handling machine for blanket replacement in the demo fusion reactor

    International Nuclear Information System (INIS)

    The paper presents the current state of investigations concerning the adaptation of the ITER in-vessel remote handling system of 1998 to DEMO conditions. The outline of the concept is the following: a rail is built up in the middle of the vessel along the major radius forming a full circle. It is supported from the four equatorial ports by long radial arms connected perpendicularly to the rail. On the rail four manipulators with telescopic arms are operating each being responsible for a 90 deg section of the rail. Within their section the manipulators are capable of reaching and removing every element, and can manipulate 10 t elements at 3,5 m distance with great precision. Element exchange will take place through the lower section of the ports. Great advantage of the system is that it is only supported from the ports, thus the maintenance of the divertor and blanket can be planned independently. For this reason the system is preferred for DEMO, but there are challenges to face, and they come from the large and heavy elements having to be inserted through the ports of limited size, the complicated installation process and the need for precision. The results of this work indicate that this adaptation can be done, although more investigation is necessary regarding the manipulator design (author)

  2. Neutronic design analyses for a dual-coolant blanket concept: Optimization for a fusion reactor DEMO

    International Nuclear Information System (INIS)

    Highlights: ► Dual-Coolant He/Pb15.7Li breeding blanket for a DEMO fusion reactor is studied. ► An iterative process optimizes neutronic responses minimizing reactor dimension. ► A 3D toroidally symmetric geometry has been generated from the CAD model. ► Overall TBR values support the feasibility of the conceptual model considered. ► Power density in TF coils is below load limit for quenching. - Abstract: The generation of design specifications for a DEMO reactor, including breeding blanket (BB), vacuum vessel (VV) and magnetic field coils (MFC), requires a consistent neutronic optimization of structures between plasma and MFC. This work targets iteratively to generate these neutronic specifications for a Dual-Coolant He/Pb15.7Li breeding blanket design. The iteration process focuses on the optimization of allowable space between plasma scrapped-off-layer and VV in order to generate a MFC/VV/BB/plasma sustainable configuration with minimum global system volumes. Two VV designs have been considered: (1) a double-walled option with light-weight stiffeners and (2) a thick massive one. The optimization process also involves VV materials, looking to warrant radiation impact operational limits on the MFC. The resulting nuclear responses: peak nuclear heating in toroidal field (TF) coil, tritium breeding ratio (TBR), power amplification factor and helium production in the structural material are provided.

  3. Radial-build design and support system for the helical DEMO reactor FFHR-d1

    International Nuclear Information System (INIS)

    Highlights: ► A conceptual design study for the helical DEMO reactor FFHR-d1 is conducted. ► A radial-build design concept is proposed, which ensures constant geometric positions of the components. ► A structural design procedure for the coil support structure with large apertures is presented and FEM analysis is performed. -- Abstract: A conceptual design for the helical DEMO reactor FFHR-d1 is under development at the National Institute for Fusion Science. In the large helical device (LHD)-type configuration of FFHR-d1, the space between the plasma boundary and the helical coil is limited. Many components are required to be installed at definite geometric positions within this space. The position of each component changes owing to variations in the surrounding conditions, such as temperature, electromagnetic forces, and support methods. This paper proposes a radial-build design concept; the application of this concept ensures constant geometric positions of the components and the gaps between them during normal operation and the construction/maintenance phase. On the other hand, large apertures are required for the coil support structure for the maintenance of blanket and divertor systems. This paper presents a structural design procedure for the coil support structure with large apertures and an LHD-type gravity support post. The analytic results show that the stress level of the structure is lower than the permissible limit

  4. A Feasible DEMO Blanket Concept Based on Water Cooled Solid Breeder

    International Nuclear Information System (INIS)

    Full text: JAEA has conducted the conceptual design study of blanket for a fusion DEMO reactor SlimCS. Considering DEMO specific requirements, we place emphasis on a blanket concept with durability to severe irradiation, ease of fabrication for mass production, operation temperature of blanket materials, and maintainability using remote handling equipment. This paper present a promising concept satisfying these requirements, which is characterized by minimized welding lines near the front, a simplified blanket interior consisting of cooling tubes and a mixed pebble bed of breeder and neutron multiplier, and approximately the same outlet temperature for all blanket modules. Neutronics calculation indicated that the blanket satisfies a self-sufficient production of tritium. An important finding is that little decrease is seen in tritium breeding ratio even when the gap between neighboring blanket modules is as wide as 0.03 m. This means that blanket modules can be arranged with such a significant clearance gap without sacrifice of tritium production, which will facilitate the access of remote handling equipment for replacement of the blanket modules and improve the access of diagnostics. (author)

  5. Endogenising demographic variables in demo-economic models: the Bachue experience.

    Science.gov (United States)

    Wery, R; Rodgers, G

    1980-01-01

    The attempt is made in this discussion to describe and draw lessons from the treatment of behavioral demographic variables in the Bachue demo-economic models constructed for the Philippines, Kenya, Brazil and Yugoslavia. Focus is on certain theoretical, technical and practical problems encountered in inserting demographic variables in the system as a whole; how they have been measured in the various applications of the Bachue models, how they are behaviorally explained and linked to the other elements in the system, the data sources used, and some issues of econometric estimates and modelling. 8 issues are dealt with: population accounting and lag structure; fertility; mortality; migration; nuptiality; household formation; schooling; and labor force participation. In each case model structure, dependent and explanatory variables, and empirical strategy are discussed. Summary tables compare the approaches of the different models. The specifics of each country situation rule out the identification of the best solution. Some suggestions regarding more promising approaches are included with respect to choice of variables and the estimation of behavioral models. The endogenous nature of certain demographic elements of a demo-economic model are clear, but construction of the Bachue models has shown that there are no exact rules valid for all cases. There is considerable variety in the way characteristics of the population have been represented in the various applications.

  6. Lessons learnt from ITER safety & licensing for DEMO and future nuclear fusion facilities

    CERN Document Server

    Taylor, Neill

    2013-01-01

    One of the strong motivations for pursuing the development of fusion energy is its potentially low environmental impact and very good safety performance. But this safety and environmental potential can only be fully realized by careful design choices. For DEMO and other fusion facilities that will require nuclear licensing, S&E objectives and criteria should be set at an early stage and taken into account when choosing basic design options and throughout the design process. Studies in recent decades of the safety of fusion power plant concepts give a useful basis on which to build the S&E approach and to assess the impact of design choices. The experience of licensing ITER is of particular value, even though there are some important differences between ITER and DEMO. The ITER project has developed a safety case, produced a preliminary safety report and had it examined by the French nuclear safety authorities, leading to the licence to construct the facility. The key technical issues that arose during ...

  7. Materials for DEMO and reactor applications—boundary conditions and new concepts

    Science.gov (United States)

    Coenen, J. W.; Antusch, S.; Aumann, M.; Biel, W.; Du, J.; Engels, J.; Heuer, S.; Houben, A.; Hoeschen, T.; Jasper, B.; Koch, F.; Linke, J.; Litnovsky, A.; Mao, Y.; Neu, R.; Pintsuk, G.; Riesch, J.; Rasinski, M.; Reiser, J.; Rieth, M.; Terra, A.; Unterberg, B.; Weber, Th; Wegener, T.; You, J.-H.; Linsmeier, Ch

    2016-02-01

    DEMO is the name for the first stage prototype fusion reactor considered to be the next step after ITER towards realizing fusion. For the realization of fusion energy especially, materials questions pose a significant challenge already today. Heat, particle and neutron loads are a significant problem to material lifetime when extrapolating to DEMO. For many of the issues faced, advanced materials solutions are under discussion or already under development. In particular, components such as the first wall and the divertor of the reactor can benefit from introducing new approaches such as composites or new alloys into the discussion. Cracking, oxidation as well as fuel management are driving issues when deciding for new materials. Here {{{W}}}{{f}}/{{W}} composites as well as strengthened CuCrZr components together with oxidation resilient tungsten alloys allow the step towards a fusion reactor. In addition, neutron induced effects such as transmutation, embrittlement and after-heat and activation are essential. Therefore, when designing a component an approach taking into account all aspects is required.

  8. On the Core Deuterium-Tritium Fuel Ratio and Temperature Measurements in DEMO

    CERN Document Server

    Kiptily, V G

    2014-01-01

    Comparing with ITER, the experimental fusion machine under constraction, the next step test fusion power plant, DEMO will be characterized by very long pulse/steady-state operation and much higher plasma volume and fusion power. The substantially increased level of neutron and gamma fluxes will require reducing the physical access to the plant. It means some conventional diagnostics for the fusion plasma control will be not suitable in DEMO. Development of diagnostics along with the machine design is a primary task for the test plant. The deuterium- tritium fuel ratio and temperature are among important parameters, which should be under control. In this letter a novel technique for the core fuel ratio and temperature diagnostics is proposed. It is based on measurements and comparison of the rates T(p,{\\gamma})4He and D(T,{\\gamma})5He nuclear reactions that take place in the hot deuterium-tritium plasma. Based on detection of high energy gamma-rays, this diagnostic is robust, efficient and does not require dir...

  9. Integrated modelling of DEMO-FNS current ramp-up scenario and steady-state regime

    Science.gov (United States)

    Dnestrovskij, A. Yu.; Kuteev, B. V.; Bykov, A. S.; Ivanov, A. A.; Lukash, V. E.; Medvedev, S. Yu.; Sergeev, V. Yu.; Sychugov, D. Yu.; Khayrutdinov, R. R.

    2015-06-01

    An approach to the integrated modelling of plasma regimes in the projected neutron source DEMO-FNS based on different codes is developed. The consistency check of the steady-state regime is carried out, namely, the possibility of the plasma current ramp-up, acceptance of growth rates of MHD modes in the steady-state regime, heat loads to the wall and divertor plates and neutron yield value. The following codes are employed for the integrated modelling. ASTRA transport code for calculation of plasma parameters in the steady-state regime, NUBEAM Monte Carlo code for NBI incorporated into the ASTRA code, DINA free boundary equilibrium and evolution code, SPIDER free boundary equilibrium and equilibrium reconstruction code, KINX ideal MHD stability code, TOKSTAB rigid shift vertical stability code, edge and divertor plasma B2SOLPS5.2 code and Semi-analytic Hybrid Model (SHM) code for self-consistent description of the core, edge and divertor plasmas based on the experimental scaling laws. The consistent steady-state regime for the DEMO-FNS plasma and the plasma current ramp-up scenario are developed using the integrated modelling approach. Passive copper coils are suggested to reduce the plasma vertical instability growth rate to below ˜30 s-1.The outer divertor operation in the ‘high-recycling’ regime is numerically demonstrated with a maximal heat flux density of 7-9 MW m-2 that is technically acceptable.

  10. Archimede solar energy molten salt parabolic trough demo plant: Improvements and second year of operation

    Science.gov (United States)

    Maccari, Augusto; Donnola, Sandro; Matino, Francesca; Tamano, Shiro

    2016-05-01

    Since July 2013, the first stand-alone Molten Salt Parabolic Trough (MSPT) demo plant, which was built in collaboration with Archimede Solar Energy and Chiyoda Corporation, is in operation, located adjacent to the Archimede Solar Energy (ASE) manufacturing plant in Massa Martana (Italy). During the two year's operating time frame, the management of the demo plant has shown that MSPT technology is a suitable and reliable option. Several O&M procedures and tests have been performed, as Heat Loss and Minimum Flow Test, with remarkable results confirming that this technology is ready to be extended to standard size CSP plant, if the plant design takes into account molten salt peculiarities. Additionally, the plant has been equipped on fall 2014 with a Steam Generator system by Chiyoda Corporation, in order to test even this important MSPT plant subsystem and to extend the solar field active time, overcoming the previous lack of an adequate thermal load. Here, a description of the plant improvements and the overall plant operation figures will be presented.

  11. A DEMO relevant fast wave current drive high harmonic antenna exploiting the high impedance technique

    Science.gov (United States)

    Milanesio, D.; Maggiora, R.

    2015-12-01

    Ion Cyclotron (IC) antennas are routinely adopted in most of the existing nuclear fusion experiments, even though their main goal, i.e. to couple high power to the plasma (MW), is often limited by rather severe drawbacks due to high fields on the antenna itself and on the unmatched part of the feeding lines. In addition to the well exploited auxiliary ion heating during the start-up phase, some non-ohmic current drive (CD) at the IC range of frequencies may be explored in view of the DEMO reactor. In this work, we suggest and describe a compact high frequency DEMO relevant antenna, based on the high impedance surfaces concept. High-impedance surfaces are periodic metallic structures (patches) usually displaced on top of a dielectric substrate and grounded by means of vertical posts embedded inside the dielectric, in a mushroom-like shape. These structures present a high impedance, within a given frequency band, such that the image currents are in-phase with the currents of the antenna itself, thus determining a significant efficiency increase. After a general introduction on the properties of high impedance surfaces, we analyze, by means of numerical codes, a dielectric based and a full metal solution optimized to be tested and benchmarked on the FTU experiment fed with generators at 433MHz.

  12. A DEMO relevant fast wave current drive high harmonic antenna exploiting the high impedance technique

    Energy Technology Data Exchange (ETDEWEB)

    Milanesio, D., E-mail: daniele.milanesio@polito.it; Maggiora, R. [Politecnico di Torino, Dipartimento di Elettronica e Telecomunicazioni (DET), Torino (Italy)

    2015-12-10

    Ion Cyclotron (IC) antennas are routinely adopted in most of the existing nuclear fusion experiments, even though their main goal, i.e. to couple high power to the plasma (MW), is often limited by rather severe drawbacks due to high fields on the antenna itself and on the unmatched part of the feeding lines. In addition to the well exploited auxiliary ion heating during the start-up phase, some non-ohmic current drive (CD) at the IC range of frequencies may be explored in view of the DEMO reactor. In this work, we suggest and describe a compact high frequency DEMO relevant antenna, based on the high impedance surfaces concept. High-impedance surfaces are periodic metallic structures (patches) usually displaced on top of a dielectric substrate and grounded by means of vertical posts embedded inside the dielectric, in a mushroom-like shape. These structures present a high impedance, within a given frequency band, such that the image currents are in-phase with the currents of the antenna itself, thus determining a significant efficiency increase. After a general introduction on the properties of high impedance surfaces, we analyze, by means of numerical codes, a dielectric based and a full metal solution optimized to be tested and benchmarked on the FTU experiment fed with generators at 433MHz.

  13. Research and development plan of fusion technologies in JAERI toward DEMO reactors

    International Nuclear Information System (INIS)

    In accordance with the 'Third Phase Basic Program on Fusion Research and Development' established by the Fusion Council of the Japan Atomic Energy Commission, research and development (R and D) of fusion technologies aim at realization of two elements: development of ITER key components and their improvement for higher performances; and construction of sound technical basis of fusion nuclear technologies essential for fusion energy utilization. JAERI has been assigned in the Third Phase Basic Program as a responsible institute for developing the above two elements, and accordingly has been implementing technology R and Ds categorized in the following three areas: R and D for ITER construction and operation; R and D for ITER utilization (blanket testing in ITER) and toward DEMO; and R and D on basic fusion technologies. The present report reviews the status and the plan of fusion technology R and Ds in the latter two areas, and presents the technical objectives, technical issues, status of R and D and near-term R and D plans for: breeding blankets; structural materials; the IFMIF program; improvements of the key ITER components for higher performances toward DEMO; and basic fusion technologies. (author)

  14. Neutronics analysis of inboard shielding capability for a DEMO fusion reactor CFETR

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Songlin; Li, Jiangang [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui 230031 (China); Zheng, Shanliang, E-mail: shanliang.zheng@ccfe.ac.uk [Culham Centre for Fusion Energy, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Mitchell, Neil [ITER Organization, Route de Vinon sur Verdon, 13115 Saint Paul Lez Durance (France)

    2013-10-15

    The inboard shielding of a fusion reactor can be a crucial issue due to the limited space available in a tokamak configuration. It is necessary to assess the inboard shielding capability of DEMO for its initial design. In this paper, 1D and 3D neutronics models were developed based on a reference design of the Chinese Fusion Engineering Testing Reactor (CFETR). The neutron wall load (NWL) is in the range of 1.5–3 MW/m{sup 2} and the inboard shielding thickness is constrained within 40–70 cm in order to achieve the tritium self-sufficiency of the reactor. Referring to the detailed design of the ITER Toroidal Field Coils (TFCs) and using radiation hardening technology developed for ITER, the inboard blanket shielding capability and nuclear responses of the TFC are investigated for both FLiBe and Li{sub 4}SiO{sub 4} breeding blanket concepts. The impact of the gaps on shielding performance is discussed. Some suggestions on improving the inboard shielding performance for DEMO are also proposed.

  15. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  16. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  17. Presentazione Demos

    OpenAIRE

    Mastino, Attilio

    2001-01-01

    L'autore presenta questo volume, con cui si è voluto far riscoprire un poco i sapori e le emozioni di una terra antica, ricca di tradizioni e con una sua forte identità ambientale e storica: il monte Sassu caratterizza ancora oggi un territorio straordinario, che abbraccia il Monte Acuto e l'Anglona, che tocca le terre occupate nell'antichità dai Balari e dai Corsi, resistenti contro i Cartaginesi, i Romani, i Bizantini.

  18. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  19. Developing structural, high-heat flux and plasma facing materials for a near-term DEMO fusion power plant: The EU assessment

    OpenAIRE

    Stork, D.; Agostini, P.; Boutard, J.L.; Buckthorpe, D.; Diegele, E.; Dudarev, S. L.; English, C.; Federici, G.; Gilbert, M. R.; Gonzalez, S.; Ibarra, A.; Linsmeier, Ch.; LI PUMA, A; Marbach, G.; Morris, P. F.

    2014-01-01

    The findings of the EU 'Materials Assessment Group' (MAG), within the 2012 EU Fusion Roadmap exercise, are discussed. MAG analysed the technological readiness of structural, plasma facing and high heat flux materials for a DEMO concept to be constructed in the early 2030s, proposing a coherent strategy for R&D up to a DEMO construction decision. A DEMO phase I with a 'Starter Blanket' and 'Starter Divertor' is foreseen: the blanket being capable of withstanding >= 2 MW yr m(-2) fusion neutron...

  20. Latest results of NEXT-DEMO, the prototype of the NEXT 100 double beta decay experiment

    CERN Document Server

    Serra, L; Martin-Albo, J; Sorel, M; Gomez-Cadenas, J J

    2014-01-01

    NEXT-DEMO is a 1:4.5 scale prototype of the NEXT100 detector, a high-pressure xenon gas TPC that will search for the neutrinoless double beta decay of $^{136}$Xe. X-ray energy depositions produced by the de-excitation of Xenon atoms after the interaction of gamma rays from radioactive sources have been used to characterize the response of the detector obtaining the spatial calibration needed for close-to-optimal energy resolution. Our result, 5.5% FWHM at 30 keV, extrapolates to 0.6% FWHM at the Q value of $^{136}$Xe. Additionally, alpha decays from radon have been used to measure several detection properties and parameters of xenon gas such as electron-ion recombination, electron drift velocity, diffusion and primary scintillation light yield. Alpha spectroscopy is also used to quantify the activity of radon inside the detector, a potential source of background for most double beta decay experiments.

  1. Global depletion analysis of Korean helium cooled solid breeder TBM model for demo fusion reactor

    International Nuclear Information System (INIS)

    The Korean HCSB (helium cooled solid breeder) TBM (test blanket module) is proposed with its specific compositions of lithium ceramic, beryllium and graphite in pebble form. In the Korean HCSB TBM, the amount of beryllium is reduced and the reduction is replaced by graphite for a neutron reflector, while tritium breeding ratio (TBR) remains almost unchanged with relatively low Li6 enrichment of ∼40%. However, the previous Korean HCSB was designed based on the LOCAL assumption, in which the surroundings are assumed by the reflective boundary condition. In this research, we establish a simple GLOBAL neutronics model based on demo fusion reactor and perform neutronics analyses including depletion (transmutation) calculation during 100 EFPDs (effective full power days) using the modified MONTEBURNS code.

  2. Operation and first results of the NEXT-DEMO prototype using a silicon photomultiplier tracking array

    CERN Document Server

    Álvarez, V; Cárcel, S; Castel, J; Cebrián, S; Cervera, A; Conde, C A N; Dafni, T; Dias, T H V T; Díaz, J; Egorov, M; Esteve, R; Evtoukhovitch, P; Fernandes, L M P; Ferrario, P; Ferreira, A L; Freitas, E D C; Gehman, V M; Gil, A; Goldschmidt, A; Gómez, H; Gómez-Cadenas, J J; González-Díaz, D; Gutiérrez, R M; Hauptman, J; Morata, J A Hernando; Herrera, D C; Iguaz, F J; Irastorza, I G; Jinete, M A; Labarga, L; Laing, A; Liubarsky, I; Lopes, J A M; Lorca, D; Losada, M; Luzón, G; Marí, A; Martín-Albo, J; Martínez, A; Martínez, G; Miller, T; Moiseenko, A; Monrabal, F; Monteiro, C M B; Mora, F J; Moutinho, L M; Vidal, J Muñoz; da Luz, H Natal; Navarro, G; Nebot-Guinot, M; Nygren, D; Oliveira, C A B; Palma, R; Pérez, J; Aparicio, J L Pérez; Renner, J; Ripoll, L; Rodríguez, A; Rodríguez, J; Santos, F P; Santos, J M F dos; Seguí, L; Serra, L; Shuman, D; Simón, A; Sofka, C; Sorel, M; Toledo, J F; Tomás, A; Torrent, J; Tsamalaidze, Z; Veloso, J F C A; Villar, J A; Webb, R; White, J T; Yahlali, N

    2013-01-01

    NEXT-DEMO is a high-pressure xenon gas TPC which acts as a technological test-bed and demonstrator for the NEXT-100 neutrinoless double beta decay experiment. In its current configuration the apparatus fully implements the NEXT-100 design concept. This is an asymmetric TPC, with an energy plane made of photomultipliers and a tracking plane made of silicon photomultipliers (SiPM) coated with TPB. The detector in this new configuration has been used to reconstruct the characteristic signature of electrons in dense gas. Demonstrating the ability to identify the MIP and ``blob'' regions. Moreover, the SiPM tracking plane allows for the definition of a large fiducial region in which an excellent energy resolution of 1.82% FWHM at 511 keV has been measured (a value which extrapolates to 0.83% at the xenon Qbetabeta).

  3. Transient Mirror Heating Theory and Experiment in the Jefferson Lab IR Demo FEL

    Energy Technology Data Exchange (ETDEWEB)

    Benson, S.; Michelle D. Shinn.; Neil, G.R.

    2001-01-01

    During commissioning of the IR Demo FEL at Jefferson Lab, we noticed that the FEL exhibited a rapid power drop with time when the first set of 3 mu-m mirrors was used. Thought the rate of power drop was unexpected, it was thought that it could be due to a distortion of the mirrors during a time short compared to a the thermal diffusion time. This transient distortion might affect the laser more than the steady state distortion. This paper presents some analysis of the transient mirror heating problem and some recent experimental results using different mirror substrates and coatings. It is found that the behavior of the first mirror set cannot be reconciled with the observed power fall-off if a linear absorption is assumed. The power drop in more recent experiments is consistent with linear thermal analysis. No anomalous transient effects are seen.

  4. Evaluation of Demo 1C composite flywheel rotor burst test and containment design

    Energy Technology Data Exchange (ETDEWEB)

    Kass, M.D.; McKeever, J.W.; Akerman, M.A.; Goranson, P.L.; Litherland, P.S.; O`Kain, D.U.

    1998-07-01

    Laboratory-Directed funds were provided in FY 1995 for research to develop flywheel containment specifications and to consider concepts that could satisfy these specifications and produce a prototype small, lightweight, inexpensive, mobile flywheel containment. Research activities have included an analytical and pictorial review of the Demo 1C flywheel failure test, which provided significant insight about radial and axial failure modes; calculations of the thickness of ultra-conservative pressure vessel containment; entertainment of advanced containment concepts using lightweight materials and armor literature; consideration of fabrication assembly procedures; and participation in a Flywheel Energy Storage Workshop during which additional flywheel failure experiences were discussed. Based on these activities, calculations, and results, a list of conclusions concerning flywheel containment and its relation to the flywheel are presented followed by recommendations for further research.

  5. Design window analysis for the helical DEMO reactor FFHR-d1

    International Nuclear Information System (INIS)

    Conceptual design activity for the LHD-type helical DEMO reactor FFHR-d1 has been conducted at the National Institute for Fusion Science under the Fusion Engineering Research Project since FY2010. In the first step of the conceptual design process, design window analysis was conducted using the system design code HELIOSCOPE by the “Design Integration Task Group”. On the basis of a parametric scan with the core plasma design based on the DPE (Direct Profile Extrapolation) method, a design point having a major radius of 15.6 m and averaged magnetic field strength at the helical coil winding center of 4.7 T was selected as a candidate. The validity of the design was confirmed through the analysis by the related task groups (in-vessel component, blanket, and superconducting magnet). (author)

  6. Dynamics of a nanowire superlattice in an ac electric field

    OpenAIRE

    Zhang, Aizhen; Voon, L. C. Lew Yan; M. Willatzen

    2005-01-01

    With a one-band envelope function theory, we investigate the dynamics of a finite nanowire superlattice driven by an ac electric field by solving numerically the time-dependent Schroedinger equation. We find that for an ac electric field resonant with two energy levels located in two different minibands, the coherent dynamics in nanowire superlattices is much more complex as compared to the standard two-level description. Depending on the energy levels involved in the transitions, the coheren...

  7. A preliminary study on the activation analysis for a conceptual K DEMO fusion reactor

    International Nuclear Information System (INIS)

    It is known that the radioactive materials of nuclear fusion reactor have a low radioactivity in comparison with fission reactors. However, in the case of a specific module which is directly facing the fusion plasma, its radioactivity is so high that the module is needed to control and decommission by the legal regulation. The typical modules which have such a characteristic are Blanket Module (BM) and Divertor (Dv). These modules are regularly substituted with new module when irradiated sufficiently, so an accurate assessment of neutron activation is mandatory for those components of the fusion reactors because of the environmental effect and safety advantages. In order to reduce the neutron activation effect, two primary considerations are required. One is the use of the materials which abate the radioactive effects, and the other is the development of effective designs for low neutron activation. Various research groups of the ITER member countries have been performing the researches to satisfy these requirements. As part of the international research trends on neutron activation fields, the Korean research group has been designing the demonstration fusion reactor, which is named K DEMO. In this study, the activation calculations of K DEMO were carried out, and then those calculation results were compared with the calculation results of ITER model. In addition to two main modules, the activation calculations for Vacuum Vessel (VV) were performed, because that component represents the containment integrity of the fusion reactor. Neutron flux distributions in the fusion reactor were provided by a MCNP calculation. The activation calculations were performed by FISPACT 2007 code. The calculated fluxes were employed to FISPACT for the activation calculation

  8. Find the weakest link. A comparison between demographic, genetic and demo-genetic metapopulation extinction times

    Directory of Open Access Journals (Sweden)

    Robert Alexandre

    2011-09-01

    Full Text Available Abstract Background While the ultimate causes of most species extinctions are environmental, environmental constraints have various secondary consequences on evolutionary and ecological processes. The roles of demographic, genetic mechanisms and their interactions in limiting the viabilities of species or populations have stirred much debate and remain difficult to evaluate in the absence of demography-genetics conceptual and technical framework. Here, I computed projected times to metapopulation extinction using (1 a model focusing on the effects of species properties, habitat quality, quantity and temporal variability on the time to demographic extinction; (2 a genetic model focusing on the dynamics of the drift and inbreeding loads under the same species and habitat constraints; (3 a demo-genetic model accounting for demographic-genetic processes and feedbacks. Results Results indicate that a given population may have a high demographic, but low genetic viability or vice versa; and whether genetic or demographic aspects will be the most limiting to overall viability depends on the constraints faced by the species (e.g., reduction of habitat quantity or quality. As a consequence, depending on metapopulation or species characteristics, incorporating genetic considerations to demographically-based viability assessments may either moderately or severely reduce the persistence time. On the other hand, purely genetically-based estimates of species viability may either underestimate (by neglecting demo-genetic interactions or overestimate (by neglecting the demographic resilience true viability. Conclusion Unbiased assessments of the viabilities of species may only be obtained by identifying and considering the most limiting processes (i.e., demography or genetics, or, preferentially, by integrating them.

  9. Quasi-linear modeling of lower hybrid current drive in ITER and DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Cardinali, A., E-mail: alessandro.cardinali@enea.it; Cesario, R.; Panaccione, L.; Santini, F.; Amicucci, L.; Castaldo, C.; Ceccuzzi, S.; Mirizzi, F.; Tuccillo, A. A. [ENEA, Unità Tecnica Fusione, Via E Fermi 45 Rome (Italy)

    2015-12-10

    First pass absorption of the Lower Hybrid waves in thermonuclear devices like ITER and DEMO is modeled by coupling the ray tracing equations with the quasi-linear evolution of the electron distribution function in 2D velocity space. As usually assumed, the Lower Hybrid Current Drive is not effective in a plasma of a tokamak fusion reactor, owing to the accessibility condition which, depending on the density, restricts the parallel wavenumber to values greater than n{sub ∥crit} and, at the same time, to the high electron temperature that would enhance the wave absorption and then restricts the RF power deposition to the very periphery of the plasma column (near the separatrix). In this work, by extensively using the “ray{sup star}” code, a parametric study of the propagation and absorption of the LH wave as function of the coupled wave spectrum (as its width, and peak value), has been performed very accurately. Such a careful investigation aims at controlling the power deposition layer possibly in the external half radius of the plasma, thus providing a valuable aid to the solution of how to control the plasma current profile in a toroidal magnetic configuration, and how to help the suppression of MHD mode that can develop in the outer part of the plasma. This analysis is useful not only for exploring the possibility of profile control of a pulsed operation reactor as well as the tearing mode stabilization, but also in order to reconsider the feasibility of steady state regime for DEMO.

  10. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  11. Integration of Communication Analysis and the OO Method: Manual derivation of the Conceptual Model. The SuperStationery Co. lab demo

    CERN Document Server

    España, Sergio; Pastor, Óscar; Ruiz, Marcela

    2011-01-01

    This document presents a lab demo that exemplifies the manual derivation of an OO Method conceptual model, taking as input a Communication Analysis requirements model. In addition, it is described how the conceptual model is created in the OLIVANOVA Modeler tool. The lab demo corresponds to part of the business processes of a fictional small and medium enterprise named SuperStationery Co. This company provides stationery and office material to its clients. The company acts as a as intermediary: the company has a catalogue of products that are bought from suppliers and sold to clients. This lab demo, besides illustrating the derivation technique, demonstrates that the technique is feasible in practice. Also, the results of this lab demo provide a valuable feedback in order to improve the derivation technique.

  12. DEMOS PLUS. Robot for decontaminating soils and cavity walls of the reactor and fuel pools NPP primarily during periods of recharging fuel

    International Nuclear Information System (INIS)

    In this work the robot Plus Demos, equipment that has been developed by GD Energy Services from the redesign and development of robot Demos show, which took place on last year. This evolution has given the team greater capabilities, highlighting the decontamination of vertical surfaces. The main objective pursued is to minimize operational doses to workers operating in cavity as well as the risk of surface contamination during them. (Author)

  13. Hermetisk AC-Krets

    OpenAIRE

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  14. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  15. Systematic cavity design approach for a multi-frequency gyrotron for DEMO and study of its RF behavior

    Science.gov (United States)

    Kalaria, P. C.; Avramidis, K. A.; Franck, J.; Gantenbein, G.; Illy, S.; Pagonakis, I. Gr.; Thumm, M.; Jelonnek, J.

    2016-09-01

    High frequency (>230 GHz) megawatt-class gyrotrons are planned as RF sources for electron cyclotron resonance heating and current drive in DEMOnstration fusion power plants (DEMOs). In this paper, for the first time, a feasibility study of a 236 GHz DEMO gyrotron is presented by considering all relevant design goals and the possible technical limitations. A mode-selection procedure is proposed in order to satisfy the multi-frequency and frequency-step tunability requirements. An effective systematic design approach for the optimal design of a gradually tapered cavity is presented. The RF-behavior of the proposed cavity is verified rigorously, supporting 920 kW of stable output power with an interaction efficiency of 36% including the considerations of realistic beam parameters.

  16. Effect of activation cross-section uncertainties on the radiological assessment of the MFE/DEMO first wall

    International Nuclear Information System (INIS)

    A Monte Carlo procedure has been applied in this work in order to address the impact of activation cross-sections (XS) uncertainties on contact dose rate and decay heat calculations for the outboard first wall (FW) of a magnetic fusion energy (MFE) demonstration (DEMO) reactor. The XSs inducing the major uncertainty in the prediction of activation related quantities have been identified. Results have shown that for times corresponding to maintenance activities the uncertainties effect is insignificant since the dominant XSs involved in these calculations are based on accurate experimental data evaluations. However, for times corresponding to waste management/recycling activities, the errors induced by the XSs uncertainties, which in this case are evaluated using systematic models, must be considered. It has been found that two particular isotopes, 6Co and 94Nb, are key contributors to the global DEMO FW activation uncertainty results. In these cases, the benefit from further improvements in the accuracy of the critical reaction XSs is discussed

  17. Effect of Activation Cross Section Uncertainties on the Radiological Assessment of the MFE/DEMO First Wall

    International Nuclear Information System (INIS)

    A Monte Carlo procedure has been applied in this work in order to address the impact of activation cross sections (XS) uncertainties on contact dose rate and decay heat calculations for the outboard first wall (FW) of a magnetic fusion energy (MFE) demonstration (DEMO) reactor. The XSs inducing the major uncertainty in the prediction of activation related quantities have been identified. Results have shown that for times corresponding to maintenance activities the uncertainties effect is insignificant since the dominant XSs involved in these calculations are based on accurate experimental data evaluations. However, for times corresponding to waste management/recycling activities, the errors induced by the XSs uncertainties, which in this case are evaluated using systematic models, must be considered. It has been found that two particular isotopes, 60Co and 94Nb, are key contributors to the global DEMO FW activation uncertainty results. In these cases, the benefit from further improvements in the accuracy of the critical reaction XSs is discussed

  18. The micro radiation environment monitor (MuREM) and SSTL radiation monitor (SSTL RM) on TechDemoSat-1

    OpenAIRE

    Taylor, B; Underwood, C.; Dyer, A.; Ashton, C.; Rason, S; Browning, J

    2012-01-01

    Two new miniaturized scientific radiation monitoring payloads are presented prior to their first flight on the TechDemoSat-1 Spacecraft. They are capable of monitoring the space radiation environment and its effects on radiation-sensitive devices. Micro radaion environment monitor (MuREM) and Surrey Satellite Technology radiation monitor (SSTL RM) carry RADFET dosimeters, dose-rate-sensitive photodiodes, and p-i-n diode particle detectors. SSTL RM is also connected to external RADFET sensors ...

  19. Concept design of the DEMO divertor cassette-to-vacuum vessel locking system adopting a systems engineering approach

    Energy Technology Data Exchange (ETDEWEB)

    Di Gironimo, G., E-mail: giuseppe.digironimo@unina.it [Università degli Studi di Napoli “Federico II”, Dipartimento di Ingegneria Industriale, Piazzale Tecchio 80, 80135 Napoli (Italy); Carfora, D. [Tampere University of Technology, Korkeakoulunkatu 6, 33720 Tampere (Finland); VTT Technical Research Centre of Finland, Tekniikankatu 1, PO Box 1300, FI-33101 Tampere (Finland); Università degli Studi di Napoli “Federico II”, Dipartimento di Ingegneria Industriale, Piazzale Tecchio 80, 80135 Napoli (Italy); Esposito, G.; Lanzotti, A.; Marzullo, D. [Università degli Studi di Napoli “Federico II”, Dipartimento di Ingegneria Industriale, Piazzale Tecchio 80, 80135 Napoli (Italy); Siuko, M. [VTT Technical Research Centre of Finland, Tekniikankatu 1, PO Box 1300, FI-33101 Tampere (Finland)

    2015-05-15

    Highlights: • An iterative and incremental design process for cassette-to-VV locking system of DEMO divertor is presented. • Three different concepts have been developed with a systematic design approach. • The final concept has been selected with Fuzzy-Analytic Hierarchy Process in virtual reality. - Abstract: This paper deals with pre-concept studies of DEMO divertor cassette-to-vacuum vessel locking system under the work program WP13-DAS-07-T06: Divertor Remote Maintenance System pre-concept study. An iterative design process, consistent with Systems Engineering guidelines and named Iterative and Participative Axiomatic Design Process (IPADeP), is used in this paper to propose new innovative solutions for divertor locking system, which can overcome the difficulties in applying the ITER principles to DEMO. The solutions conceived have been analysed from the structural point of view using the software Ansys and, eventually, evaluated using the methodology known as Fuzzy-Analytic Hierarchy Process. Due to the lack and the uncertainty of the requirements in this early conceptual design stage, the aim is to cover a first iteration of an iterative and incremental process to propose an innovative design concept to be developed in more details as the information will be completed.

  20. Concept design of the DEMO divertor cassette-to-vacuum vessel locking system adopting a systems engineering approach

    International Nuclear Information System (INIS)

    Highlights: • An iterative and incremental design process for cassette-to-VV locking system of DEMO divertor is presented. • Three different concepts have been developed with a systematic design approach. • The final concept has been selected with Fuzzy-Analytic Hierarchy Process in virtual reality. - Abstract: This paper deals with pre-concept studies of DEMO divertor cassette-to-vacuum vessel locking system under the work program WP13-DAS-07-T06: Divertor Remote Maintenance System pre-concept study. An iterative design process, consistent with Systems Engineering guidelines and named Iterative and Participative Axiomatic Design Process (IPADeP), is used in this paper to propose new innovative solutions for divertor locking system, which can overcome the difficulties in applying the ITER principles to DEMO. The solutions conceived have been analysed from the structural point of view using the software Ansys and, eventually, evaluated using the methodology known as Fuzzy-Analytic Hierarchy Process. Due to the lack and the uncertainty of the requirements in this early conceptual design stage, the aim is to cover a first iteration of an iterative and incremental process to propose an innovative design concept to be developed in more details as the information will be completed

  1. Benchmarking Reactor Systems Studies by Comparison of EU and Japanese System Code Results for Different DEMO Concepts

    International Nuclear Information System (INIS)

    Full text: Recent systems studies work within the Broader Approach framework has focussed on benchmarking the EU systems code PROCESS against the Japanese code TPC for conceptual DEMO designs. This paper describes benchmarking work for a conservative, pulsed DEMO and an advanced, steady-state, high-bootstrap fraction DEMO. The resulting former machine is an R0 = 10 m, a = 2.5 m, βN 0 = 8 m, a = 2.7 m), with βN = 3.0, enhanced confinement, and high bootstrap fraction fBS = 0.8. These options were chosen to test the codes across a wide range of parameter space. While generally in good agreement, some of the code outputs differ. In particular, differences have been identified in the impurity radiation models and flux swing calculations. The global effects of these differences are described and approaches to identifying the best models, including future experiments, are discussed. Results of varying some of the assumptions underlying the modelling are also presented, demonstrating the sensitivity of the solutions to technological limitations and providing guidance for where further research could be focussed. (author)

  2. Dynamic Emulation Modelling (DEMo) of large physically-based environmental models

    Science.gov (United States)

    Galelli, S.; Castelletti, A.

    2012-12-01

    In environmental modelling large, spatially-distributed, physically-based models are widely adopted to describe the dynamics of physical, social and economic processes. Such an accurate process characterization comes, however, to a price: the computational requirements of these models are considerably high and prevent their use in any problem requiring hundreds or thousands of model runs to be satisfactory solved. Typical examples include optimal planning and management, data assimilation, inverse modelling and sensitivity analysis. An effective approach to overcome this limitation is to perform a top-down reduction of the physically-based model by identifying a simplified, computationally efficient emulator, constructed from and then used in place of the original model in highly resource-demanding tasks. The underlying idea is that not all the process details in the original model are equally important and relevant to the dynamics of the outputs of interest for the type of problem considered. Emulation modelling has been successfully applied in many environmental applications, however most of the literature considers non-dynamic emulators (e.g. metamodels, response surfaces and surrogate models), where the original dynamical model is reduced to a static map between input and the output of interest. In this study we focus on Dynamic Emulation Modelling (DEMo), a methodological approach that preserves the dynamic nature of the original physically-based model, with consequent advantages in a wide variety of problem areas. In particular, we propose a new data-driven DEMo approach that combines the many advantages of data-driven modelling in representing complex, non-linear relationships, but preserves the state-space representation typical of process-based models, which is both particularly effective in some applications (e.g. optimal management and data assimilation) and facilitates the ex-post physical interpretation of the emulator structure, thus enhancing the

  3. Evaluation of energy and particle impact on the plasma facing components in DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Igitkhanov, Yuri, E-mail: juri.gitkhanov@ihm.fzk.de [Karlsruhe Institute of Technology, IHM, Karlsruhe (Germany); Bazylev, Boris [Karlsruhe Institute of Technology, IHM, Karlsruhe (Germany)

    2012-08-15

    Highlights: Black-Right-Pointing-Pointer We analyze the first wall blanket W/EUROFER configuration for DEMO under steady-state normal operation and off-normal conditions, such as vertical displacements events (VDE) and runaway electrons (RE). The main issue is to find the optimal thickness of the W armor which will prevent tungsten surface from evaporation and melting and, on the other hand, will keep EUROFER below the critical thermal stresses. Black-Right-Pointing-Pointer The minimum thickness of the tungsten amour about 3 mm for W/EUROFER sandwich structure will keep the maximum EUROFER temperature below the critical limit for EUROFER steel under steady-state operation and ITER like cooling conditions. Black-Right-Pointing-Pointer The W surface temperature and the max. EUROFER temperature are increasing with incoming heat flux. For reference conditions (Dw {approx}3 mm, DEUROFER {approx}4 mm) the maximum tolerable heat flux which does not causes in thermal stresses in structural material is about {approx}13.5 MW/m{sup 2}. Black-Right-Pointing-Pointer The RE deposit their energy deeper into W armour and for energies {>=}50 MJ/m{sup 2} and deposition times {<=}0.1 s, the minimum armor thickness required to prevent EUROFER from thermal distraction is {>=}1.4 cm. Black-Right-Pointing-Pointer However, at this thickness the W surface melts. For higher RE energy deposition rates ({>=}100 MJ/m{sup 2} in 0.1 s), the required armor thickness to prevent thermal destruction is even larger so that the bulk of the armor layer will melt and evaporate. - Abstract: We analyze the first wall blanket W/EUROFER configuration for DEMO under steady-state normal operation and off-normal conditions, such as vertical displacement events (VDE) and runaway electrons (RE). The main issue is to find the optimal thickness of the W armor which will prevent tungsten surface from evaporation and melting and, on the other hand, will keep EUROFER below the critical thermal stresses. Under steady

  4. Evaluation of energy and particle impact on the plasma facing components in DEMO

    International Nuclear Information System (INIS)

    Highlights: ► We analyze the first wall blanket W/EUROFER configuration for DEMO under steady-state normal operation and off-normal conditions, such as vertical displacements events (VDE) and runaway electrons (RE). The main issue is to find the optimal thickness of the W armor which will prevent tungsten surface from evaporation and melting and, on the other hand, will keep EUROFER below the critical thermal stresses. ► The minimum thickness of the tungsten amour about 3 mm for W/EUROFER sandwich structure will keep the maximum EUROFER temperature below the critical limit for EUROFER steel under steady-state operation and ITER like cooling conditions. ► The W surface temperature and the max. EUROFER temperature are increasing with incoming heat flux. For reference conditions (Dw ∼3 mm, DEUROFER ∼4 mm) the maximum tolerable heat flux which does not causes in thermal stresses in structural material is about ∼13.5 MW/m2. ► The RE deposit their energy deeper into W armour and for energies ≥50 MJ/m2 and deposition times ≤0.1 s, the minimum armor thickness required to prevent EUROFER from thermal distraction is ≥1.4 cm. ► However, at this thickness the W surface melts. For higher RE energy deposition rates (≥100 MJ/m2 in 0.1 s), the required armor thickness to prevent thermal destruction is even larger so that the bulk of the armor layer will melt and evaporate. - Abstract: We analyze the first wall blanket W/EUROFER configuration for DEMO under steady-state normal operation and off-normal conditions, such as vertical displacement events (VDE) and runaway electrons (RE). The main issue is to find the optimal thickness of the W armor which will prevent tungsten surface from evaporation and melting and, on the other hand, will keep EUROFER below the critical thermal stresses. Under steady-state operation heat transfer into the coolant must remain below the critical heat flux (CHF) to avoid the possible severe degradation of the coolant heat removal

  5. AC susceptibility of polycrystalline (Bi-Pb 2223 superconductors

    Directory of Open Access Journals (Sweden)

    H. Salamati

    2004-06-01

    Full Text Available   The temperature dependence of ac susceptibility of (Bi-Pb2223 polycrystalline samples was measured as a function of frequency and ac field amplitude. Analysis of the temperature dependence of the AC susceptibility near the transition temperature (Tc has been done employing Bean’s critical state model. The observed variation of intergranular critical current densities (Jc with temperature indicates that the weak links are superconductor- normal metal-superconductor (SNS type for this sample. The frequency effect on AC susceptibility was also measured. As the frequency increases, (TP shifts to higher temperatures. This effect can be interpreted in terms of flux creep. The temperature T, and field, , dependence of activation energy obtained from the Arrhenius plot for the frequency ( f and ( TP , can be described as: U(Hac,T=U0(1-T/TCHac-0.18

  6. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  7. Design of a water cooled monoblock divertor for DEMO using Eurofer as structural material

    Energy Technology Data Exchange (ETDEWEB)

    Richou, Marianne, E-mail: marianne.richou@cea.fr [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Li-Puma, Antonella [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Visca, Eliseo [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, IT-00044 Frascati (Italy)

    2014-10-15

    The performed investigation focus on a monoblock type design for a water cooled DEMO divertor using Eurofer as structural material. In 2013, a study case of such a concept was presented. It was shown that basic concepts using Eurofer as structural material are limited to an incident heat flux of 8 MW m{sup −2}. Since, the EFDA agency issued new specifications. In this study, the conceptual design is reassessed with regard to specifications. Then, steady state thermal analyses and thermo-mechanical elastic analyses have been performed to define an upgrade of the geometry taking into account new specifications, design criteria and the maximum heat flux requirement of 10 MW m{sup −2}. An analysis of the influence of each adjustable geometrical parameter on thermo-mechanical design criteria was performed. As a consequence, geometrical parameters were set in order to fit to materials requirements. For defined hydraulic conditions taken in the most favourable configuration, the limit of this design is estimated to an incident heat flux of 10 MW m{sup −2}. Margin to critical heat flux and rules against progressive deformation/ratcheting in structural material limit the design.

  8. Validation of a FAST Model of the Statoil-Hywind Demo Floating Wind Turbine

    Energy Technology Data Exchange (ETDEWEB)

    Driscoll, Frederick; Jonkman, Jason; Robertson, Amy; Sirnivas, Senu; Skaare, Bjorn; Nielsen, Finn Gunnar

    2016-09-01

    To assess the accuracy of the National Renewable Energy Laboratory's (NREL's) FAST simulation tool for modeling the coupled response of floating offshore wind turbines under realistic open-ocean conditions, NREL developed a FAST model of the Statoil Hywind Demo floating offshore wind turbine, and validated simulation results against field measurements. Field data were provided by Statoil, which conducted a comprehensive test measurement campaign of its demonstration system, a 2.3-MW Siemens turbine mounted on a spar substructure deployed about 10 km off the island of Karmoy in Norway. A top-down approach was used to develop the FAST model, starting with modeling the blades and working down to the mooring system. Design data provided by Siemens and Statoil were used to specify the structural, aerodynamic, and dynamic properties. Measured wind speeds and wave spectra were used to develop the wind and wave conditions used in the model. The overall system performance and behavior were validated for eight sets of field measurements that span a wide range of operating conditions. The simulated controller response accurately reproduced the measured blade pitch and power. The structural and blade loads and spectra of platform motion agree well with the measured data.

  9. Participation as Post-Fordist Politics: Demos, New Labour, and Science Policy.

    Science.gov (United States)

    Thorpe, Charles

    2010-12-01

    In recent years, British science policy has seen a significant shift 'from deficit to dialogue' in conceptualizing the relationship between science and the public. Academics in the interdisciplinary field of Science and Technology Studies (STS) have been influential as advocates of the new public engagement agenda. However, this participatory agenda has deeper roots in the political ideology of the Third Way. A framing of participation as a politics suited to post-Fordist conditions was put forward in the magazine Marxism Today in the late 1980s, developed in the Demos thinktank in the 1990s, and influenced policy of the New Labour government. The encouragement of public participation and deliberation in relation to science and technology has been part of a broader implementation of participatory mechanisms under New Labour. This participatory program has been explicitly oriented toward producing forms of social consciousness and activity seen as essential to a viable knowledge economy and consumer society. STS arguments for public engagement in science have gained influence insofar as they have intersected with the Third Way politics of post-Fordism. PMID:21258426

  10. Participation as Post-Fordist Politics: Demos, New Labour, and Science Policy.

    Science.gov (United States)

    Thorpe, Charles

    2010-12-01

    In recent years, British science policy has seen a significant shift 'from deficit to dialogue' in conceptualizing the relationship between science and the public. Academics in the interdisciplinary field of Science and Technology Studies (STS) have been influential as advocates of the new public engagement agenda. However, this participatory agenda has deeper roots in the political ideology of the Third Way. A framing of participation as a politics suited to post-Fordist conditions was put forward in the magazine Marxism Today in the late 1980s, developed in the Demos thinktank in the 1990s, and influenced policy of the New Labour government. The encouragement of public participation and deliberation in relation to science and technology has been part of a broader implementation of participatory mechanisms under New Labour. This participatory program has been explicitly oriented toward producing forms of social consciousness and activity seen as essential to a viable knowledge economy and consumer society. STS arguments for public engagement in science have gained influence insofar as they have intersected with the Third Way politics of post-Fordism.

  11. Characterisation of NEXT-DEMO using xenon K$_{\\alpha}$ X-rays

    CERN Document Server

    Lorca, D; Laing, A; Ferrario, P; Gómez-Cadenas, J J; Álvarez, V; Borges, F I G; Camargo, M; Cárcel, S; Cebrián, S; Cervera, A; Conde, C A N; Dafni, T; Díaz, J; Esteve, R; Fernandes, L M P; Ferreira, A L; Freitas, E D C; Gehman, V M; Goldschmidt, A; Gómez, H; González-Díaz, D; Gutiérrez, R M; Hauptman, J; Morata, J A Hernando; Herrera, D C; Irastorza, I G; Labarga, L; Liubarsky, I; Losada, M; Luzón, G; Marí, A; Martínez-Lema, G; Martínez, A; Miller, T; Monrabal, F; Monserrate, M; Monteiro, C M B; Mora, F J; Moutinho, L M; Vidal, J Muñoz; Nebot-Guinot, M; Nygren, D; Oliveira, C A B; Pérez, J; Aparicio, J L Pérez; Renner, J; Ripoll, L; Rodríguez, A; Rodríguez, J; Santos, F P; Santos, J M F dos; Seguí, L; Serra, L; Shuman, D; Simón, A; Sofka, C; Sorel, M; Toledo, J F; Torrent, J; Tsamalaidze, Z; Veloso, J F C A; Webb, R; White, J T; Yahlali, N

    2014-01-01

    The NEXT experiment aims to observe the neutrinoless double beta decay of $^{136}$Xe in a high pressure gas TPC using electroluminescence (EL) to amplify the signal from ionization. Understanding the response of the detector is imperative in achieving a consistent and well understood energy measurement. The abundance of xenon k-shell x-ray emission during data taking has been identified as a multitool for the characterisation of the fundamental parameters of the gas as well as the equalisation of the response of the detector. The NEXT-DEMO prototype is a ~1.5 kg volume TPC filled with natural xenon. It employs an array of 19 PMTs as an energy plane and of 256 SiPMs as a tracking plane with the TPC light tube and SiPM surfaces being coated with tetraphenyl butadiene (TPB) which acts as a wavelength shifter for the VUV scintillation light produced by xenon. This paper presents the measurement of the properties of the drift of electrons in the TPC, the effects of the EL production region, and the extraction of p...

  12. Laser-driven Beat-Wave Current Drive in Dense Plasmas with Demo on CTIX

    Science.gov (United States)

    Liu, Fei; Horton, Robert; Hwang, David; Zhu, Ben; Evans, Russell; Hong, Sean; Hsu, Scott

    2010-11-01

    The ability to remotely generate plasma current in dense plasmas hanging freely in vacuum in voluminous amount without obstruction to diagnostics will greatly enhance our ability to study the physics of high energy density plasmas in strong magnetic fields. Plasma current can be generated through nonlinear beat-wave process by launching two intense electromagnetic waves into unmagnetized plasma. Beat-wave acceleration of electrons has been demonstrated in a low-density plasma using microwaves [1]. The proposed PLX experimental facility presently under construction at Los Alamos offers the opportunity to test the method at a density level scalable to the study of HED plasmas. For PLX beat-wave experiments, CO2 lasers will be used as pump waves due to their high power and tunability. For a typical PLX density ne=10^17cm-3, two CO2 lasers can be separately tuned to 9P(28) and 10P(20) to match the 2.84THz plasma frequency. The beat-wave demo experiment will be conducted on CTIX. The laser arrangement is being converted to two independent single lasers. Frequency-tuning methods, optics focusing system and diagnostics system will be discussed. The laser measurements and results of synchronization of two lasers will be presented, and scaling to PLX experiments will be given. [1] Rogers, J. H. and Hwang, D. Q., PRL. v68 p3877 (1992).

  13. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  14. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  15. DEMOS PLUS. Robot for decontaminating soils and cavity walls of the reactor and fuel pools NPP primarily during periods of recharging fuel; DEMOS PLUS. Robot para la descontaminacion de suelos y paredes de la cavidad de reactor y piscinas de combustible de CC.NN. principalmente durante los periodos de recarga de combustible

    Energy Technology Data Exchange (ETDEWEB)

    Lacalle Bayo, J.; Vaquer Perez, J. I.; Rosello Garcia, J. I.

    2014-07-01

    In this work the robot Plus Demos, equipment that has been developed by GD Energy Services from the redesign and development of robot Demos show, which took place on last year. This evolution has given the team greater capabilities, highlighting the decontamination of vertical surfaces. The main objective pursued is to minimize operational doses to workers operating in cavity as well as the risk of surface contamination during them. (Author)

  16. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  17. Assessment of GPS Reflectometry from TechDemoSat-1 for Scatterometry and Altimetry Applications

    Science.gov (United States)

    Shah, R.; Hajj, G. A.

    2015-12-01

    The value of GPS reflectometry for scatterometry and altimetry applications has been a topic of investigation for the past two decades. TechDemoSat-1 (TDS-1), a technology demonstration satellite launched in July of 2014, with an instrument to collect GPS reflections from 4 GPS satellites simultaneously, provide the first extensive data that allows for validation and evaluation of GPS reflectometry from space against more established techniques. TDS-1 uses a high gain (~13 dBi) L1 antenna pointing 6 degrees off nadir with a 60ohalf-beam width. Reflected GPS L1 signals are processed into Delay Doppler Maps (DDMs) inside the receiver and made available (through Level-1b) along with metadata describing the bistatic geometry, antenna gain, etc., on a second-by-second basis for each of the 4 GPS tracks recorded at any given time. In this paper we examine level-1b data from TDS-1 for thousands of tracks collected over the span of Jan.-Feb., 2015. This data corresponds to reflections from various types of surfaces throughout the globe including ice, deserts, forests, oceans, lakes, wetlands, etc. Our analysis will consider how the surface type manifests itself in the DDMs (e.g., coherence vs. non-coherence reflection) and derivable physical quantities. We will consider questions regarding footprint resolution, waveform rise time and corresponding bistatic range accuracy, and level of precision for altimetry (sea surface height) and scatterometry (significant wave height and sea surface wind). Tracks from TDS-1 that coincide with Jason-1 or 2 tracks will be analyzed, where the latter can be used as truth for comparison and validation. Where coincidences are found, vertical delay introduced by the media as measured by Jason will be mapped to bistatic propagation path to correct for neutral atmospheric and ionospheric delays.

  18. Analysis of Different Uncertainty Activation Cross Section Data Libraries for LWR, ADS and DEMO Neutron Spectr

    Science.gov (United States)

    Díez, C. J.; Cabellos, O.; Martínez, J. S.

    2012-05-01

    This work is aimed to present the main differences of nuclear data uncertainties among three different nuclear data libraries: EAF-2007, EAF-2010 and SCALE-6.0, under different neutron spectra: LWR, ADS and DEMO (fusion). To take into account the neutron spectrum, the uncertainty data are collapsed to onegroup. That is a simple way to see the differences among libraries for one application. Also, the neutron spectrum effect on different applications can be observed. These comparisons are presented only for (n,fission), (n,gamma) and (n,p) reactions, for the main transuranic isotopes (234,235,236,238U, 237Np, 238,239,240,241Pu, 241,242m,243Am, 242,243,244,245,246,247,248Cm, 249Bk, 249,250,251,252Cf). But also general comparisons among libraries are presented taking into account all included isotopes. In other works, target accuracies are presented for nuclear data uncertainties; here, these targets are compared with uncertainties on the above libraries. The main results of these comparisons are that EAF-2010 has reduced their uncertainties for many isotopes from EAF-2007 for (n,gamma) and (n,fission) but not for (n,p); SCALE-6.0 gives lower uncertainties for (n,fission) reactions for ADS and PWR applications, but gives higher uncertainties for (n,p) reactions in all applications. For the (n,gamma) reaction, the amount of isotopes which have higher uncertainties is quite similar to the amount of isotopes which have lower uncertainties when SCALE-6.0 and EAF-2010 are compared. When the effect of neutron spectra is analysed, the ADS neutron spectrum obtained the highest uncertainties for (n,gamma) and (n,fission) reactions of all libraries.

  19. Low cycle fatigue behavior of ITER-like divertor target under DEMO-relevant operation conditions

    International Nuclear Information System (INIS)

    Highlights: • LCF behavior of the cooling tube and the interlayer of an ITER-like divertor target is studied. • For the cooling tube, LCF failure will not be an issue under an HHF load of up to 18 MW/m2. • Plastic strain in the interlayer is concentrated at the free surface edge of the bond interface. • The predicted LCF lifetime of the interlayer may not meet the design requirement. - Abstract: In this work the low cycle fatigue (LCF) behavior of the copper alloy cooling tube and the copper interlayer of an ITER-like divertor target is reported for nine different combinations of loading and cooling conditions relevant to DEMO divertor operation. The LCF lifetime is presented as a function of loading and cooling conditions considered here by means of cyclic plasticity simulation and using LCF data of materials relevant for ITER. The numerical predictions indicate, that fatigue failure will not be an issue for the copper alloy tube under a high heat flux (HHF) load of up to 18 MW/m2 as long as it preserves its initial strength. In contrast, the copper interlayer exhibits significant plastic dissipation at the free surface edge of the bond interface adjacent to the cooling tube, where the LCF lifetime is predicted to be below 3000 load cycles for HHF loads higher than 15 MW/m2. Most of the bulk region of the copper interlayer away from the free surface edge does not experience severe plastic fatigue and hence does not pose any critical concern as the LCF lifetime is predicted to be at least 7000 load cycles. LCF lifetime decreases as HHF load is increased or coolant temperature is decreased

  20. Maximal design basis accident of fusion neutron source DEMO-TIN

    Energy Technology Data Exchange (ETDEWEB)

    Kolbasov, B. N., E-mail: Kolbasov-BN@nrcki.ru [National Research Center Kurchatov Institute (Russian Federation)

    2015-12-15

    When analyzing the safety of nuclear (including fusion) facilities, the maximal design basis accident at which the largest release of activity is expected must certainly be considered. Such an accident is usually the failure of cooling systems of the most thermally stressed components of a reactor (for a fusion facility, it is the divertor or the first wall). The analysis of safety of the ITER reactor and fusion power facilities (including hybrid fission–fusion facilities) shows that the initial event of such a design basis accident is a large-scale break of a pipe in the cooling system of divertor or the first wall outside the vacuum vessel of the facility. The greatest concern is caused by the possibility of hydrogen formation and the inrush of air into the vacuum chamber (VC) with the formation of a detonating mixture and a subsequent detonation explosion. To prevent such an explosion, the emergency forced termination of the fusion reaction, the mounting of shutoff valves in the cooling systems of the divertor and the first wall or blanket for reducing to a minimum the amount of water and air rushing into the VC, the injection of nitrogen or inert gas into the VC for decreasing the hydrogen and oxygen concentration, and other measures are recommended. Owing to a continuous feed-out of the molten-salt fuel mixture from the DEMO-TIN blanket with the removal period of 10 days, the radioactivity release at the accident will mainly be determined by tritium (up to 360 PBq). The activity of fission products in the facility will be up to 50 PBq.

  1. Maximal design basis accident of fusion neutron source DEMO-TIN

    Science.gov (United States)

    Kolbasov, B. N.

    2015-12-01

    When analyzing the safety of nuclear (including fusion) facilities, the maximal design basis accident at which the largest release of activity is expected must certainly be considered. Such an accident is usually the failure of cooling systems of the most thermally stressed components of a reactor (for a fusion facility, it is the divertor or the first wall). The analysis of safety of the ITER reactor and fusion power facilities (including hybrid fission-fusion facilities) shows that the initial event of such a design basis accident is a large-scale break of a pipe in the cooling system of divertor or the first wall outside the vacuum vessel of the facility. The greatest concern is caused by the possibility of hydrogen formation and the inrush of air into the vacuum chamber (VC) with the formation of a detonating mixture and a subsequent detonation explosion. To prevent such an explosion, the emergency forced termination of the fusion reaction, the mounting of shutoff valves in the cooling systems of the divertor and the first wall or blanket for reducing to a minimum the amount of water and air rushing into the VC, the injection of nitrogen or inert gas into the VC for decreasing the hydrogen and oxygen concentration, and other measures are recommended. Owing to a continuous feed-out of the molten-salt fuel mixture from the DEMO-TIN blanket with the removal period of 10 days, the radioactivity release at the accident will mainly be determined by tritium (up to 360 PBq). The activity of fission products in the facility will be up to 50 PBq.

  2. Space Charge Neutralization of DEMO Relevant Negative Ion Beams at Low Gas Density

    International Nuclear Information System (INIS)

    The application of neutral beams to future power plant devices (DEMO) is dependent on achieving significantly improved electrical efficiency and the most promising route to achieving this is by implementing a photoneutralizer in place of the traditional gas neutralizer. A corollary of this innovation would be a significant reduction in the background gas density through which the beam is transported between the accelerator and the neutralizer. This background gas is responsible for the space charge neutralization of the beam, enabling distances of several metres to be traversed without significant beam expansion. This work investigates the sensitivity of a D- beam to reduced levels of space charge compensation for energies from 100 keV to 1.5 MeV, representative of a scaled prototype experiment, commissioning and full energy operation. A beam transport code, following the evolution of the phase space ellipse, is employed to investigate the effect of space charge on the beam optics. This shows that the higher energy beams are insensitive to large degrees of under compensation, unlike the lower energies. The probable degree of compensation at low gas density is then investigated through a simple, two component beam-plasma model that allows the potential to be negative. The degree of under-compensation is dependent on the positive plasma ion energy, one source of which is dissociation of the gas by the beam. The subsequent space charge state of the beam is shown to depend upon the relative times for equilibration of the dissociation energy and ionization by the beam ions.

  3. Low cycle fatigue behavior of ITER-like divertor target under DEMO-relevant operation conditions

    Energy Technology Data Exchange (ETDEWEB)

    Li, Muyuan; Werner, Ewald [Lehrstuhl für Werkstoffkunde und Werkstoffmechanik, Technische Universität München, Boltzmannstr. 15, 85748 Garching (Germany); You, Jeong-Ha, E-mail: you@ipp.mpg.de [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany)

    2015-01-15

    Highlights: • LCF behavior of the cooling tube and the interlayer of an ITER-like divertor target is studied. • For the cooling tube, LCF failure will not be an issue under an HHF load of up to 18 MW/m{sup 2}. • Plastic strain in the interlayer is concentrated at the free surface edge of the bond interface. • The predicted LCF lifetime of the interlayer may not meet the design requirement. - Abstract: In this work the low cycle fatigue (LCF) behavior of the copper alloy cooling tube and the copper interlayer of an ITER-like divertor target is reported for nine different combinations of loading and cooling conditions relevant to DEMO divertor operation. The LCF lifetime is presented as a function of loading and cooling conditions considered here by means of cyclic plasticity simulation and using LCF data of materials relevant for ITER. The numerical predictions indicate, that fatigue failure will not be an issue for the copper alloy tube under a high heat flux (HHF) load of up to 18 MW/m{sup 2} as long as it preserves its initial strength. In contrast, the copper interlayer exhibits significant plastic dissipation at the free surface edge of the bond interface adjacent to the cooling tube, where the LCF lifetime is predicted to be below 3000 load cycles for HHF loads higher than 15 MW/m{sup 2}. Most of the bulk region of the copper interlayer away from the free surface edge does not experience severe plastic fatigue and hence does not pose any critical concern as the LCF lifetime is predicted to be at least 7000 load cycles. LCF lifetime decreases as HHF load is increased or coolant temperature is decreased.

  4. The Logic-Based Supervisor Control for Sun-Tracking System of 1 MW HCPV Demo Plant: Study Case

    OpenAIRE

    Hong-Yih Yeh; Cheng-Dar Lee

    2012-01-01

    This paper presents a logic-based supervisor controller designed for trackers for a 1MW HCPV demo plant in Taiwan. A sun position sensor on the tracker is used to detect the sun position, as the sensor is sensitive to the intensity of sun light. The signal output of the sensor is partially affected by the cloud, which has a hard control position with the traditional PID control. Therefore we have used logic-based supervisor (LBS) control which permits switching the PID control to sun trajecto...

  5. Direct Experimental Observation of a Practical AC Zeeman Force

    Science.gov (United States)

    Fancher, Charles; Pyle, Andrew; Rotunno, Andrew; Du, Shuangli; Aubin, Seth

    2016-05-01

    We present measurements of the spin-dependent AC Zeeman force produced by microwave magnetic near-field gradients on an atom chip. We measure the AC Zeeman force on ultracold 87 Rb atoms by observing its effect on the motion of atoms in free-fall and on those confined in a trap. We have studied the force as a function of microwave frequency detuning from a hyperfine transition at 6.8 GHz at several magnetic field strengths and have observed its characteristic bipolar and resonant features predicted by two-level dressed atom theory. We find that the force is several times the strength of gravity in our setup, and that it can be targeted to a specific hyperfine transition while leaving other hyperfine states and transitions relatively unaffected. We find that our measurements are reasonably consistent with theory and are working towards a parameter-free comparison. AC Zeeman potentials offer the possibility of targeting qualitatively different trapping potentials to different spin states, a capability currently absent from the toolbox of atomic quantum control techniques. In particular, an AC Zeeman potential could be used as the beamsplitter for a spin-dependent atom interferometer or for engineering a quantum gate. Work supported by AFOSR and W&M, and in part by AFRL.

  6. Operation Method for AC Motor Control during Power Interruption in Direct AC/AC Converter System

    Science.gov (United States)

    Shizu, Keiichiro; Azuma, Satoshi

    Direct AC/AC converters have been studied due to their potential use in power converters with no DC-link capacitor, which can contribute to the miniaturization of power converters. However, the absence of a DC-link capacitor makes it difficult to control the AC motor during power interruption. First, this paper proposes a system that realizes AC motor control during power interruption by utilizing a clamp capacitor. In general, direct AC/AC converters have a clamp circuit consisting of a rectifier diode(s) and a clamp capacitor in order to avoid over-voltages. In the proposed system, there is an additional semiconductor switch reverse-parallel to the rectifier diode(s), and the clamp capacitor voltage can be utilized for AC motor control by turning on the additional switch. Second, this paper discusses an operation method for AC motor control and clamp capacitor voltage control during power interruption. In the proposed method “DC-link voltage control”, the kinetic energy in the AC motor is transformed into electrical energy and stored in the clamp capacitor; the clamp capacitor is therefore charged and the capacitor voltage is controlled to remain constant at an instruction value. Third, this paper discusses a switching operation during power interruption. A dead-time is introduced between the operation of turning off all switches on the rectifier side and the operation of turning on the additional switch, which prevents the occurrence of a short circuit between the interrupted power source and the clamp capacitor. Finally, experimental results are presented. During power interruptions, an output current was continuously obtained and the clamp capacitor voltage was maintained to be equal to the instruction value of the capacitor voltage. These results indicate that both AC motor control and capacitor voltage control were successfully achieved by using the proposed system.

  7. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  8. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  9. Effect of activation cross-section uncertainties on the radiological assessment of the MFE/DEMO first wall

    Energy Technology Data Exchange (ETDEWEB)

    Cabellos, O. [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, Madrid (Spain)]. E-mail: cabellos@din.upm.es; Reyes, S. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Sanz, J. [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, Madrid (Spain); University Nacional Educacion a Distancia, Dep. Ingenieria Energetica, Juan del Rosal 12, 28040 Madrid (Spain); Rodriguez, A. [University Nacional Educacion a Distancia, Dep. Ingenieria Energetica, Juan del Rosal 12, 28040 Madrid (Spain); Youssef, M. [University of California, Los Angeles, CA (United States); Sawan, M. [University of Wisconsin, Madison, WI (United States)

    2006-02-15

    A Monte Carlo procedure has been applied in this work in order to address the impact of activation cross-sections (XS) uncertainties on contact dose rate and decay heat calculations for the outboard first wall (FW) of a magnetic fusion energy (MFE) demonstration (DEMO) reactor. The XSs inducing the major uncertainty in the prediction of activation related quantities have been identified. Results have shown that for times corresponding to maintenance activities the uncertainties effect is insignificant since the dominant XSs involved in these calculations are based on accurate experimental data evaluations. However, for times corresponding to waste management/recycling activities, the errors induced by the XSs uncertainties, which in this case are evaluated using systematic models, must be considered. It has been found that two particular isotopes, {sup 6}Co and {sup 94}Nb, are key contributors to the global DEMO FW activation uncertainty results. In these cases, the benefit from further improvements in the accuracy of the critical reaction XSs is discussed.

  10. Tritium self-sufficiency of HCPB blanket modules for DEMO considering time-varying neutron flux spectra and material compositions

    Energy Technology Data Exchange (ETDEWEB)

    Aures, A., E-mail: Alexander.Aures@ccfe.ac.uk; Packer, L.W.; Zheng, S.

    2013-10-15

    Highlights: • Simulations on the tritium breeding performance of HCPB blanket modules were done. • MCNP5 and FISPACT were used for coupled transport and activation calculations. • Material transmutation affects the neutron flux spectra within the blanket modules. • The consequences of time-dependent spectra on TBR and tritium self-sufficiency were investigated. -- Abstract: Significant transmutation of solid-type breeding blanket materials affects the time and spatial variation of neutron energy within such materials. This has an impact on simulation assumptions required to accurately assess tritium surplus quantities for conceptual power plant devices. This paper details an investigation, via simulation, of the consequences for the tritium breeding ratio and the tritium self-sufficiency of a DEMO concept with homogeneous Helium-Cooled Pebble Bed blanket modules containing Li{sub 4}SiO{sub 4} ceramic breeder material. For this purpose, a code was developed to couple MCNP5 and FISPACT to supply material compositions from activation calculations to the neutron transport calculation in an iterative loop covering several time steps. Simulation results are presented for a simple 1D spherical device model and a DEMO tokamak model.

  11. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  12. Thermal-hydraulics analyses and external circuits layout for the EU DEMO water-cooled Pb-17Li blanket concept

    International Nuclear Information System (INIS)

    This paper describes the detailed thermal-hydraulics analyses performed on the EU reference design for DEMO water-cooled Pb-17Li blanket. It includes the calculation of pressure drops and flow-rates in the main fluid circuits (first-wall and Pb-17Li-pool water-cooling circuits and Pb-17Li circuit, for both inboard and outboard segments), and an Out-of-Vessel Loss-Of-Coolant Accident (LOCA) analysis showing that a LOCA in one of the two independent cooling-circuits does not lead to unacceptable temperatures in all parts of the blanket. A preliminary description of the external circuits layout (out-of-vessel) is also given in the paper. (orig.)

  13. Scoping of material response under DEMO neutron irradiation: comparison with fission and influence of nuclear library selection

    CERN Document Server

    Gilbert, M R

    2016-01-01

    Predictions of material activation inventories will be a key input to virtually all aspects of the operation, safety and environmental assessment of future fusion nuclear plants. Additionally, the neutron-induced transmutation (change) of material composition (inventory) with time, and the creation and evolution of configurational damage from atomic displacements, require precise quantification because they can lead to significant changes in material properties, and thus influence reactor-component lifetime. A comprehensive scoping study has been performed to quantify the activation, transmutation (depletion and build-up) and immediate damage response under neutron irradiation for all naturally occurring elements from hydrogen to bismuth. The resulting database provides a global picture of the response of a material, covering the majority of nuclear technological space, but focussing specifically on typical conditions expected for a demonstration fusion power plant (DEMO). Results from fusion are compared aga...

  14. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  15. Phase sensitive quantum interference on forbidden transition in ladder scheme

    CERN Document Server

    Koganov, Gennady A

    2014-01-01

    A three level ladder system is analyzed and the coherence of initially electric-dipole forbidden transition is calculated. Due to the presence of two laser fields the initially dipole forbidden transition becomes dynamically permitted due to ac Stark effect. It is shown that such transitions exhibit quantum-interference-related phenomena, such as electromagnetically induced transparency, gain without inversion and enhanced refractive index. Gain and dispersion characteristics of such transitions strongly depend upon the relative phase between the driving and the probe fields. Unlike allowed transitions, gain/absorption behavior of ac-Stark allowed transitions exhibit antisymmetric feature on the Rabi sidebands. It is found that absorption/gain spectra possess extremely narrow sub-natural resonances on these ac Stark allowed forbidden transitions. An interesting finding is simultaneous existence of gain and negative dispersion at Autler-Townes transition which may lead to both reduction of the group velocity a...

  16. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  17. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  18. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  19. Nuclear structure effects in the exotic decay of $^{225}$Ac via $^{14}$C emission

    CERN Document Server

    Bonetti, R; Guglielmetti, A; Matheoud, R; Migliorino, C; Pasinetti, A L; Ravn, H L

    1993-01-01

    By using a $^{225}$Ac source produced at the electromagnetic separator Isolde we collected on our track-recording glass detectors 305 $^{14}$C events from the radioactive decays of $^{225}$Ac and its daughter $^{221}$Fr and obtained, for $^{225}$Ac, a branching ratio B($^{14}$C/$\\alpha$)=(6.0 $\\pm$ 1.3) x 10$^{-12}$. Our result suggests that such a decay from an odd proton nucleus is dominated by transition to the ground or to the first excited state of daughter nucleus.

  20. SSTI Clark ACS Technology Demonstrations

    OpenAIRE

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  1. Apuntes de Acústica

    OpenAIRE

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  2. Energy saving in ac generators

    Science.gov (United States)

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  3. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  4. Combination of helical ferritic-steel inserts and flux-tube-expansion divertor for the heat control in tokamak DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Takizuka, T., E-mail: takizuka.tomonori@gmail.com [Graduate School of Engineering, Osaka University, 2-1 Yamadaoka, Suita 565-0871 (Japan); Tokunaga, S.; Hoshino, K. [Japan Atomic Energy Agency, 2-166, Omotedate, Obuchi, Rokkasho, Aomori 039-3212 (Japan); Shimizu, K. [Japan Atomic Energy Agency, 801-1, Mukoyama, Naka 311-0193 (Japan); Asakura, N. [Japan Atomic Energy Agency, 2-166, Omotedate, Obuchi, Rokkasho, Aomori 039-3212 (Japan)

    2015-08-15

    Edge localized modes (ELMs) in the H-mode operation of tokamak reactors may be suppressed/mitigated by the resonant magnetic perturbation (RMP), but RMP coils are considered incompatible with DEMO reactors under the strong neutron flux. We propose an innovative concept of the RMP without installing coils but inserting ferritic steels of the helical configuration. Helically perturbed field is naturally formed in the axisymmetric toroidal field through the helical ferritic steel inserts (FSIs). When ELMs are avoided, large stationary heat load on divertor plates can be reduced by adopting a flux-tube-expansion (FTE) divertor like an X divertor. Separatrix shape and divertor-plate inclination are similar to those of a simple long-leg divertor configuration. Combination of the helical FSIs and the FTE divertor is a suitable method for the heat control to avoid transient ELM heat pulse and to reduce stationary divertor heat load in a tokamak DEMO reactor.

  5. Developing Structural, High-heat flux and Plasma Facing Materials for a near-term DEMO Fusion Power Plant: the EU Assessment

    CERN Document Server

    Stork, D; Boutard, J-L; Buckthorpe, D; Diegele, E; Dudarev, S L; English, C; Federici, G; Gilbert, M R; Gonzalez, S; Ibarra, A; Linsmeier, Ch; Puma, A Li; Marbach, G; Morris, P F; Packer, L W; Raj, B; Rieth, M; Tran, M Q; Ward, D J; Zinkle, S J

    2014-01-01

    The findings of the EU 'Materials Assessment Group' (MAG), within the 2012 EU Fusion Roadmap exercise, are discussed. MAG analysed the technological readiness of structural, plasma facing and high heat flux materials for a DEMO concept to be constructed in the early 2030s, proposing a coherent strategy for R&D up to a DEMO construction decision. Technical consequences for the materials required and the development, testing and modelling programmes, are analysed using: a systems engineering approach, considering reactor operational cycles, efficient maintenance and inspection requirements, and interaction with functional materials/coolants; and a project-based risk analysis, with R&D to mitigate risks from material shortcomings including development of specific risk mitigation materials.

  6. The DEMO trial: a randomized, parallel-group, observer-blinded clinical trial of strength versus aerobic versus relaxation training for patients with mild to moderate depression

    DEFF Research Database (Denmark)

    2009-01-01

    OBJECTIVE: To assess the benefit and harm of exercise training in adults with clinical depression. METHOD: The DEMO trial is a randomized pragmatic trial for patients with unipolar depression conducted from January 2005 through July 2007. Patients were referred from general practitioners or psych......OBJECTIVE: To assess the benefit and harm of exercise training in adults with clinical depression. METHOD: The DEMO trial is a randomized pragmatic trial for patients with unipolar depression conducted from January 2005 through July 2007. Patients were referred from general practitioners......: Our findings do not support a biologically mediated effect of exercise on symptom severity in depressed patients, but they do support a beneficial effect of strength training on work capacity. TRIAL REGISTRATION: (ClinicalTrials.gov) Identifier: NCT00103415....

  7. On the use of double-walled tubes as a means to improve safety and availability of the EU DEMO Water-Cooled Pb-17Li blanket

    International Nuclear Information System (INIS)

    The impact on the blanket reliability and availability of both double-walled tube and welded joint failures in the Water-Cooled Pb-17Li Demo Single-Box blanket reference design is examined. The pertinence of employing a leak detection system is analysed and its contribution to the blanket safety and availability is evaluated. The contribution of welded joints to the blanket safety and availability is evaluated in normal operation. (orig.)

  8. Performance of tungsten-based materials and components under ITER and DEMO relevant steady-state thermal loads

    Energy Technology Data Exchange (ETDEWEB)

    Ritz, Guillaume Henri

    2011-07-01

    In nuclear fusion devices the surfaces directly facing the plasma are irradiated with high energy fluxes. The most intense loads are deposited on the divertor located at the bottom of the plasma chamber, which has to withstand continuous heat loads with a power density of several MW . m{sup -2} as well as transient events. These are much shorter (in the millisecond and sub-millisecond regime) but deposit a higher power densities of a few GW . m{sup -2}. The search for materials that can survive to those severe loading conditions led to the choice of tungsten which possesses advantageous attributes such as a high melting point, high thermal conductivity, low thermal expansion and an acceptable activation rate. These properties made it an attractive and promising candidate as armor material for divertors of future fusion devices such as ITER and DEMO. For the DEMO divertor, conceptual studies on helium-cooled tungsten plasma-facing components were performed. The concept was realized and tested under DEMO specific cyclic thermal loads. The examination of the plasma-facing components by microstructural analyses before and after thermal loading enabled to determine the mechanisms for components failure. Among others, it clearly showed the impact of the tungsten grade and the thermal stress induced crack formation on the performance of the armor material and in general of the plasma-facing component under high heat loads. A tungsten qualification program was launched to study the behaviour of various tungsten grades, in particular the crack formation, under fusion relevant steady-state thermal loads. In total, seven commercially available materials from two industrial suppliers were investigated. As the material's thermal response is strongly related to its microstructure, this program comprised different material geometries and manufacturing technologies. It also included the utilization of an actively cooled specimen holder which has been designed to perform

  9. Performance of tungsten-based materials and components under ITER and DEMO relevant steady-state thermal loads

    International Nuclear Information System (INIS)

    In nuclear fusion devices the surfaces directly facing the plasma are irradiated with high energy fluxes. The most intense loads are deposited on the divertor located at the bottom of the plasma chamber, which has to withstand continuous heat loads with a power density of several MW . m-2 as well as transient events. These are much shorter (in the millisecond and sub-millisecond regime) but deposit a higher power densities of a few GW . m-2. The search for materials that can survive to those severe loading conditions led to the choice of tungsten which possesses advantageous attributes such as a high melting point, high thermal conductivity, low thermal expansion and an acceptable activation rate. These properties made it an attractive and promising candidate as armor material for divertors of future fusion devices such as ITER and DEMO. For the DEMO divertor, conceptual studies on helium-cooled tungsten plasma-facing components were performed. The concept was realized and tested under DEMO specific cyclic thermal loads. The examination of the plasma-facing components by microstructural analyses before and after thermal loading enabled to determine the mechanisms for components failure. Among others, it clearly showed the impact of the tungsten grade and the thermal stress induced crack formation on the performance of the armor material and in general of the plasma-facing component under high heat loads. A tungsten qualification program was launched to study the behaviour of various tungsten grades, in particular the crack formation, under fusion relevant steady-state thermal loads. In total, seven commercially available materials from two industrial suppliers were investigated. As the material's thermal response is strongly related to its microstructure, this program comprised different material geometries and manufacturing technologies. It also included the utilization of an actively cooled specimen holder which has been designed to perform sophisticated material

  10. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  11. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  12. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  13. Development of ac corona discharge modes at atmospheric pressure

    International Nuclear Information System (INIS)

    Corona discharges in gases exist under several distinctive forms. In this paper, a survey study has been made of ac corona discharge modes generated in some different gases fed in a wire-duct reactor with a constant rate of flowing at atmospheric pressure. The properties of different corona modes are analyzed under some condition transitions from Trichel pulses to a steady glow. In the course of the presented experimental work, numerous apparent contradictions with earlier observations necessitated further study and are given to provide more information on the physical mechanisms of the ac corona discharges. Furthermore, we have gained insight into some new technologies and applications of the environmentally friendly corona and plasma discharges.

  14. Monitoring colloidal stability of polymer-coated magnetic nanoparticles using AC susceptibility measurements.

    Science.gov (United States)

    Herrera, Adriana P; Barrera, Carola; Zayas, Yashira; Rinaldi, Carlos

    2010-02-15

    The application of the response of magnetic nanoparticles to oscillating magnetic fields to probe transitions in colloidal state and structure of polymer-coated nanoparticles is demonstrated. Cobalt ferrite nanoparticles with narrow size distribution were prepared and shown to respond to oscillating magnetic fields through a Brownian relaxation mechanism, which is dependent on the mechanical coupling between the particle dipoles and the surrounding matrix. These nanoparticles were coated with covalently-attached poly(N-isopropylacrylamide) (pNIPAM) or poly(N-isopropylmethacrylamide) (pNIPMAM) through free radical polymerization. The temperature induced transitions of colloidal suspensions of these nanoparticles were studied through a combination of differential scanning calorimetry (DSC), dynamic light scattering (DLS), and AC susceptibility measurements. In the pNIPAM coated nanoparticles excellent agreement was found for a transition temperature of approximately 30 degrees C by all three methods, although the AC susceptibility measurements indicated aggregation which was not evident from the DLS results. Small-angle neutron scattering (SANS) results obtained for pNIPAM coated nanoparticles confirmed that aggregation indeed occurs above the lower critical transition temperature of pNIPAM. For the pNIPMAM coated nanoparticles DLS and AC susceptibility measurements indicated aggregation at a temperature of approximately 33-35 degrees C, much lower than the transition temperature peak at 40 degrees C observed by DSC. However, the transition observed by DSC is very broad, hence it is possible that aggregation begins to occur at temperatures lower than the peak, as indicated by the AC susceptibility and DLS results. These experiments and observations demonstrate the possibility of using AC susceptibility measurements to probe transitions in colloidal suspensions induced by external stimuli. Because magnetic measurements do not require optical transparency, these

  15. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  16. Potential and limits of water cooled divertor concepts based on monoblock design as possible candidates for a DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Li-Puma, Antonella, E-mail: antonella.lipuma@cea.fr [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Richou, Marianne; Magaud, Philippe; Missirlian, Marc [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Visca, Eliseo [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, IT-00044 Frascati (Italy); Ridolfini, Vincenzo Pericoli [EFDA-CSU Garching, PPPT department, D-85748 Garching bei München (Germany)

    2013-10-15

    In this paper water-cooled divertor concepts based on tungsten monoblock design identified in previous studies as candidate for fusion power plant have been reviewed to assess their potential and limits as possible candidates for a DEMO concept deliverable in a short to medium term (“conservative baseline design”). The rationale and technology development assumptions that have led to their selection are revisited taking into account present factual information on reactor parameters, materials properties and manufacturing technologies. For that purpose, main parameters impacting the divertor design are identified and their relevance discussed. The state of the art knowledge on materials and relevant manufacturing techniques is reviewed. Particular attention is paid to material properties change after irradiation; phenomenon thresholds (if any) and possible operating ranges are identified (in terms of temperature and damage dose). The suitability of various proposed heat sink/structural and sacrificial layer materials, as proposed in the past, are re-assessed (e.g. with regard to the possibility of reducing peak heat flux and/or neutron radiation damages). As a result, potential and limits of various proposed concepts are highlighted, ranges in which they could operate (if any) defined and possible improvements are proposed. Identified missing point in materials database and/or manufacturing techniques knowledge that should be uppermost investigated in future R and D activities are reported. This work has been carried out in the frame of EFDA PPPT Work Programme activities.

  17. Design of a Multi-Tube Pd-Membrane Module for Tritium Recovery from He in DEMO

    Directory of Open Access Journals (Sweden)

    Marco Incelli

    2016-10-01

    Full Text Available Dense self-supported Pd-alloy membranes are used to selectively separate hydrogen and hydrogen isotopes. In particular, deuterium (D and tritium (T are currently identified as the main elements for the sustainability of the nuclear fusion reaction aimed at carbon free power generation. In the fusion nuclear reactors, a breeding blanket produces the tritium that is extracted and purified before being sent to the plasma chamber in order to sustain the fusion reaction. In this work, the application of Pd-alloy membranes has been tested for recovering tritium from a solid breeding blanket through a helium purge stream. Several simulations have been performed in order to optimize the design of a Pd-Ag multi-tube module in terms of geometry, operating parameters, and membrane module configuration (series vs. parallel. The results demonstrate that a pre-concentration stage before the Pd-membrane unit is mandatory because of the very low tritium concentration in the He which leaves the breeding blanket of the fusion reactor. The most suitable operating conditions could be reached by: (i increasing the hydrogen partial pressure in the lumen side and (ii decreasing the shell pressure. The preliminary design of a membrane unit has been carried out for the case of the DEMO fusion reactor: the optimized membrane module consists of an array of 182 Pd-Ag tubes of 500 mm length, 10 mm diameter, and 0.100 mm wall thickness (total active area of 2.85 m2.

  18. Tritium self-sufficiency time and inventory evolution for solid-type breeding blanket materials for DEMO

    Science.gov (United States)

    Packer, L. W.; Pampin, R.; Zheng, S.

    2011-10-01

    One of the primary functions of a fusion blanket is to generate enough tritium to make a fusion power plant (FPP) self-sufficient. To ensure that there is satisfactory tritium production in a real plant the tritium breeding ratio (TBR) in the blanket must be greater than 1 + M, where M is the breeding margin. For solid-type blanket designs, the initial TBR must be significantly higher than 1 + M, since the blanket TBR will be reduced over time as the lithium fuel is consumed. The rate of TBR reduction will impact on the overall blanket self-sufficiency time, the time in which the net tritium inventory of the system is positive. DEMO relevant blanket materials, Li 4SiO 4 and Li 2TiO 3, are investigated by computational simulation using radiation transport tools coupled with time-dependent inventory calculations. The results include tritium inventory assessments and depletion of breeding materials over time, which enable self-sufficiency times and maximum surplus tritium inventories to be evaluated, which are essential quantities to determine to allow one to design a credible FPP using solid-type breeding material concepts. The blanket concepts investigated show self-sufficiency times of several years in some cases and maximum surplus inventories of up to a few tens of kg.

  19. Breeding zone models of DEMO ceramic helium cooled blanket test module for testing in IVV-2M reactor

    International Nuclear Information System (INIS)

    The goal of DEMO ceramic helium cooled blanket test module (CHC BTM) is to demonstrate a breeding capability that would lead to tritium self-sufficiency in ITER reactor and to extract a high-grade heat suitable for electricity generation. Experimental validation of all the adopted design solutions is main important problem at design and calculation works carrying out in order to develop the CHC BTM. One important task for breeding zones feasibility validation is in-pile tests. Two models were developed and fabricated for testing in the fission IVV-2M reactor. Breeding zone is based on poloidal BIT-conception. The models structural material is ferrito-martensitic steel. Breeder material is lithium orthosilicate in pebble beds and pellet forms. Multiplier material is beryllium in pebble beds and porosity forms. The cooling is provided by helium at 10 MPa. The tritium produced in the breeder material is purged by the helium flow at 0.1-0.2 MPa. Designs of model description and experimental channel, results of neutronic and thermo-hydraulic calculations are presented in the paper. (orig.)

  20. Potential and limits of water cooled divertor concepts based on monoblock design as possible candidates for a DEMO reactor

    International Nuclear Information System (INIS)

    In this paper water-cooled divertor concepts based on tungsten monoblock design identified in previous studies as candidate for fusion power plant have been reviewed to assess their potential and limits as possible candidates for a DEMO concept deliverable in a short to medium term (“conservative baseline design”). The rationale and technology development assumptions that have led to their selection are revisited taking into account present factual information on reactor parameters, materials properties and manufacturing technologies. For that purpose, main parameters impacting the divertor design are identified and their relevance discussed. The state of the art knowledge on materials and relevant manufacturing techniques is reviewed. Particular attention is paid to material properties change after irradiation; phenomenon thresholds (if any) and possible operating ranges are identified (in terms of temperature and damage dose). The suitability of various proposed heat sink/structural and sacrificial layer materials, as proposed in the past, are re-assessed (e.g. with regard to the possibility of reducing peak heat flux and/or neutron radiation damages). As a result, potential and limits of various proposed concepts are highlighted, ranges in which they could operate (if any) defined and possible improvements are proposed. Identified missing point in materials database and/or manufacturing techniques knowledge that should be uppermost investigated in future R and D activities are reported. This work has been carried out in the frame of EFDA PPPT Work Programme activities

  1. Neutronic design studies of a conceptual DCLL fusion reactor for a DEMO and a commercial power plant

    Science.gov (United States)

    Palermo, I.; Veredas, G.; Gómez-Ros, J. M.; Sanz, J.; Ibarra, A.

    2016-01-01

    Neutronic analyses or, more widely, nuclear analyses have been performed for the development of a dual-coolant He/LiPb (DCLL) conceptual design reactor. A detailed three-dimensional (3D) model has been examined and optimized. The design is based on the plasma parameters and functional materials of the power plant conceptual studies (PPCS) model C. The initial radial-build for the detailed model has been determined according to the dimensions established in a previous work on an equivalent simplified homogenized reactor model. For optimization purposes, the initial specifications established over the simplified model have been refined on the detailed 3D design, modifying material and dimension of breeding blanket, shield and vacuum vessel in order to fulfil the priority requirements of a fusion reactor in terms of the fundamental neutronic responses. Tritium breeding ratio, energy multiplication factor, radiation limits in the TF coils, helium production and displacements per atom (dpa) have been calculated in order to demonstrate the functionality and viability of the reactor design in guaranteeing tritium self-sufficiency, power efficiency, plasma confinement, and re-weldability and structural integrity of the components. The paper describes the neutronic design improvements of the DCLL reactor, obtaining results for both DEMO and power plant operational scenarios.

  2. Development of Thermal-hydraulic Analysis Methodology for Multi-module Breeding Blankets in K-DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Geon-Woo; Lee, Jeong-Hun; Park, Goon-Cherl; Cho, Hyoung-Kyu [Seoul National University, Seoul (Korea, Republic of); Im, Kihak [National Fusion Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    In this paper, the purpose of the analyses is to extend the capability of MARS-KS to the entire blanket system which includes a few hundreds of single blanket modules. Afterwards, the plan for the whole blanket system analysis using MARS-KS is introduced and the result of the multiple blanket module analysis is summarized. A thermal-hydraulic analysis code for a nuclear reactor safety, MARS-KS, was applied for the conceptual design of the K-DEMO breeding blanket thermal analysis. Then, a methodology to simulate multiple blanket modules was proposed, which uses a supervisor program to handle each blanket module individually at first and then distribute the flow rate considering pressure drops arises in each module. For a feasibility test of the proposed methodology, 10 outboard blankets in a toroidal field sector were simulated, which are connected with each other through the inlet and outlet common headers. The calculation results of flow rates, pressure drops, and temperatures showed the validity of the calculation and thanks to the parallelization using MPI, almost linear speed-up could be obtained.

  3. DC and AC transport properties on La0.8Sr0.2MnO3

    Institute of Scientific and Technical Information of China (English)

    Zhantao Wei; Xinsheng Yang; Li Lv; Min Zhang; Yong Zhang

    2014-01-01

    Magnetoresistive sensor can be widely used in modern transportation field, such as the vehicle positioning and navigation system, vehicle detection system, and intelligent transportation system. In order to improve the efficiency of magnetoresistive sensor, we synthesized La0.8Sr0.2MnO3 polycrystalline bulks at different sintering temperatures and investigated their DC and AC transport properties in this work. As a result, all samples showed insulator-metal (I-M) phase transition, and the transition temperature (TI-M) shifted to higher temperature with the increase of sintering temperature. The TI-M measured at different AC frequencies was smaller than that measured at DC condition, which implied that the I-M phase transition was suppressed at AC frequencies. The resistivity mea-sured at high AC frequencies was larger than that measured at low AC frequencies, which could be attributed to the change of the magnetic penetration depth (d). However, the room-temperature AC-magnetoresistance (MR) at low frequencies was much larger than that at high frequencies and room-temperature DC-MR. These findings demon-strate that reducing the AC frequency is an effective way for enhancing the room-temperature MR, which can be used to promote the efficiency of magnetoresistive sensor.

  4. A DEVICE FOR MEASURING SUPERCONDUCTING TRANSITION TEMPERATURE BY AC SUSCEPTIBILITY MEASUREMENT OF SUPERCONDUCTING FILM IN SMALL ^* CRYOCOOLER%在小型制冷机中测量薄片交流磁化率以决定超导转变温度的装置

    Institute of Scientific and Technical Information of China (English)

    褚向华; 王三胜; 杨慧; 陈笃行

    2012-01-01

    In this paper, a device for measuring superconducting transition temperature in small cryocooler, based on principles of electromagnetic induction and superconducting magnetic effect, is introduced. This device consists of a vacuum chamber, a small cryocooler, a vacuum pump, a vacuum gauge, a lock-in amplifier, a temperature controller, a computer and a coil pancake and so on. The coil pancake, which is fixed in the vacuum claamoer, contains a primary coil and secondary coil, the primary coil and secondary coil are respectively wound onto two coil formers. The measured superconducting thin film is put between the primary coil and the secondary coil. The small cryocooler is used to cool superconducting thin film, the vacuum pump is used to pump gas in the vacuum chamber, and the temperature controller is used to measure and control the temperature of superconducting thin filro. The internal oscillator of the lock-in amplifier is connected to the primary coil to provide an excitation field exerted to the superconducting film. At the same time, the lock-in amplifier is used to measure the response of the secondary coil. In our system, the sample temperature datum and the voltage output of the secondary coil are transmitted and saved in the computer; then these datum can be drawn into V--T lines displayed on the computer screen at real time. Experiments show that this device can be used to obtain superconducting transition temperature automatically by measuring ac susceptibility with a lower cost.%本文介绍了一种利用电磁感应原理和超导磁效应,在小型制冷机中测量超导体转变温度的装置.本装置包括密闭的真空室、压缩制冷机、真空泵、真空计、锁相放大器、温控仪、计算机、线圈绕组.其中,线圈绕组置于真空室内,由初级线圈和次级线圈组成,初级线圈和次级线圈分别绕制在两个线圈骨架上;被测超导薄片材料放置于初级线圈和次级线圈之间

  5. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  6. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  7. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  8. ac electroosmosis in rectangular microchannels.

    Science.gov (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  9. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  10. Shape Dependence of Low-Temperature Magnetic Relaxation of Mn12Ac

    Institute of Scientific and Technical Information of China (English)

    LIU Hai-Qing; SU Shao-Kui; JING Xiu-nian; LIU Ying; LI Yan-rong; HE Lun-Hua; GE Pei-Wen; YAN Qi-Wei; WANG Yun-Ping

    2008-01-01

    We report the discovery that the low-temperature magnetic relaxation in Mn,12 Ac single crystals strongly depends on the shape of the samples. The relaxation time exhibits a minimum at the phase transition point between ferromagnetic and antiferromagnetic phases. The shape dependence is attributed to the dipolar interaction between molecular magnets.

  11. Current distribution effects in AC impedance spectroscopy of electroceramic point contact and thin film model electrodes

    DEFF Research Database (Denmark)

    Nielsen, Jimmi; Jacobsen, Torben

    2010-01-01

    The Finite-Element-Method (FEM) was used for the simulations of the effect of a changing current distribution during AC impedance spectrum recording on electroceramic point contact and thin film model electrodes. For pure electronic conducting point contact electrodes the transition from the prim...

  12. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  13. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  14. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  15. Role of demonstration projects in innovation: transition to sustainable energy and transport

    DEFF Research Database (Denmark)

    Klitkou, Antje; Coenen, Lars; Andersen, Per Dannemand;

    2013-01-01

    from road transport, and climate changes caused by greenhouse gas emissions, all these crises have contributed to a sense of urgency in political statements on the need for transition towards a sustainable society. Politicians have developed different types of instruments to achieve a development......Transition towards more sustainability has been on the agenda of politicians, researchers, industry and concerned societal actors for a number of years. The oil crisis in the 1970s, environmental concerns related to decreasing biodiversity, depleted natural resources, cities polluted by emissions...... review with a short but to our mind relevant account of transition theory. Our literature review is guided by the research questions for the InnoDemo project: 1. What are the main contributions of Scandinavian demonstration and trial projects and programmes to sustainable energy and transport transitions...

  16. Maintenance duration estimate for a DEMO fusion power plant, based on the EFDA WP12 pre-conceptual studies

    International Nuclear Information System (INIS)

    Highlights: •Time to replace the blankets and divertor cassettes for a single sector is estimated to be approaching 1000 h. •Time to replace just the blankets is the same as for the blankets and divertor because the divertor must be removed first. •Four remote handling systems would be required to operate in parallel to meet the PPCS 75% availability target. •Rapid remote maintenance is essential for an economically viable fusion reactor. -- Abstract: The erosion and high neutron flux in a fusion power plant results in the need for frequent remote replacement of the plasma facing components. This is a complex and time consuming remote handling operation and its duration directly affects the availability and therefore the commercial viability of the power plant. A tool is needed to allow the maintenance duration to be determined so that developments in component design can be assessed in terms of their effect on the maintenance duration. This allows the correct balance to be drawn between component cost and performance on the one hand and the remote handling cost and plant availability on the other. The work to develop this tool has begun with an estimate of the maintenance duration for a fusion power plant based on the EFDA DEMO WP12 pre-conceptual design studies. The estimate can be readily adjusted for changes to the remote maintenance process resulting from design changes. The estimate uses data extrapolated from recorded times and operational experience from remote maintenance activities on the JET tokamak and other nuclear facilities. The Power Plant Conceptual Study from 2005 proposes that commercial viability of a power plant would require an availability of 75% or above. Results from the maintenance estimate described in this paper suggest that this level of availability could be achieved for the planned maintenance using a highly developed and tested remote maintenance system, with a large element of parallel working and challenging but feasible

  17. Influence of thermal performance on design parameters of a He/LiPb dual coolant DEMO concept blanket design

    International Nuclear Information System (INIS)

    Spanish Breeding Blanket Technology Programme TECNOFUS is exploring the technological capabilities of a Dual-Coolant He/Pb15.7Li breeding blanket for DEMO and studying new breeding blanket design specifications. The progress of the channel conceptual design is being conducted in parallel with the extension of MHD computational capabilities of CFD tools and the underlying physics of MHD models. A qualification of MHD effects under present blanket design specifications and some approaches to their modelling were proposed by the authors in . The analysis was accomplished with the 2D transient algorithm from Sommeria and Moreau and implemented in the OpenFOAM CFD toolbox . The thermal coupling was implemented by means of the Boussinesq hypothesis. Previous analyses showed the need of improvement of FCI thickness and thermal properties in order to obtain a desirable liquid metal temperature gain of 300 °C. In the present study, an assessment through sensitivity and parametric analyses of the required FCI thickness is performed. Numerical simulations have been carried out considering a Robin-type thermal boundary condition which assumes 1D steady state thermal balance across the solid FCI and Eurofer layers. Such boundary condition has been validated with a fluid–solid coupled domain analysis. Results for the studied flow conditions and channel dimensions show that, in order to obtain a liquid metal temperature gain of about 300 °C, the required FCI material should have a very small effective heat transfer coefficient ((k/δ) ≤ 1 W/m2K) and fluid velocities should be about 0.2 m/s or less. Moreover, special attention has to be placed on the temperature difference across the FCI layer. However, for a maximised liquid metal thermal gain, higher velocities would be preferable, what would also imply a reduced temperature difference across the FCI layer.

  18. Influence of thermal performance on design parameters of a He/LiPb dual coolant DEMO concept blanket design

    Energy Technology Data Exchange (ETDEWEB)

    Mas de les Valls, E., E-mail: elisabet.masdelesvalls@gits.ws [Technical University of Catalonia (UPC), Jordi Girona 1-3, 08034 Barcelona (Spain); Technology for Fusion (T4F) Research Group, GREENER, Department of Heat Engines, Barcelona (Spain); Batet, L. [Technical University of Catalonia (UPC), Jordi Girona 1-3, 08034 Barcelona (Spain); Technology for Fusion (T4F) Research Group, GREENER, Department of Physics and Nuclear Engineering, Barcelona (Spain); Medina, V. de [Technical University of Catalonia (UPC), Jordi Girona 1-3, 08034 Barcelona (Spain); Sediment Transport Research Group, Department of Engineering Hydraulic, Marine and Environmental Engineering, Barcelona (Spain); Fradera, J. [Technical University of Catalonia (UPC), Jordi Girona 1-3, 08034 Barcelona (Spain); Technology for Fusion (T4F) Research Group, GREENER, Department of Physics and Nuclear Engineering, Barcelona (Spain); Sanmarti, M. [bFUS-IREC, Jardins de les Dones de Negre 1, 08930 Sant Adria del Besos (Spain); Sedano, L.A. [EURATOM-CIEMAT Association, 28040 Madrid (Spain)

    2012-08-15

    Spanish Breeding Blanket Technology Programme TECNO{sub F}US is exploring the technological capabilities of a Dual-Coolant He/Pb15.7Li breeding blanket for DEMO and studying new breeding blanket design specifications. The progress of the channel conceptual design is being conducted in parallel with the extension of MHD computational capabilities of CFD tools and the underlying physics of MHD models. A qualification of MHD effects under present blanket design specifications and some approaches to their modelling were proposed by the authors in . The analysis was accomplished with the 2D transient algorithm from Sommeria and Moreau and implemented in the OpenFOAM CFD toolbox . The thermal coupling was implemented by means of the Boussinesq hypothesis. Previous analyses showed the need of improvement of FCI thickness and thermal properties in order to obtain a desirable liquid metal temperature gain of 300 Degree-Sign C. In the present study, an assessment through sensitivity and parametric analyses of the required FCI thickness is performed. Numerical simulations have been carried out considering a Robin-type thermal boundary condition which assumes 1D steady state thermal balance across the solid FCI and Eurofer layers. Such boundary condition has been validated with a fluid-solid coupled domain analysis. Results for the studied flow conditions and channel dimensions show that, in order to obtain a liquid metal temperature gain of about 300 Degree-Sign C, the required FCI material should have a very small effective heat transfer coefficient ((k/{delta}) {<=} 1 W/m{sup 2}K) and fluid velocities should be about 0.2 m/s or less. Moreover, special attention has to be placed on the temperature difference across the FCI layer. However, for a maximised liquid metal thermal gain, higher velocities would be preferable, what would also imply a reduced temperature difference across the FCI layer.

  19. On radio frequency current drive in the ion cyclotron range of frequencies in DEMO and large ignited plasmas

    International Nuclear Information System (INIS)

    To explore the possibility of efficient fast wave current drive in an ignited plasma in the ion cyclotron (IC) range of frequency in spite of competition from absorption by ions, we have added to the full-wave toroidal code TORIC a set of subroutines which evaluate absorption by these particles at IC harmonic resonances, using a realistic ‘slowing-down’ distribution function, and taking into account that their Larmor radius is comparable or even larger than the fast wave wavelength. The thermalized population of α-particles is not a serious competitor for power absorption as long as their number density is compatible with maintenance of ignition. By contrast, the energetic slowing down fraction, in spite of its even greater dilution, can absorb from the waves a substantial amount of power at the cyclotron resonance and its harmonics. An extensive exploration both in frequency and in toroidal wavenumbers using the parameters of one of the European versions of DEMO shows that three frequency windows exist in which damping is nevertheless predominantly on the electrons. Designing an antenna capable of shaping the launched spectrum to optimize current drive, however, will not be straightforward. Only in a narrow range when the first IC harmonic of tritium is deep inside the plasma on the high-field side of the magnetic axis, and that of deuterium and helium is still outside on the low-field side, it appears possible to achieve a satisfactory current drive efficiency with a conventional multi-strap antenna, preferentially located in the upper part of the vessel. Exploiting the other two windows at quite low and quite high frequencies is either impossible on first principles, or will demand novel ideas in antenna design. (paper)

  20. On radio frequency current drive in the ion cyclotron range of frequencies in DEMO and large ignited plasmas

    Science.gov (United States)

    Brambilla, Marco; Bilato, Roberto

    2015-02-01

    To explore the possibility of efficient fast wave current drive in an ignited plasma in the ion cyclotron (IC) range of frequency in spite of competition from absorption by ions, we have added to the full-wave toroidal code TORIC a set of subroutines which evaluate absorption by these particles at IC harmonic resonances, using a realistic ‘slowing-down’ distribution function, and taking into account that their Larmor radius is comparable or even larger than the fast wave wavelength. The thermalized population of α-particles is not a serious competitor for power absorption as long as their number density is compatible with maintenance of ignition. By contrast, the energetic slowing down fraction, in spite of its even greater dilution, can absorb from the waves a substantial amount of power at the cyclotron resonance and its harmonics. An extensive exploration both in frequency and in toroidal wavenumbers using the parameters of one of the European versions of DEMO shows that three frequency windows exist in which damping is nevertheless predominantly on the electrons. Designing an antenna capable of shaping the launched spectrum to optimize current drive, however, will not be straightforward. Only in a narrow range when the first IC harmonic of tritium is deep inside the plasma on the high-field side of the magnetic axis, and that of deuterium and helium is still outside on the low-field side, it appears possible to achieve a satisfactory current drive efficiency with a conventional multi-strap antenna, preferentially located in the upper part of the vessel. Exploiting the other two windows at quite low and quite high frequencies is either impossible on first principles, or will demand novel ideas in antenna design.

  1. Anomalous behavior of magnetostriction and magnetic ac-suseptibility of Gd1-xPrxCo5 polycrystals

    Directory of Open Access Journals (Sweden)

    A. Amirabadizadeh

    2003-12-01

    Full Text Available Magnetostriction and low field ac-susceptibility of polycrystalline Gd1-xPrxCo5 (x = 0, 0.1 and 0.5 alloys are measured in temperature region of 77-300 K. XRD patterns show that our samples are single phase. For x = 0 (GdCo5 there are no anomaly in temperature dependence of magnetostriction and ac-susceptibility curves. For x = 0.1 and 0.5 temperature dependence of ac-susceptibilities show easy-axes phase transitions. In the case of x = 0.1 sample, the easy-axes of magnetization changes from canted to axial (practically, hexagonal c-axis direction as temperature increases, and ac-susceptibility of x = 0.5 sample shows two iterative transitions, first from basal to canted then canted to axial. Magnetostriction of Pr contained samples anomalously decreases at spin reorientation regions.

  2. Cluster emission in the radioactive decay of 223Ac

    CERN Document Server

    Steyn, G F; Faccio, D; Bonetti, R; Tretyakova, S P; Shishkin, S V; Ogloblin, A A; Pik-Pichak, G A; Vermeulen, C; van der Meulen, N P; van der Walt, T N; McGee, D

    2010-01-01

    The branching ratio of 223Ac decay by spontaneous 14C emission was measured and a search for 15N clusters was performed. After exposure of a hemispherical array of solid-state nuclear track detectors, 347 14C events were identified and no 15N events. B(14C) = λ(14C)/λ(α) = (3.2 ± 1.0) x 10-11 is consistent with a favoured ground state to ground state transition. As no nitrogen tracks were found, only an upper limit could be inferred for 15N emission, B(15N) = λ(15N)/λ(α) ≤ 2.2 x 10-13 (confidence limit 90%), consistent with an unfavoured transition. Intense 227Pa sources were produced for this study, using the reaction 232Th(p,6n)227Pa. This offered an opportunity to compare the measured source strength with predictions based on published excitation function data.

  3. Current generation by helicons and LH waves in modern tokamaks and reactors FNSF-AT, ITER and DEMO. Scenarios, modeling and antennae

    Science.gov (United States)

    Vdovin, V.

    2014-02-01

    The Innovative concept and 3D full wave code modeling Off-axis current drive by RF waves in large scale tokamaks, reactors FNSF-AT, ITER and DEMO for steady state operation with high efficiency was proposed [1] to overcome problems well known for LH method [2]. The scheme uses the helicons radiation (fast magnetosonic waves at high (20-40) IC frequency harmonics) at frequencies of 500-1000 MHz, propagating in the outer regions of the plasmas with a rotational transform. It is expected that the current generated by Helicons will help to have regimes with negative magnetic shear and internal transport barrier to ensure stability at high normalized plasma pressure βN > 3 (the so-called Advanced scenarios) of interest for FNSF and the commercial reactor. Modeling with full wave three-dimensional codes PSTELION and STELEC2 showed flexible control of the current profile in the reactor plasmas of ITER, FNSF-AT and DEMO [2,3], using multiple frequencies, the positions of the antennae and toroidal waves slow down. Also presented are the results of simulations of current generation by helicons in tokamaks DIII-D, T-15MD and JT-60SA [3]. In DEMO and Power Plant antenna is strongly simplified, being some analoge of mirrors based ECRF launcher, as will be shown. For spherical tokamaks the Helicons excitation scheme does not provide efficient Off-axis CD profile flexibility due to strong coupling of helicons with O-mode, also through the boundary conditions in low aspect machines, and intrinsic large amount of trapped electrons, as is shown by STELION modeling for the NSTX tokamak. Brief history of Helicons experimental and modeling exploration in straight plasmas, tokamaks and tokamak based fusion Reactors projects is given, including planned joint DIII-D - Kurchatov Institute experiment on helicons CD [1].

  4. Multiple Module Simulation of Water Cooled Breeding Blankets in K-DEMO Using Thermal-Hydraulic Analysis Code MARS-KS

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Geon-Woo; Lee, Jeong-Hun; Park, Goon-Cherl; Cho, Hyoung-Kyu [Seoul National University, Seoul (Korea, Republic of); Im, Kihak [National Fusion Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    A preliminary concept for the Korean fusion demonstration reactor (K-DEMO) has been studied by the National Fusion Research Institute (NFRI) based on the National Fusion Roadmap of Korea. The feasibility studies have been performed in order to establish the conceptual design guidelines of the breeding blanket. As a part of the NFRI research, Seoul National University (SNU) is conducting thermal design, evaluation and validation of the water-cooled breeding blanket for the K-DEMO reactor. The purpose of this study is to extend the capability of MARS-KS to the overall blanket system analysis which includes 736 blanket modules in total. The strategy for the multi-module blanket system analysis using MARS-KS is introduced and the analysis result of the 46 blanket modules of single sector was summarized. A thermal-hydraulic analysis code for a nuclear reactor safety, MARS-KS, was applied for thermal analysis of the conceptual design of the K-DEMO breeding blanket. Then, a methodology to simulate multiple blanket modules was proposed, which uses a supervisor program to handle each blanket module individually at first and then distribute the flow rate considering the pressure drop that occurs in each module. For a feasibility test of the proposed methodology, 46 blankets in a sector, which are connected with each other through the common headers for the sector inlet and outlet, were simulated. The calculation results of flow rates, pressure drops, and temperatures showed the validity of the calculation. Because of parallelization using the MPI system, the computational time could be reduced significantly. In future, this methodology will be extended to an efficient simulation of multiple sectors, and further validation for transient simulation will be carried out for more practical applications.

  5. DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-05-01

    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  6. 聚变示范堆气体注入系统氚渗透分析%Tritium permeation of gas injection system for DEMO

    Institute of Scientific and Technical Information of China (English)

    王俊; 张国书; 张龙

    2014-01-01

    以中国聚变工程实验堆(CFETR)的堆芯参数为例,参照ITER的相关工程设计,对聚变示范堆(DEMO)气体注入系统(GIS)作出了初步的管道布局考虑。基于此布局,计算了稳态运行下 GIS 含氚管道气流压降,对燃料储存与输运系统的泵压头提出了要求,得出相应泵压头下GIS的氚渗透量。计算结果表明,重力势是管道气流压降的主要原因,在负压情况下,GIS的氚渗透对整体氚循环的影响不大。这为研究DEMO的氚自持问题提供了相关参数,为GIS歧管布局的进一步优化奠定了基础。%In the present work, tritium permeation issue of gas injection system (GIS) in DEMO were focused. Based on the reactor core parameters of Chian Fusion Engineering Test Reactor (CFETR) and referring to accumulated experience of GIS design in ITER, preliminary pipes layout of DEMO GIS was performed. Steady-state tritium gas pressure drop calculation along the pipes and pump head request to the fuel storage and delivery system were made on the basis of the GIS’s structure layout. Tritium permeation under corresponding pump head was calculated at the same time. According to the calculation results, gravitational potential is the main determinant to pressure drop in pipe flow and the tritium permeation in GIS is of little amount to the whole tritium cycle in the case negative pressure. So this work offers related parameters to tritium self-sufficiency issues in DEMO, and also lays the foundation for further optimization of GIS’s structure layout.

  7. Examining the Link Between Public Transit Use and Active Commuting

    Directory of Open Access Journals (Sweden)

    Melissa Bopp

    2015-04-01

    Full Text Available Background: An established relationship exists between public transportation (PT use and physical activity. However, there is limited literature that examines the link between PT use and active commuting (AC behavior. This study examines this link to determine if PT users commute more by active modes. Methods: A volunteer, convenience sample of adults (n = 748 completed an online survey about AC/PT patterns, demographic, psychosocial, community and environmental factors. t-test compared differences between PT riders and non-PT riders. Binary logistic regression analyses examined the effect of multiple factors on AC and a full logistic regression model was conducted to examine AC. Results: Non-PT riders (n = 596 reported less AC than PT riders. There were several significant relationships with AC for demographic, interpersonal, worksite, community and environmental factors when considering PT use. The logistic multivariate analysis for included age, number of children and perceived distance to work as negative predictors and PT use, feelings of bad weather and lack of on-street bike lanes as a barrier to AC, perceived behavioral control and spouse AC were positive predictors. Conclusions: This study revealed the complex relationship between AC and PT use. Further research should investigate how AC and public transit use are related.

  8. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  9. Dosimetric impact evaluation of primary coolant chemistry of the internal tritium breeding cycle of a fusion reactor DEMO

    International Nuclear Information System (INIS)

    Tritium will be responsible for a large fraction of the environmental impact of the first generation of DT fusion reactors. Today, the efforts of conceptual development of the tritium cycle for DEMO are mainly centred in the so called Inner Breeding Tritium Cycle, conceived as guarantee of reactor fuel self-sufficiency. The EU Fusion Programme develops for the short term of fusion power technology two breeding blanket conceptual designs both helium cooled. One uses Li-ceramic material (HCPB, Helium-Cooled Pebble Bed) and the other a liquid metal eutectic alloy (Pb15.7Li) (HCLL, Helium-Cooled Lithium Lead). Both are Li-6 enriched materials. At a proper scale designs will be tested as Test Blanket Modules in ITER. The tritium cycles linked to both blanket concepts are similar, with some different characteristics. The tritium is recovered from the He purge gas in the case of HCPB, and directly from the breeding alloy through a carrier gas in HCLL. For a 3 GWth self-sufficient fusion reactor the tritium breeding need is few hundred grams of tritium per day. Safety and environmental impact are today the top priority design criteria. Dose impact limits should determine the key margins and parameters in its conception. Today, transfer from the cycle to the environment is conservatively assumed to be operating in a 1-enclosure scheme through the tritium plant power conversion system (intermediate heat exchangers and helium blowers). Tritium loss is caused by HT and T2 permeation and simultaneous primary coolant leakage through steam generators. Primary coolant chemistry appears to be the most natural way to control tritium permeation from the breeder into primary coolant and from primary coolant through SG by H2 tritium flux isotopic swamping or steel (EUROFER/INCOLOY) oxidation. A primary coolant chemistry optimization is proposed. Dynamic flow process diagrams of tritium fluxes are developed ad-hoc and coupled with tritiated effluents dose impact evaluations. Dose

  10. Dosimetric impact evaluation of primary coolant chemistry of the internal tritium breeding cycle of a fusion reactor DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Velarde, M. [Instituto de Fusion Nuclear (DENIM), ETSII, Universidad Politecnica Madrid UPM, J. Gutierrez Abascal 2, Madrid 28006 (Spain); Sedano, L. A. [Asociacion Euratom-Ciematpara Fusion, Av. Complutense 22, 28040 Madrid (Spain); Perlado, J. M. [Instituto de Fusion Nuclear (DENIM), ETSII, Universidad Politecnica Madrid UPM, J. Gutierrez Abascal 2, Madrid 28006 (Spain)

    2008-07-15

    Tritium will be responsible for a large fraction of the environmental impact of the first generation of DT fusion reactors. Today, the efforts of conceptual development of the tritium cycle for DEMO are mainly centred in the so called Inner Breeding Tritium Cycle, conceived as guarantee of reactor fuel self-sufficiency. The EU Fusion Programme develops for the short term of fusion power technology two breeding blanket conceptual designs both helium cooled. One uses Li-ceramic material (HCPB, Helium-Cooled Pebble Bed) and the other a liquid metal eutectic alloy (Pb15.7Li) (HCLL, Helium-Cooled Lithium Lead). Both are Li-6 enriched materials. At a proper scale designs will be tested as Test Blanket Modules in ITER. The tritium cycles linked to both blanket concepts are similar, with some different characteristics. The tritium is recovered from the He purge gas in the case of HCPB, and directly from the breeding alloy through a carrier gas in HCLL. For a 3 GWth self-sufficient fusion reactor the tritium breeding need is few hundred grams of tritium per day. Safety and environmental impact are today the top priority design criteria. Dose impact limits should determine the key margins and parameters in its conception. Today, transfer from the cycle to the environment is conservatively assumed to be operating in a 1-enclosure scheme through the tritium plant power conversion system (intermediate heat exchangers and helium blowers). Tritium loss is caused by HT and T{sub 2} permeation and simultaneous primary coolant leakage through steam generators. Primary coolant chemistry appears to be the most natural way to control tritium permeation from the breeder into primary coolant and from primary coolant through SG by H{sub 2} tritium flux isotopic swamping or steel (EUROFER/INCOLOY) oxidation. A primary coolant chemistry optimization is proposed. Dynamic flow process diagrams of tritium fluxes are developed ad-hoc and coupled with tritiated effluents dose impact evaluations

  11. DEMO-II trial. Aerobic exercise versus stretching exercise in patients with major depression-a randomised clinical trial.

    Directory of Open Access Journals (Sweden)

    Jesper Krogh

    Full Text Available BACKGROUND: The effect of referring patients from a clinical setting to a pragmatic exercise intervention for depressive symptoms, cognitive function, and metabolic variables has yet to be determined. METHODS: Outpatients with major depression (DSM-IV were allocated to supervised aerobic or stretching exercise groups during a three months period. The primary outcome was the Hamilton depression score (HAM-D(17. Secondary outcomes were cognitive function, cardiovascular risk markers, and employment related outcomes. RESULTS: 56 participants were allocated to the aerobic exercise intervention versus 59 participants to the stretching exercise group. Post intervention the mean difference between groups was -0.78 points on the HAM-D(17 (95% CI -3.2 to 1.6; P = .52. At follow-up, the participants in the aerobic exercise group had higher maximal oxygen uptake (mean difference 4.4 l/kg/min; 95% CI 1.7 to 7.0; P = .001 and visuospatial memory on Rey's Complex Figure Test (mean difference 3.2 points; 95% CI 0.9 to 5.5; P = .007 and lower blood glucose levels (mean difference 0.2 mmol/l; 95% CI 0.0 to 0.5; P = .04 and waist circumference (mean difference 2.2 cm; 95% CI 0.3 to 4.1; P = .02 compared with the stretching exercise group. CONCLUSIONS: The results of this trial does not support any antidepressant effect of referring patients with major depression to a three months aerobic exercise program. Due to lower recruitment than anticipated, the trial was terminated prior to reaching the pre-defined sample size of 212 participants; therefore the results should be interpreted in that context. However, the DEMO-II trial does suggest that an exercise program for patients with depression offer positive short-term effects on maximal oxygen uptake, visuospatial memory, fasting glucose levels, and waist circumference. TRIAL REGISTRATION: ClinicalTrials.gov NCT00695552.

  12. Normal operation and maintenance safety lessons from the ITER US PbLi test blanket module program for a US FNSF and DEMO

    International Nuclear Information System (INIS)

    A leading power reactor breeding blanket candidate for a fusion demonstration power plant (DEMO) being pursued by the US Fusion Community is the Dual Coolant Lead Lithium (DCLL) concept. The safety hazards associated with the DCLL concept as a reactor blanket have been examined in several US design studies. These studies identify the largest radiological hazards as those associated with the dust generation by plasma erosion of plasma blanket module first walls, oxidation of blanket structures at high temperature in air or steam, inventories of tritium bred in or permeating through the ferritic steel structures of the blanket module and blanket support systems, and the 210Po and 203Hg produced in the PbLi breeder/coolant. What these studies lack is the scrutiny associated with a licensing review of the DCLL concept. An insight into this process was gained during the US participation in the ITER Test Blanket Module (TBM) Program. In this paper we discuss the lessons learned during this activity and make safety proposals for the design of a Fusion Nuclear Science Facility (FNSF) or a DEMO that employs a lead lithium breeding blanket

  13. TBM/MTM for HTS-FNSF: An Innovative Testing Strategy to Qualify/Validate Fusion Technologies for U.S. DEMO

    Directory of Open Access Journals (Sweden)

    Laila El-Guebaly

    2016-08-01

    Full Text Available The qualification and validation of nuclear technologies are daunting tasks for fusion demonstration (DEMO and power plants. This is particularly true for advanced designs that involve harsh radiation environment with 14 MeV neutrons and high-temperature operating regimes. This paper outlines the unique qualification and validation processes developed in the U.S., offering the only access to the complete fusion environment, focusing on the most prominent U.S. blanket concept (the dual cooled PbLi (DCLL along with testing new generations of structural and functional materials in dedicated test modules. The venue for such activities is the proposed Fusion Nuclear Science Facility (FNSF, which is viewed as an essential element of the U.S. fusion roadmap. A staged blanket testing strategy has been developed to test and enhance the DCLL blanket performance during each phase of FNSF D-T operation. A materials testing module (MTM is critically important to include in the FNSF as well to test a broad range of specimens of future, more advanced generations of materials in a relevant fusion environment. The most important attributes for MTM are the relevant He/dpa ratio (10–15 and the much larger specimen volumes compared to the 10–500 mL range available in the International Fusion Materials Irradiation Facility (IFMIF and European DEMO-Oriented Neutron Source (DONES.

  14. Normal and Accidental Scenarios Analyses with MELCOR 1.8.2 and MELCOR 2.1 for the DEMO Helium-Cooled Pebble Bed Blanket Concept

    Directory of Open Access Journals (Sweden)

    Bruno Gonfiotti

    2015-01-01

    Full Text Available As for Light Water Reactors (LWRs, one of the most challenging accidents for the future DEMOnstration power plant is the Loss of Coolant Accident, which can trigger the pressurization of the confinement structures and components. Hence, careful analyses have to be executed to demonstrate that the confinement barriers are able to withstand the pressure peak within design limits and the residual cooling capabilities of the Primary Heat Transfer System are sufficient to remove the decay heat. To do so, severe accident codes, as MELCOR, can be employed. In detail, the MELCOR code has been developed to cope also with fusion reactors, but unfortunately, these fusion versions are based on the old 1.8.x source code. On the contrary, for LWRs, the newest 2.1.x versions are continuously updated. Thanks to the new features introduced in these latest 2.1.x versions, the main phenomena occurring in the helium-cooled blanket concepts of DEMO can be simulated in a basic manner. For this purpose, several analyses during normal and accidental DEMO conditions have been executed. The aim of these analyses is to compare the results obtained with MELCOR 1.8.2 and MELCOR 2.1 in order to highlight the differences among the results of the main thermal-hydraulic parameters.

  15. Developing structural, high-heat flux and plasma facing materials for a near-term DEMO fusion power plant: The EU assessment

    Energy Technology Data Exchange (ETDEWEB)

    Stork, D., E-mail: derek.stork@btinternet.com [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Agostini, P. [ENEA, Brasimone Research Centre, 40032 Cumugnano, Bologna (Italy); Boutard, J.L. [CEA, cab HC, Saclay, F-91191 Gif-sur-Yvette (France); Buckthorpe, D. [AMEC, Booths Park, Chelford Road, Knutsford, Cheshire WA16 8QZ (United Kingdom); Diegele, E. [Karlsruhe Institute for Technology, IMF-I, D-7602 Karlsruhe (Germany); Dudarev, S.L. [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); English, C. [National Nuclear Laboratory, Chadwick House, Warrington Road, Birchwood Park WA3 6AE (United Kingdom); Federici, G. [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching 85748 (Germany); Gilbert, M.R. [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Gonzalez, S. [EFDA Power Plant Physics and Technology, Boltzmannstr. 2, Garching 85748 (Germany); Ibarra, A. [CIEMAT, Avda. Complutense 40, Madrid (Spain); Linsmeier, Ch. [Forschungszentrum Jülich GmbH, Institut für Energie- und Klimaforschung – Plasmaphysik, EURATOM Association, 52425 Jülich (Germany); Li Puma, A. [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Marbach, G. [CEA, cab HC, Saclay, F-91191 Gif-sur-Yvette (France); Morris, P.F. [Formerly of TATA Steel Europe, Swinden Technology Centre, Moorgate, Rotherham S60 3AR (United Kingdom); Packer, L.W. [Euratom – CCFE Association, Culham Science Centre, Abingdon, Oxfordshire OX14 3DB (United Kingdom); Raj, B. [Indian National Academy of Engineering, Shaheed Jeet Singh Marg, New Delhi 110016 (India); Rieth, M. [Karlsruhe Institute for Technology, IMF-I, D-7602 Karlsruhe (Germany); and others

    2014-12-15

    The findings of the EU ‘Materials Assessment Group’ (MAG), within the 2012 EU Fusion Roadmap exercise, are discussed. MAG analysed the technological readiness of structural, plasma facing and high heat flux materials for a DEMO concept to be constructed in the early 2030s, proposing a coherent strategy for R and D up to a DEMO construction decision. A DEMO phase I with a ‘Starter Blanket’ and ‘Starter Divertor’ is foreseen: the blanket being capable of withstanding ⩾2 MW yr m{sup −2} fusion neutron fluence (∼20 dpa in the front-wall steel). A second phase ensues for DEMO with ⩾5 MW yr m{sup −2} first wall neutron fluence. Technical consequences for the materials required and the development, testing and modelling programmes, are analysed using: a systems engineering approach, considering reactor operational cycles, efficient maintenance and inspection requirements, and interaction with functional materials/coolants; and a project-based risk analysis, with R and D to mitigate risks from material shortcomings including development of specific risk mitigation materials. The DEMO balance of plant constrains the blanket and divertor coolants to remain unchanged between the two phases. The blanket coolant choices (He gas or pressurised water) put technical constraints on the blanket steels, either to have high strength at higher temperatures than current baseline variants (above 650 °C for high thermodynamic efficiency from He-gas coolant), or superior radiation-embrittlement properties at lower temperatures (∼290–320 °C), for construction of water-cooled blankets. Risk mitigation proposed would develop these options in parallel, and computational and modelling techniques to shorten the cycle-time of new steel development will be important to achieve tight R and D timescales. The superior power handling of a water-cooled divertor target suggests a substructure temperature operating window (∼200–350 °C) that could be realised, as a

  16. Developing structural, high-heat flux and plasma facing materials for a near-term DEMO fusion power plant: The EU assessment

    Science.gov (United States)

    Stork, D.; Agostini, P.; Boutard, J. L.; Buckthorpe, D.; Diegele, E.; Dudarev, S. L.; English, C.; Federici, G.; Gilbert, M. R.; Gonzalez, S.; Ibarra, A.; Linsmeier, Ch.; Li Puma, A.; Marbach, G.; Morris, P. F.; Packer, L. W.; Raj, B.; Rieth, M.; Tran, M. Q.; Ward, D. J.; Zinkle, S. J.

    2014-12-01

    The findings of the EU 'Materials Assessment Group' (MAG), within the 2012 EU Fusion Roadmap exercise, are discussed. MAG analysed the technological readiness of structural, plasma facing and high heat flux materials for a DEMO concept to be constructed in the early 2030s, proposing a coherent strategy for R&D up to a DEMO construction decision. A DEMO phase I with a 'Starter Blanket' and 'Starter Divertor' is foreseen: the blanket being capable of withstanding ⩾2 MW yr m-2 fusion neutron fluence (∼20 dpa in the front-wall steel). A second phase ensues for DEMO with ⩾5 MW yr m-2 first wall neutron fluence. Technical consequences for the materials required and the development, testing and modelling programmes, are analysed using: a systems engineering approach, considering reactor operational cycles, efficient maintenance and inspection requirements, and interaction with functional materials/coolants; and a project-based risk analysis, with R&D to mitigate risks from material shortcomings including development of specific risk mitigation materials. The DEMO balance of plant constrains the blanket and divertor coolants to remain unchanged between the two phases. The blanket coolant choices (He gas or pressurised water) put technical constraints on the blanket steels, either to have high strength at higher temperatures than current baseline variants (above 650 °C for high thermodynamic efficiency from He-gas coolant), or superior radiation-embrittlement properties at lower temperatures (∼290-320 °C), for construction of water-cooled blankets. Risk mitigation proposed would develop these options in parallel, and computational and modelling techniques to shorten the cycle-time of new steel development will be important to achieve tight R&D timescales. The superior power handling of a water-cooled divertor target suggests a substructure temperature operating window (∼200-350 °C) that could be realised, as a baseline-concept, using tungsten on a copper

  17. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  18. Electric field in an AC dielectric barrier discharge overlapped with a nanosecond pulse discharge

    Science.gov (United States)

    Goldberg, Benjamin M.; Shkurenkov, Ivan; Adamovich, Igor V.; Lempert, Walter R.

    2016-08-01

    The effect of ns discharge pulses on the AC barrier discharge in hydrogen in plane-to-plane geometry is studied using time-resolved measurements of the electric field in the plasma. The AC discharge was operated at a pressure of 300 Torr at frequencies of 500 and 1750 Hz, with ns pulses generated when the AC voltage was near zero. The electric field vector is measured by ps four-wave mixing technique, which generates coherent IR signal proportional to the square of electric field. Absolute calibration was done using an electrostatic (sub-breakdown) field applied to the discharge electrodes, when no plasma was generated. The results are compared with one-dimensional kinetic modeling of the AC discharge and the nanosecond pulse discharge, predicting behavior of both individual micro-discharges and their cumulative effect on the electric field distribution in the electrode gap, using stochastic averaging based on the experimental micro-discharge temporal probability distribution during the AC period. Time evolution of the electric field in the AC discharge without ns pulses, controlled by a superposition of random micro-discharges, exhibits a nearly ‘flat top’ distribution with the maximum near breakdown threshold, reproduced quite well by kinetic modeling. Adding ns pulse discharges on top of the AC voltage waveform changes the AC discharge behavior in a dramatic way, inducing transition from random micro-discharges to a more regular, near-1D discharge. In this case, reproducible volumetric AC breakdown is produced at a well-defined moment after each ns pulse discharge. During the reproducible AC breakdown, the electric field in the plasma exhibits a sudden drop, which coincides in time with a well-defined current pulse. This trend is also predicted by the kinetic model. Analysis of kinetic modeling predictions shows that this effect is caused by large-volume ionization and neutralization of surface charges on the dielectrics by ns discharge pulses. The present

  19. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  20. Logarithmic ac response in the heavy-fermion superconductor URu2Si2

    International Nuclear Information System (INIS)

    Ac-magnetic-susceptibility χac(T) measurements as a function of frequency f and excitation field hac have been performed on a single crystal of the heavy-fermion superconductor URu2Si2 in magnetic fields H up to 30 kOe applied along the c axis. The apparent superconducting transition temperature Tc shows an unexpected and approximately logarithmic increase (decrease) with f (hac) that is enhanced with H, which suggests the existence of an irreversibility line below the upper critical field Hc2(T) in URu2Si2. Isothermal χac vs H sweeps were used to define Hc2(T) which was independent of f and hac

  1. AcEST: DK954326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available mily ATPase, CDC48 subfamily OS=Met... 125 1e-27 tr|B8GJ73|B8GJ73_9EURY AAA famil...al transitional endo... 122 1e-26 tr|A7IB30|A7IB30_METB6 AAA family ATPase, CDC48 subfamily OS=Met...... 122 2e-26 tr|A2SR43|A2SR43_METLZ AAA family ATPase, CDC48 subfamily OS=Met... 122 2e-26...et... 120 5e-26 tr|Q2FSR5|Q2FSR5_METHJ AAA family ATPase, CDC48 subfamily OS=Met... 120 5e-26 >tr|O81459|O81

  2. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  3. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  4. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    OpenAIRE

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  5. Structure and relaxation dynamics of poly(amide urethane)s with bioactive transition metal acetyl acetonates in hard blocks.

    Science.gov (United States)

    Kalogeras, I M; Roussos, M; Vassilikou-Dova, A; Spanoudaki, A; Pissis, P; Savelyev, Y V; Shtompel, V I; Robota, L P

    2005-12-01

    Structural characteristics, thermal transitions and molecular dynamics of selected poly(amide urethane)s with transition metal acetyl acetonates Me(AcAc)(2) (Me = Sn(4+), Zn(2+), Cu(2+), Pb(2+)) as chain extenders, were comparatively investigated using small- and wide-angle X-ray scattering (SAXS, WAXS), differential scanning calorimetry (DSC), and dielectric techniques (dielectric relaxation spectroscopy, DRS; thermally stimulated currents, TSC). We studied the influence of metal chelates on the mixing of the soft-segment (SS) and hard-segment (HS) domains and the related degree of microphase separation (DMS). The reactivity of Me(AcAc)(2) with macrodiisocyanate was found to decrease in the order Sn(AcAc)(2)Cl(2) > Cu(AcAc)(2) > Zn(AcAc)(2) > Pb(AcAc)(2). While Pb(AcAc)(2) shows a higher tendency for crystallisation, both the dielectric and calorimetric results suggest that the corresponding polyurethane has comparatively low DMS. The type of the transition metal has moderate effect on the glass transition temperature and no influence on the shape of the dielectric alpha relaxation signal, indicating weak interactions between metal ions and SS domains. In contrast, structural parameters and the dielectric behaviour of the beta relaxation suggest preference for hydrogen-bonding interactions between Sn(4+) and Cu(2+) metal-chelates and HS domains. The temperature dependence of dc conductivity sigma(dc) is described by the Vogel-Tammann-Fulcher equation and signifies the coupling between the mobility of polymeric chains and charges' motion. It may be expected that the present combination of techniques and particular results with respect to DMS will contribute to the development and testing of novel biodegradation-resistant and antibacterial metal-polyurethanes for biotechnological and industrial applications. PMID:16331340

  6. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  7. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  8. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  9. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  10. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... COMMISSION ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission (``Commission...''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b)(2) of the..., owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  11. Micro pumping methods based on AC electrokinetics and Electrorheologically actuated PDMS valves

    Science.gov (United States)

    Soni, Gaurav; Squires, Todd; Meinhart, Carl

    2006-11-01

    We have developed 2 different micropumping methods for transporting ionic fluids through microchannels. The first method is based on Induced Charge Electroosmosis (ICEO) and AC flow field-effect. We used an AC electric field to produce a symmetric ICEO flow on a planar electrode, called `gate'. In order to break the symmetry of ICEO, we applied an additional AC voltage to the gate electrode. Such modulation of the gate potential is called field effect and produces a unidirectional pumping over the gate surface. We used micro PIV to measure pumping velocities for a range of ionic concentration, AC frequency and gate voltage. We have also conducted numerical simulations to understand the deteriorating effect of lateral conduction of surface charge on the pumping velocities. The second method is based on vibration of a flexible PDMS diaphragm actuated by an electrorheological (ER) fluid. ER fluid is a colloidal suspension exhibiting a reversible liquid-to-solid transition under an electric field. This liquid-to-solid transition can yield very high shear stress and can be used to open and close a PDMS valve. Three such valves were fabricated and actuated in a peristaltic fashion in order to achieve positive displacement pumping of fluids.

  12. A Generalised Fault Protection Structure Proposed for Uni-grounded Low-Voltage AC Microgrids

    Science.gov (United States)

    Bui, Duong Minh; Chen, Shi-Lin; Lien, Keng-Yu; Jiang, Jheng-Lun

    2016-04-01

    This paper presents three main configurations of uni-grounded low-voltage AC microgrids. Transient situations of a uni-grounded low-voltage (LV) AC microgrid (MG) are simulated through various fault tests and operation transition tests between grid-connected and islanded modes. Based on transient simulation results, available fault protection methods are proposed for main and back-up protection of a uni-grounded AC microgrid. In addition, concept of a generalised fault protection structure of uni-grounded LVAC MGs is mentioned in the paper. As a result, main contributions of the paper are: (i) definition of different uni-grounded LVAC MG configurations; (ii) analysing transient responses of a uni-grounded LVAC microgrid through line-to-line faults, line-to-ground faults, three-phase faults and a microgrid operation transition test, (iii) proposing available fault protection methods for uni-grounded microgrids, such as: non-directional or directional overcurrent protection, under/over voltage protection, differential current protection, voltage-restrained overcurrent protection, and other fault protection principles not based on phase currents and voltages (e.g. total harmonic distortion detection of currents and voltages, using sequence components of current and voltage, 3I0 or 3V0 components), and (iv) developing a generalised fault protection structure with six individual protection zones to be suitable for different uni-grounded AC MG configurations.

  13. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  14. Josephson effects in an alternating current biased transition edge sensor

    CERN Document Server

    Gottardi, Luciano; Akamatsu, Hiroki; van der Kuur, Jan; Bruijn, Marcel P; Hartog, Roland H den; Hijmering, Richard; Khosropanah, Pourya; Lambert, Colin; van der Linden, Anton J; Ridder, Marcel L; Suzuki, Toyo; Gao, Jan R

    2016-01-01

    We report the experimental evidence of the ac Josephson effect in a transition edge sensor (TES) operating in a frequency domain multiplexer and biased by ac voltage at MHz frequencies. The effect is observed by measuring the non-linear impedance of the sensor. The TES is treated as a weakly linked superconducting system and within the resistively shunted junction model framework. We provide a full theoretical explanation of the results by finding the analytic solution of the non-inertial Langevian equation of the system and calculating the non-linear response of the detector to a large ac bias current in the presence of noise.

  15. Consistent behaviour of AC susceptibility and transport properties in magnetic superconductor RuSr 2GdCu 2O 8

    Science.gov (United States)

    Očko, M.; Živkovic, I.; Prester, M.; Drobac, Dj.; Ariosa, D.; Berger, H.; Pavuna, D.

    2004-02-01

    We report on AC susceptibility, resistivity, thermopower and measurements of sintered magnetic superconductor RuSr 2GdCu 2O 8. The antiferromagnetic phase transition at 133 K is seen clearly in the AC susceptibility as well as in the derivative of resistivity and thermopower. Above the antiferromagnetic transition, we have found some new evidences of the similarity between HTC compounds and the magnetic superconductor. The onset of superconductivity is observed by both transport methods at 46 K, and an explanation why it is not seen in the AC susceptibility data is given. The end of the SC transition occurs at about 24 K in all measured properties. We discuss the steps of broad SC transition, especially the maximum in susceptibility at 34 K, and compare our results with related studies reported in the literature.

  16. Consistent behaviour of AC susceptibility and transport properties in magnetic superconductor RuSr{sub 2}GdCu{sub 2}O{sub 8}

    Energy Technology Data Exchange (ETDEWEB)

    Ocko, M. E-mail: ocko@ifs.hr; Zivkovic, I.; Prester, M.; Drobac, Dj.; Ariosa, D.; Berger, H.; Pavuna, D

    2004-02-01

    We report on AC susceptibility, resistivity, thermopower and measurements of sintered magnetic superconductor RuSr{sub 2}GdCu{sub 2}O{sub 8}. The antiferromagnetic phase transition at 133 K is seen clearly in the AC susceptibility as well as in the derivative of resistivity and thermopower. Above the antiferromagnetic transition, we have found some new evidences of the similarity between HTC compounds and the magnetic superconductor. The onset of superconductivity is observed by both transport methods at 46 K, and an explanation why it is not seen in the AC susceptibility data is given. The end of the SC transition occurs at about 24 K in all measured properties. We discuss the steps of broad SC transition, especially the maximum in susceptibility at 34 K, and compare our results with related studies reported in the literature.

  17. An Assessment of the Penetrations in the First Wall Required for Plasma Measurments for Control of an Advanced Tokamak Plasma Demo

    Energy Technology Data Exchange (ETDEWEB)

    Kenneth M. Young

    2010-02-22

    A Demonstration tokamak (Demo) is an essential next step toward a magnetic-fusion based reactor. One based on advanced-tokamak (AT) plasmas is especially appealing because of its relative compactness. However, it will require many plasma measurements to provide the necessary signals to feed to ancillary systems to protect the device and control the plasma. This note addresses the question of how much intrusion into the blanket system will be required to allow the measurements needed to provide the information required for plasma control. All diagnostics will require, at least, the same shielding designs as planned for ITER, while having the capability to maintain their calibration through very long pulses. Much work is required to define better the measurement needs and the quantity and quality of the measurements that will have to be made, and how they can be integrated into the other tokamak structures.

  18. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  19. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  20. R&D around a photoneutralizer-based NBI system (Siphore) in view of a DEMO Tokamak steady state fusion reactor

    Science.gov (United States)

    Simonin, A.; Achard, Jocelyn; Achkasov, K.; Bechu, S.; Baudouin, C.; Baulaigue, O.; Blondel, C.; Boeuf, J. P.; Bresteau, D.; Cartry, G.; Chaibi, W.; Drag, C.; de Esch, H. P. L.; Fiorucci, D.; Fubiani, G.; Furno, I.; Futtersack, R.; Garibaldi, P.; Gicquel, A.; Grand, C.; Guittienne, Ph.; Hagelaar, G.; Howling, A.; Jacquier, R.; Kirkpatrick, M. J.; Lemoine, D.; Lepetit, B.; Minea, T.; Odic, E.; Revel, A.; Soliman, B. A.; Teste, P.

    2015-11-01

    Since the signature of the ITER treaty in 2006, a new research programme targeting the emergence of a new generation of neutral beam (NB) system for the future fusion reactor (DEMO Tokamak) has been underway between several laboratories in Europe. The specifications required to operate a NB system on DEMO are very demanding: the system has to provide plasma heating, current drive and plasma control at a very high level of power (up to 150 MW) and energy (1 or 2 MeV), including high performances in term of wall-plug efficiency (η  >  60%), high availability and reliability. To this aim, a novel NB concept based on the photodetachment of the energetic negative ion beam is under study. The keystone of this new concept is the achievement of a photoneutralizer where a high power photon flux (~3 MW) generated within a Fabry-Perot cavity will overlap, cross and partially photodetach the intense negative ion beam accelerated at high energy (1 or 2 MeV). The aspect ratio of the beam-line (source, accelerator, etc) is specifically designed to maximize the overlap of the photon beam with the ion beam. It is shown that such a photoneutralized based NB system would have the capability to provide several tens of MW of D0 per beam line with a wall-plug efficiency higher than 60%. A feasibility study of the concept has been launched between different laboratories to address the different physics aspects, i.e. negative ion source, plasma modelling, ion accelerator simulation, photoneutralization and high voltage holding under vacuum. The paper describes the present status of the project and the main achievements of the developments in laboratories.

  1. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  2. Power Electronic Transformer based Three-Phase PWM AC Drives

    Science.gov (United States)

    Basu, Kaushik

    A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common

  3. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  4. Dynamic Stark effect and forbidden-transition spectrallineshapes

    Energy Technology Data Exchange (ETDEWEB)

    Stalnaker, Jason E.; Budker, D.; Freedman, S.J.; Guzman, J.S.; Rochester, S.M.; Yashchuk, V.V.

    2005-12-15

    We report on an experimental and theoretical study of thedynamic (ac) Stark effect on a for bidden transition. A general frameworkfor parameterizing and describing off-resonant ac-Stark shifts ispresented. A model is developed to calculate spectral line shapesresulting from resonant excitation of atoms in an intense standinglight-wave in the presence of off-resonant ac-Stark shifts. The model isused in the analysis and interpretation of a measurement of the ac-Starkshifts of the static-electric-field-induced 6s2 1S0 -->5d6s 3D1transition at 408 nm in atomic Yb. The results are in agreement withestimates of the ac-Stark shift of the transition under the assumptionthat the shift is dominated by that of the 6s2 1S0 ground state. Adetailed description of the experiment and analysis is presented. Abi-product of this work is an ind ependent determination (from thesaturation behavior of the 408-nm transition) of the Stark transitionpolarizability, which is found to be in agreement with our earliermeasurement. This work is part of the ongoing effort aimed at a precisionmeasurement of atomic parity-violation effects in Yb.

  5. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  6. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  7. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  8. Wetting transitions

    International Nuclear Information System (INIS)

    When a liquid droplet is put onto a surface, two situations distinguishable by the contact angle may result. If the contact angle is zero, the droplet spreads across the surface, a situation referred to as complete wetting. On the other hand, if the contact angle is between 0 deg. and 180 deg., the droplet does not spread, a situation called partial wetting. A wetting transition is a surface phase transition from partial wetting to complete wetting. We review the key experimental findings on this transition, together with simple theoretical models that account for the experiments. The wetting transition is generally first order (discontinuous), implying a discontinuity in the first derivative of the surface free energy. In this case, if one measures the thickness of the adsorbed film beside the droplet, at the wetting transition a discontinuous jump in film thickness occurs from a microscopically thin to a thick film. We show that this can lead to the observation of metastable surface states and an accompanying hysteresis. The observed hysteresis poses, in turn, a number of questions concerning the nucleation of wetting films that we also consider here. In addition, we consider the equilibrium wetting film thickness that results from a competition between the long-range van der Waals forces and gravity. Finally, the first-order character of the wetting transition can lead to a similar transition even when the phase that does the wetting is not (yet) stable in the bulk. For such prewetting transitions, a discontinuous thin-to-thick film transition occurs off bulk coexistence. We show that, for the large variety of systems for which prewetting transitions have been observed, the behaviour is surprisingly uniform, and can be mapped onto a simple generic phase diagram. The second part of the review deals with the exceptions to the first-order nature of the wetting transition. Two different types of continuous or critical wetting transition have been reported, for which

  9. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  10. Phase transitions

    CERN Document Server

    Solé, Ricard V

    2011-01-01

    Phase transitions--changes between different states of organization in a complex system--have long helped to explain physics concepts, such as why water freezes into a solid or boils to become a gas. How might phase transitions shed light on important problems in biological and ecological complex systems? Exploring the origins and implications of sudden changes in nature and society, Phase Transitions examines different dynamical behaviors in a broad range of complex systems. Using a compelling set of examples, from gene networks and ant colonies to human language and the degradation o

  11. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  12. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  13. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  14. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  15. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  16. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  17. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  18. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  19. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  20. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  1. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  2. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  3. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  4. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Directory of Open Access Journals (Sweden)

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  5. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  6. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  7. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  8. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    OpenAIRE

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  9. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Directory of Open Access Journals (Sweden)

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  10. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  11. A new class of hybrid AC/AC direct power converters

    OpenAIRE

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  12. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    OpenAIRE

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  13. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  14. MoMar-Demo at Lucky Strike. A near-real time multidisciplinary observatory of hydrothermal processes and ecosystems at the Mid-Atlantic Ridge

    Science.gov (United States)

    Cannat, M.; Sarradin, P.; Blandin, J.; Escartin, J.; Colaco, A.; MoMAR-Demo Scientific Party : Aron Michael, Aumont Virginie, Baillard Christian, Ballu Valérie, Barreyre Thibaut, Blandin Jérôme, Blin Alexandre, Boulart Cédric, Cannat Mathilde, Carval Thierry, Castillo Alain, Chavagnac Valérie, Coail Jean Yves, Colaço Ana, Corela Carlos, Courrier Christophe, Crawford Wayne, Cuvelier Daphné, Daniel Romuald, Dausse Denis, Escartin Javier, Fabrice Fontaine, Gabsi Taoufik, Gayet Nicolas, Guyader Gérard, Lallier François, Lecomte Benoit, Legrand Julien, Lino Silva, Miranda Miguel, Mitard Emmelyne, Pichavant Pascal, Pot Olivier, Reverdin Gilles, Rommevaux Céline, Sarradin Pierre Marie, Sarrazin Jozée, Tanguy Virginie, Villinger Heinrich, Zbinden Magali

    2011-12-01

    The MoMAR "Monitoring the Mid-Atlantic Ridge" project was initiated by InterRidge in 1998 to study the environmental instability resulting from active mid-ocean-ridge processes at hydrothermal vent fields south of the Azores. It then developped into a component of the ESONET (European Seafloor Observatory Network) and EMSO (European Multidisciplinary Subsea Observatory) programs, which coordinate eulerian observatory initiatives in the seas around Europe. MoMAR experiments have started in 2006 and address two main questions : What are the feedbacks between volcanism, deformation, seismicity, and hydrothermalism at a slow spreading mid-ocean ridge? and How does the hydrothermal ecosystem couple with these sub-seabed processes? The MoMAR-Demo project started in 2010 with partial support from ESONET. It has been implemented so far by 2 cruises of the RV Pourquoi Pas ? during which we successfully deployed (in 2010), and upgraded (in 2011) a near-realtime buoyed observatory system. The system comprises two Sea Monitoring Nodes (SeaMoN) at the seafloor, which are acoustically linked to a surface relay buoy (BoRel), ensuring satellite communication to a land base station in Brest (France). One SeaMoN node connects to a 3-components seismometer and an hydrophone for seismic event detection, and two pressure probes for geodetic measurements, and the other SeaMoN node connects to a video camera, a dissolved-iron analyzer, and an optode (oxygen and temperature probe) for ecological time studies. The BOREL transmission buoy is equiped with GPS (geodetic experiment and buoy location) and meteo station. Data and/or status signals from these sensors are transmitted every 6 hours, and put on line in compliance with the ESONET-EMSO data policy (temporary access through http://www.ifremer.fr/WC2en/allEulerianNetworks). The MoMAR-Demo system also allows for interactive connections and changes of data transmission rates on demand. It is nested in arrays of autonomous sensors (OBSs

  15. AC losses in a HTS coil carrying DC current in AC external magnetic field

    International Nuclear Information System (INIS)

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  16. AC Conductivity and Dielectric Relaxation Behavior of Sb2S3 Bulk Material

    Science.gov (United States)

    Abd El-Rahman, K. F.; Darwish, A. A. A.; Qashou, Saleem I.; Hanafy, T. A.

    2016-07-01

    The Sb2S3 bulk material was used for next-generation anode for lithium-ion batteries. Alternative current (AC) conductivity, dielectric properties and electric modulus of Sb2S3 have been investigated. The measurements were carried out in the frequency range from 40 Hz to 5 MHz and temperature range from 293 K to 453 K. The direct current (DC) conductivity, σ DC, shows an activated behavior and the calculated activation energy is 0.50 eV. The AC conductivity, σ AC, was found to increase with the increase of temperature and frequency. The conduction mechanism of σ AC was controlled by the correlated barrier hopping model. The behavior of the dielectric constant, ɛ', and dielectric loss index, ɛ'', reveal that the polarization process of Sb2S3 is dipolar in nature. The behavior of both ɛ' and ɛ'' reveals that bulk Sb2S3 has no ferroelectric or piezoelectric phase transition. The dielectric modulus, M, gives a simple method for evaluating the activation energy of the dielectric relaxation. The calculated activation energy from M is 0.045 eV.

  17. A novel wireless power and data transmission AC to DC converter for an implantable device.

    Science.gov (United States)

    Liu, Jhao-Yan; Tang, Kea-Tiong

    2013-01-01

    This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz. PMID:24110077

  18. Ac Stark splitting in multiphoton excitation of atomic hydrogen in flames: Abnormal peak asymmetry due to pressure broadening

    International Nuclear Information System (INIS)

    A theory of ac Stark (or Autler-Townes) splitting occurring in double optical resonances, one of which is a two-photon transition is developed. Both laser bandwidth and collisional broadening effects are included. Theoretical results are in excellent agreement with Goldsmith's observation of two-peaked structures in the multiphoton excitation spectra of atomic hydrogen in atmospheric-pressure flames. This is believed to be the first study demonstrating that the peak asymmetry in an ac Stark doublet can be reversed due to pressure broadening

  19. Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 1: Self-cooled liquid metal breeder blanket. Vol. 2. Detailed version

    International Nuclear Information System (INIS)

    A self-cooled liquid metal breeder blanket for a fusion DEMO-reactor and the status of the development programme is described as a part of the European development programme of DEMO relevant test blankets for NET/ITER. Volume 1 (KfK 4907) contains a summary. Volume 2 (KfK 4908) a more detailed version of the report. Both volumes contain sections on previous studies on self-cooled liquid metal breeder blankets, the reference blanket design for a DEMO-reactor, a typical test blanket design including the ancillary loop system and the building requirements for NET/ITER together with the present status of the associated RandD-programme in the fields of neutronics, magnetohydrodynamics, tritium removal and recovery, liquid metal compatibility and purification, ancillary loop system, safety and reliability. An outlook is given regarding the required RandD-programme for the self-cooled liquid metal breeder blanket prior to tests in NET/ITER and the relevant test programme to be performed in NET/ITER. (orig.)

  20. Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 2: BOT helium cooled solid breeder blanket. Vol. 2

    International Nuclear Information System (INIS)

    The BOT (Breeder Outside Tube) Helium Cooled Solid Breeder Blanket for a fusion Demo reactor and the status of the R and D program is presented. This is the KfK contribution to the European Program for the Demo relevant test blankets to be irradiated in NET/ITER. Volume 1 (KfK 4928) contains the summary, volume 2 (KfK 4929) a more detailed version of the report. In both volumes are described the reasons for the selected design, the reference blanket design for the Demo reactor, the design of the test blanket including the ancillary systems together with the present status of the relative R and D program in the fields of neutronic and thermohydraulic calculations, of the electromagnetic forces caused by disruptions, of the development and irradiation of the ceramic breeder material, of the tritium release and recovery, and of the technological investigations. An outlook is given on the required R and D program for the BOT Helium Cooled Solid Breeder Blanket prior to tests in NET/ITER and the proposed test program in NET/ITER. (orig.)

  1. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  2. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an...

  3. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  4. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  5. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  6. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  7. Entropy production in ac-calorimetry

    OpenAIRE

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  8. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  9. Transitional Shelter

    OpenAIRE

    Shiozaki, Yoshimitsu; TANAKA, Yasuo; Hokugo, Akihiko; Bettencourt, Sofia

    2013-01-01

    Transitional shelter can play a crucial role in housing reconstruction following a mega disaster. Reconstruction of permanent housing cannot move forward until a number of complex issues are settled, such as relocation planning and removal of debris. Even after plans are agreed on and reconstruction begins, it may take several years for permanent housing to be completed. In this context, a...

  10. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  11. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  12. The superconducting proposal for the CS magnet system of FAST: a preliminary analysis of the heat load due to AC losses

    CERN Document Server

    Pompeo, N

    2011-01-01

    FAST (Fusion Advanced Studies Torus), the Italian proposal of a Satellite Facility to ITER, is a compact tokamak (R$_0$ = 1.82 m, a = 0.64 m, triangularity $\\delta$ = 0.4) able to investigate non-linear dynamics effects of $\\alpha$-particle behavior in burning plasmas and to test technical solutions for the first wall/divertor directly relevant for ITER and DEMO. Currently, ENEA is investigating the feasibility of a superconducting solution for the magnet system. This paper focuses on the analysis of the CS (Central Solenoid) magnet thermal behavior. In particular, considering a superconducting solution for the CS which uses the room available in the resistive design and referring to one of the most severe scenario envisaged for FAST, the heat load of the CS winding pack due to AC losses is preliminarily evaluated. The results provide a tentative baseline for the definition of the strand requirements and conductor design, that can be accepted in order to fulfil the design requirements.

  13. Insight into the durability of plant resistance to aphids from a demo-genetic study of Aphis gossypii in melon crops.

    Science.gov (United States)

    Thomas, Sophie; Vanlerberghe-Masutti, Flavie; Mistral, Pascale; Loiseau, Anne; Boissot, Nathalie

    2016-07-01

    Resistance breakdown has been observed following the deployment of plant cultivars resistant to pests. Assessing the durability of a resistance requires long-term experiments at least at a regional scale. We collected such data for melon resistance conferred by the Vat gene cluster to melon aphids. We examined landscape-level populations of Aphis gossypii collected in 2004-2015, from melon-producing regions with and without the deployment of Vat resistance and with different climates. We conducted demo-genetic analyses of the aphid populations on Vat and non-Vat plants during the cropping seasons. The Vat resistance decreased the density of aphid populations in all areas and changed the genetic structure and composition of these populations. Two bottlenecks were identified in the dynamics of adapted clones, due to the low levels of production of dispersal morphs and winter extinction. Our results suggest that (i) Vat resistance will not be durable in the Lesser Antilles, where no bottleneck affected the dynamics of adapted clones, (ii) Vat resistance will be durable in south-west France, where both bottlenecks affected the dynamics of adapted clones and (iii) Vat resistance will be less durable in south-east France, where only one of the two bottlenecks was observed. PMID:27330552

  14. Planting and demo of red lettuce on winter fallow farmlands%冬闲田种植红莴笋示范试验

    Institute of Scientific and Technical Information of China (English)

    李秀娥

    2009-01-01

    为充分利用冬闲田,2006~2007年,引进飞桥红莴笋,在水田示范基地进行示范试验.试验结果显示:飞桥红莴笋最高产量达3 097.5kg/667m2,最低产量为2 147.1kg/667m2,平均产量为2 720.2kg/667m2;在同等条件下种植红莴笋比种植白菜增收771.2元,比种植萝卜增收1 181.2元.%In order to use winter fallow farmlands, from 2006 to 2007, "Feiqiao" red lettuce was introduced and planted in paddy field as a demo. The experiment results show that the highest yield of this vegetable can reach to 3 097.5kg/667m2 with lowest yield of 2 147.1kg/667m2 and average yield of 2 720.2kg/667m2. In the same conditions, the planting of red lettuce can increase income by 771.2 Yuan than Chinese cabbage, by 1 181.2 Yuan than radish.

  15. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  16. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  17. Transition Operators

    CERN Document Server

    Alcock-Zeilinger, Judith

    2016-01-01

    In this paper, we give a generic algorithm of the transition operators between Hermitian Young projection operators corresponding to equivalent irreducible representations of SU(N), using the compact expressions of Hermitian Young projection operators derived in a companion paper. We show that the Hermitian Young projection operators together with their transition operators constitute a fully orthogonal basis for the algebra of invariants of $V^{\\otimes m}$ that exhibits a systematically simplified multiplication table. We discuss the full algebra of invariants over $V^{\\otimes 3}$ and $V^{\\otimes 4}$ as explicit examples. In our presentation we make use of various standard concepts such as Young projection operators, Clebsch-Gordan operators, and invariants (in birdtrack notation). We tie these perspectives together and use them to shed light on each other.

  18. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  19. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled......-second average at its output, while simultaneously achieving inductive voltage boosting by shooting through either an appropriately selected inverter phase-leg or two phase-legs being commanded simultaneously. More interestingly, these performance features are achieved with no increase in the number...

  20. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications

    OpenAIRE

    Vuorsalo, Simo

    2015-01-01

    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  1. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    Directory of Open Access Journals (Sweden)

    S. Arumugam S. Ramareddy M. Sridhar

    2011-12-01

    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  2. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... a low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  3. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  4. AC Electric Field Activated Shape Memory Polymer Composite

    Science.gov (United States)

    Kang, Jin Ho; Siochi, Emilie J.; Penner, Ronald K.; Turner, Travis L.

    2011-01-01

    Shape memory materials have drawn interest for applications like intelligent medical devices, deployable space structures and morphing structures. Compared to other shape memory materials like shape memory alloys (SMAs) or shape memory ceramics (SMCs), shape memory polymers (SMPs) have high elastic deformation that is amenable to tailored of mechanical properties, have lower density, and are easily processed. However, SMPs have low recovery stress and long response times. A new shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive fillers to enhance its thermo-mechanical characteristics. A new composition of shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive functionalized graphene sheets (FGS) to enhance its thermo-mechanical characteristics. The elastic modulus of LaRC-SMPC is approximately 2.7 GPa at room temperature and 4.3 MPa above its glass transition temperature. Conductive FGSs-doped LaRC-SMPC exhibited higher conductivity compared to pristine LaRC SMP. Applying an electric field at between 0.1 Hz and 1 kHz induced faster heating to activate the LaRC-SMPC s shape memory effect relative to applying DC electric field or AC electric field at frequencies exceeding1 kHz.

  5. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  6. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  7. An ac biased superconducting flux transformer

    International Nuclear Information System (INIS)

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  8. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  9. AC susceptibility studies of the superconductivity of PrOs4Sb12

    International Nuclear Information System (INIS)

    We report the superconducting phase diagram of PrOs4Sb12 deduced from the real-part χ' and the imaginary part χ'' of the AC susceptibility. The double transition at Tc1=1.85K and Tc2=1.75K seen in the specific heat may be related to features in χ' and χ'', where full diamagnetic shielding is observed below Tc2 only. As function of magnetic field the phase bounded by Tc2 displays features reminiscent of the peak effect

  10. Transit space

    DEFF Research Database (Denmark)

    Raahauge, Kirsten Marie

    2008-01-01

    This article deals with representations of one specific city, Århus, Denmark, especially its central district. The analysis is based on anthropological fieldwork conducted in Skåde Bakker and Fedet, two well-off neighborhoods. The overall purpose of the project is to study perceptions of space...... and the interaction of cultural, social, and spatial organizations, as seen from the point of view of people living in Skåde Bakker and Fedet. The focus is on the city dwellers’ representations of the central district of Århus with specific reference to the concept of transit space. When applied to various Århusian...

  11. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    Directory of Open Access Journals (Sweden)

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  12. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  13. TBM testing in ITER: Requirements for the development of predictive tools to describe corrosion-related phenomena in HCLL blankets towards DEMO

    Energy Technology Data Exchange (ETDEWEB)

    Krauss, W., E-mail: wolfgang.krauss@kit.edu [Karlsruhe Institute of Technology, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Konys, J. [Karlsruhe Institute of Technology, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Li-Puma, A. [CEA, DEN, Saclay, DANS/DM2S/SERMA, F-91191 Gif-sur-Yvette (France)

    2012-08-15

    Highlights: Black-Right-Pointing-Pointer To collect corrosion data relevant for TBM operation in updated facilities. Black-Right-Pointing-Pointer To develop predictive tools (corrosion, transport, precipitation, impurity effects). Black-Right-Pointing-Pointer To perform validation of predictive tools. Black-Right-Pointing-Pointer To develop/qualify components for TBM tests in ITER. - Abstract: Compatibility testing of RAFM-steels in Pb-15.7Li environment has shown that liquid metal corrosion is always present and dissolution of steel elements in hot areas of non-isothermal systems takes place whereas a transport of the corrosion products and formed precipitates has to be considered in the TBM design. It is clear that for the design of a HCLL breeding blanket system for DEMO and to ensure the safety over a fusion power plant lifetime, a good knowledge of the corrosion behavior including the dominating mechanisms is required. Simulation tools predicting the corrosion behavior of bare and coated Eurofer in Pb-15.7Li must be implemented and validated in a real fusion environment where numerous physical phenomena are additionally present, compared to the state of the art corrosion knowledge, such as neutron flux, H, T permeation, MHD effects, temperature field with steep gradients. The state of the art will be shown and discussed using some of the main fundamental corrosion data selected from own testing campaigns and published literature regarding corrosion behavior of TBMs. On this basis a test matrix for TBM testing in ITER is presented in the paper and the deficits in present knowledge are outlined deviating future development needs in corrosion.

  14. An 'Orca-stra' of Science and Sound: The Reverberations of Northeast Pacific Whales and How We're Helping People Understand Them Though Games, Demos and Listening

    Science.gov (United States)

    Pelz, M.; Dewey, R. K.; Hoeberechts, M.; Kanes, K.; Ewing, N.

    2015-12-01

    Presented by the Ocean Networks Canada (ONC) Leaning and Engagement team, this demonstration focuses on our strategy for engaging and inspiring the next generation of ocean advocates by introducing them to one of the ocean's most charismatic inhabitants: marine mammals (and don't worry, we don't need any tanks or neoprene suits to do it). Using bioacoustic data, we can bring the essence of the animals with us. ONC, an initiative of the University of Victoria, operates cabled ocean observatories which supply continuous power and Internet connectivity to a broad suite of subsea instruments from the coast to the deep sea. This Internet connectivity permits researchers, students and members of the public to download freely available data onto their computers from anywhere around the globe, in real-time. Our demo focuses on the story of bioacoustics from instrument to animal. When visiting classrooms or hosting booths, we enhance user knowledge and experience by connecting familiar animals with their acoustic data from hydrophones. This includes listening to hydrophone clips collected from the network, analyzing sounds using interactive, real-time software and playing interactive games designed to get participants thinking like a scientist and taking a whale's perspective. For example, participants listen to recordings and guess the sound, identify frequencies and try a working hydrophone. The presentation consists of a suite of activities that meet a broad range of Next Generation Science Standards and includes links to the SoundCloud, https://soundcloud.com/oceannetworkscanada the ONC hydrophone FAQ, http://www.oceannetworks.ca/smart-hydrophone-faq and a classroom ready resource, Shouting Whales http://openschool.bc.ca/shouting_whales/index.html . The included links allow users anywhere to have a similar whale "experience" as the data are classroom ready, accessible and free.

  15. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica

    OpenAIRE

    Ranz Guerra, Carlos; Cobo, Pedro

    2000-01-01

    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  16. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC03Q....Seq.d/ Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  17. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC20Q.Seq.d/ Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  18. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...

  19. Estudio acústico del Conservatorio de Piles

    OpenAIRE

    VILLA MORANT, SARA

    2014-01-01

    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  20. Control of high-frequency AC link electronic transformer

    OpenAIRE

    Krishnaswami, H; Ramanarayanan, V.

    2005-01-01

    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  1. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  2. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  3. Evaluation of a.c. conductivity behaviour of graphite filled polysulphide modified epoxy composites

    Indian Academy of Sciences (India)

    Navin Chand; Deepak Jain

    2004-06-01

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled and unfilled epoxy composites. It was observed that the dielectric constant, tan and a.c. conductivity increase with increasing temperature. Near the transition temperature the materials show anomalous behaviour for the observed properties. Peaks of dielectric constant, tan and a.c. conductivity were observed to shift towards lower temperature with increasing frequency. Clear relaxation (tan ) peaks around 169°C were observed in epoxy resin, which shifted to lower temperature side on increasing the frequency. Addition of 2.91 wt% graphite shifted the tan peaks towards higher temperature side by creating hindrances to the rotation of polymer dipoles. Addition of 2.91 wt% graphite leads to an increased relaxation time of dipoles in polysulphide epoxy from 1.44 × 10-5-3.92 × 10-5 (s) at 90°C by creating the hindrance to the rotation of dipoles.

  4. Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing

    CERN Document Server

    Gottardi, Luciano; de Korte, Piet A J; Hartog, Roland Den; Dirks, Bob; Popescu, Manuela; Hoevers, Henk F C; Bruijn, Marcel; Borderias, Maria Parra; Takei, Y

    2016-01-01

    We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDMconfiguration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/RN < 0.5). The measured energy resolution at 5.89keV is 2.7eV for DC bias and 3.7eV for AC bias, while the baseline resolution is 2.8eV and 3.3eV, respectively.

  5. Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing

    International Nuclear Information System (INIS)

    We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDM configuration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10 MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370 kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/RN<0.5). The measured energy resolution at 5.89 keV is 2.7 eV for DC bias and 3.7 eV for AC bias, while the baseline resolution is 2.8 eV and 3.3 eV, respectively.

  6. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Science.gov (United States)

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  7. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  8. An ac bridge readout for bolometric detectors

    Science.gov (United States)

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.

    1989-01-01

    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  9. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  10. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  11. Josephson arrays for dc and ac metrology

    International Nuclear Information System (INIS)

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  12. The AC and DC Conductivity of Nanocomposites

    Directory of Open Access Journals (Sweden)

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  13. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC29Q....Seq.d/ Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  14. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  15. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . With the proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion system...

  16. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  17. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  18. Equivalent circuit models for ac impedance data analysis

    Science.gov (United States)

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  19. Considerations for an Ac Dipole for the LHC

    CERN Document Server

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  20. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%), for kidneys 20 ± 1% (19...

  1. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  2. AC loss in large-scale superconducting cables

    NARCIS (Netherlands)

    Mulder, G.B.J.

    1993-01-01

    A review is given of recent work on ac losses, carried out at our institute. The emphasis is on large-scale conductors for fusion applications, such as the `cable-in-conduit¿ prototype conductors to be used for NET. Calculation methods for the ac losses are presented together with some experimental

  3. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  4. Resistivity and AC calorimetry measurements on CeNiGe{sub 2} under pressure

    Energy Technology Data Exchange (ETDEWEB)

    Holmes, A.T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan)]. E-mail: alex@djebel.mp.es.osaka-u.ac.jp; Muramatsu, T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Miyake, A. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Kaczorowski, D. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wroclaw (Poland); Bukowski, Z. [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wroclaw (Poland); Kagayama, T. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Shimizu, K. [KYOKUGEN, Osaka University, Toyonaka, Osaka 560-8531 (Japan)

    2007-03-15

    We present resistivity and AC calorimetry measurements of single crystalline CeNiGe{sub 2} under high pressure and low temperature in a diamond anvil cell. CeNiGe{sub 2} is a highly anisotropic, antiferromagnetic Kondo system at ambient pressure, located close to the boundary with non-magnetic systems. It has two ordering temperatures, T{sub N1}=3.9K and T{sub N2}=3.2K, which are suppressed under pressure. Between 0.7 and 1.4GPa only a single transition was identified, with T{sub N} reaching 1.9K by 1.4 GPa. At 1.9GPa two transitions could again be seen by AC calorimetry at 2.0 and 1.3K, accompanied by a qualitative change in the behaviour of the resistivity. The Sommerfeld coefficient showed a maximum of 755mJmol{sup -1}K{sup -2} at 1.4GPa, up from 448mJmol{sup -1}K{sup -2} at close to ambient pressure. The residual resistivity was found to decrease sharply above 1.4GPa after an initial increase with pressure.

  5. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  6. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems

    Science.gov (United States)

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François

    2016-09-01

    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  7. Transition time

    Directory of Open Access Journals (Sweden)

    Carlos Renato Zacharias

    2013-03-01

    Full Text Available 2013 is going to be an interesting year for the High Dilution research field. There is a tendency to revise basic concepts and common beliefs, while refining models and theories. The fundamental research team seems to be open to deeper discussions, aiming to reinforce some hypothesis and discharge others. In somehow, we are stuck in a vicious way of think, trying to manage and describe an informational phenomenon into a molecular framework. The challenge offered to those researchers involved with basic science is to figure out how to deal with such phenomenon, since previous theories and models have not shown to be matched! In the other hand, there is a tendency to explore the HD phenomenon in its technological branch. While basic research is important to describe how things work, the applied research has a more intense social and economic appeal. To develop technology based on HD means to give a different kind of visibility to the field, attracting sponsors, companies, entrepreneurs, always committed to the market regulatory laws. I am expecting for this year some important movements, both in the basic and applied research. Of course, it will be only a new beginning, as these changes require a lot of work, discussions and insights. But this transition time is very welcome!

  8. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    Institute of Scientific and Technical Information of China (English)

    房绪鹏

    2006-01-01

    提出了一种新型AC/AC变流器电路--单相电压型Z源AC/AC变流器;介绍了其电路拓扑、工作原理、控制方法等;给出了相应的仿真和实验结果.仿真和实验证实了该电路拓扑的合理性和优越性.

  9. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  10. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  11. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  12. Spin reorientation transition process in single crystal NdFeO3

    Science.gov (United States)

    Song, Gaibei; Jiang, Junjie; Kang, Baojuan; Zhang, Jincang; Cheng, Zhenxiang; Ma, Guohong; Cao, Shixun

    2015-06-01

    The spin reorientation transition in single crystal NdFeO3 is studied using AC magnetic susceptibility, hysteresis loops, and polarized terahertz (THz) time domain spectroscopy measurements. Different frequency dependence behaviors of AC susceptibility reflect that the dynamic response of magnetization inside the spin reorientation region differs from the phase outside the transition region. The magnetization hysteresis loops at different temperatures reveal that domains formed during the spin reorientation process, which coincides with the abrupt increase of AC magnetic susceptibility during the transition. In addition, temperature dependent THz wave excitation of quasi-antiferromagnetic mode indicates the process of spin reorientation as a continuous rotation of Fe3+ spins rather than a mixed phase of Γ4 and Γ2.

  13. Effect of electric fields on the stabilization of premixed laminar bunsen flames at low AC frequency: Bi-ionic wind effect

    KAUST Repository

    Kim, Minkuk

    2012-03-01

    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally by applying AC electric fields at low frequency below 60. Hz together with DC in the single electrode configuration. The blowoff velocity has been measured for varying AC voltage and frequency. A transition frequency between low and high frequency regimes has been identified near 40-50. Hz, where AC electric fields have minimal effect on flame stabilization. In the low frequency regime, the blowoff velocity decreased linearly with AC voltage such that the flames became less stable. This was consistent with the DC result, implying the influence of the ionic wind effect. The variation of blowoff velocity with AC frequency showed a non-monotonic behavior in that the velocity decreased and then increased, exhibiting minimum blowoff velocity near 6-8. Hz. Based on the molecular kinetic theory, the developing degree of ionic wind was derived. By considering the ionic wind effects arising from both positive and negative ions in a flame zone, the bi-ionic wind effect successfully explained the non-monotonic behavior of blowoff velocity with AC frequency in the low frequency regime. © 2011 The Combustion Institute.

  14. Ocean wind and roughness retrieval with spaceborne GNSS-Reflectometry: first results from the UK TechDemoSat-1 mission

    Science.gov (United States)

    Gommenginger, C.; Foti, G.

    2015-12-01

    GNSS-Reflectometry (GNSS-R) is a ground breaking ocean remote sensing technique that exploits reflected signals from Global Navigation Satellite Systems (GNSS) to retrieve geophysical information about the ocean surface such as near-surface winds above the ocean. Adopting a bistatic radar configuration, signals emitted by GNSS satellites flying in Medium Earth Orbit (MEO) are received by a GNSS-R receiver on a Low Earth Orbit (LEO) observatory utilizing both a zenith antenna to receive the direct signal from the GNSS and a nadir antenna to acquire the earth-reflected signal. The reflected signal originated from a glistening zone on the ocean surface sited around the Specular Point (SP), the geometrical point on the Earth surface where GNSS signals are forward scattered in the specular direction. The two signals are correlated for different shifts in time (delay) and frequency (Doppler) relative to the specular point (SP) to produce a so-called Delay Doppler Map (DDM) of forward-scattered electromagnetic power over the surface. This paper gives an overview of recent results obtained for wind speed and ocean roughness retrieval with the Low-Earth-Orbiting UK TechDemoSat-1 satellite (TDS-1). Launched in July 2014, TDS-1 provides the first new spaceborne Global Navigation Satellite System-Reflectometry (GNSS-R) data since the pioneering UK-Disaster Monitoring Mission experiment in 2003. We present examples of onboard-processed delay Doppler Maps, including excellent DDM data quality for winds up to 27.9 m/s. The relationship between observed GNSS-R signals, wind speed and ocean roughness is explored using global collocated matchup datasets with METOP ASCAT scatterometer winds and WaveWatch3 numerical wave model output. Several Geophysical Model Functions are proposed, that make it possible to retrieve wind speed without bias and with a precision of the order of 2 m/s even without calibration. This work demonstrates the capabilities of low-cost, low-mass, low-power GNSS

  15. An Ac transposon system based on maize chromosome 4S for isolating long-distance-transposed Ac tags in the maize genome.

    Science.gov (United States)

    Wang, Fei; Li, Zhaoying; Fan, Jun; Li, Pengfei; Hu, Wei; Wang, Gang; Xu, Zhengkai; Song, Rentao

    2010-12-01

    Transposon tagging is an important tool for gene isolation and functional studies. In maize, several transposon-tagging systems have been developed, mostly using Activator/Dissociation (Ac/Ds) and Mutator systems. Here, we establish another Ac-based transposon system with the donor Ac tightly linked with sugary1 (su1) on maize chromosome 4S. Newly transposed Ac (tr-Acs) were detected based on a negative dosage effect, and long-distance-transposed Ac events were identified and isolated from the donor Ac by a simple backcross scheme. In this study, we identified 208 independent long-distance-transposed Ac lines. Thirty-one flanking sequences of these tr-Acs were isolated and localized in the maize genome. As found in previous studies, the tr-Acs preferentially inserted into genic sequences. The distribution of tr-Acs is not random. In our study, the tr-Acs preferentially transposed into chromosomes 1, 2, 9 and 10. We discuss the preferential distribution of tr-Acs from Ac systems. Our system is complementary to two other Ac-based regional-mutagenesis systems in maize, and the combined use of these systems will achieve an even and high-density distribution of Ac elements throughout the maize genome for functional-genomics studies.

  16. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    Science.gov (United States)

    2010-07-01

    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning...

  17. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  18. La acústica submarina y su desarrollo desde la creación del Instituto de Acústica

    OpenAIRE

    Ranz Guerra, Carlos; Cobo, Pedro; Carbó, Rafael; Santiago Páez, José Salvador; Soler, A. M.; Briones, J. M.; Jimeno, I.; Muñoz, N; Camarasa, M.; Recuero López, Manuel

    2000-01-01

    PACS: 43.30.Xm; 43.30.Yj; 43.30.Vh; 43.30.Nb; 43.30.Ma.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  19. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Directory of Open Access Journals (Sweden)

    Henrik H. El Ali

    2012-10-01

    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  20. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  1. AC Impedance Behaviour of Black Diamond Films

    Institute of Scientific and Technical Information of China (English)

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  2. Faint Galaxies in deep ACS observations

    CERN Document Server

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L

    2003-01-01

    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  3. Structural Transitions in Topologically Constrained DNA

    Science.gov (United States)

    Leger, J.; Romano, G.; Sarkar, A.; Robert, J.; Bourdieu, L.; Chatenay, D.; Marko, J. F.

    2000-03-01

    We propose a theoretical explanation for results of recent single molecule micromanipulation experiments (Leger et al, PRL 83, 1066, 1999) on double-stranded DNA with fixed linking number. The topological constraint leads to novel structural transitions, including a shift of the usual 60 pN B-form to S-form transition force plateau up to a force of 100 pN when linking is fixed at zero. Our model needs five distinct states to explain the four different observed transitions. The various constant-force plateaus observed for different fixed values of linking correspond to a mixture of different pairs of states, weighted to satisfy the topological constraint. Our model allows us to conclude that sufficiently overtwisted DNA (positive linkage number) undergoes a transition from B-form DNA to a mixture of S-form and P-form DNA at a force plateau near 45 pN, and then to homogeneous P-form DNA at a force plateau near 110 pN. A similar two-step transition occurs for undertwisted DNA, and by analysing the twisting necessary to produce pure S-form DNA we conclude that the S-state has helix repeat of 38 bp. Support from the Whitaker Foundation, the NSF, the ACS-PRF and Research Corporation is gratefully acknowledged.

  4. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  5. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  6. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  7. An Improved AC-BM Algorithm for Monitoring Watch List

    Directory of Open Access Journals (Sweden)

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  8. Cyclotron production of Ac-225 for targeted alpha therapy.

    Science.gov (United States)

    Apostolidis, C; Molinet, R; McGinley, J; Abbas, K; Möllenbeck, J; Morgenstern, A

    2005-03-01

    The feasibility of producing Ac-225 by proton irradiation of Ra-226 in a cyclotron through the reaction Ra-226(p,2n)Ac-225 has been experimentally demonstrated for the first time. Proton energies were varied from 8.8 to 24.8 MeV and cross-sections were determined by radiochemical analysis of reaction yields. Maximum yields were reached at incident proton energies of 16.8 MeV. Radiochemical separation of Ac-225 from the irradiated target yielded a product suitable for targeted alpha therapy of cancer.

  9. WLCG Operations portal demo tutorial

    CERN Document Server

    CERN. Geneva

    2016-01-01

    This is a navigation through http://wlcg-ops.web.cern.ch/ the Worldwide LHC Computing Grid (WLCG) Operations' portal. In this portal you will find documentation and information about WLCG Operation activities for: System Administrators at the WLCG sites LHC Experiments Operation coordination people, including Task Forces and Working Groups

  10. DemoCensus_MCDPLACE1990

    Data.gov (United States)

    Vermont Center for Geographic Information — The 1990 Census TIGER/Line File is an extract of selected geographic and cartographic information from the Census Bureau's TIGER (Topologically Integrated...

  11. Single-Phase Four Switch Z-Source AC-AC Converters%单相四开关Z源AC-AC变换器

    Institute of Scientific and Technical Information of China (English)

    汤雨; 谢少军; 张超华

    2007-01-01

    提出了一种单相四开关Z源AC-AC变换器,它包括电压型与电流型两类.与传统脉宽调制AC-AC变换器相比,它具有如下特点:输出电压范围宽且可升可降,输出电压与输入电压可同相或反相,冲击和谐波电流小,可靠性高.针对AC-AC变换器中固有的开关管换流问题,提出了一种适用于单相四开关Z源AC-AC变换器的换流方案,无需外加缓冲吸收电路即可实现开关管的安全换流.以电压型单相四开关Z源AC-AC变换器为例,对其进行了理论分析、仿真和原理试验研究.实验结果证实了Z源变换器的特性及换流方案的可行性.

  12. Highly sensitive pseudo-differential ac-nanocalorimeter for the study of the glass transition

    Energy Technology Data Exchange (ETDEWEB)

    Laarraj, Mohcine [Institut NÉEL, CNRS, 25 Avenue des Martyrs, F-38042 Grenoble (France); University Grenoble Alpes, Institut NEEL, F-38042 Grenoble (France); Laboratoire d’Ingénierie et des Matériaux (LIMAT), Université Hassan II de Casablanca, Faculté des Sciences Ben M’Sik, Casablanca Maroc (Morocco); Adhiri, Rahma; Moussetad, Mohamed [Laboratoire d’Ingénierie et des Matériaux (LIMAT), Université Hassan II de Casablanca, Faculté des Sciences Ben M’Sik, Casablanca Maroc (Morocco); Ouaskit, Said [Laboratoire de Physique de la Matière Condensée (LPMC), Université Hassan II de Casablanca, Faculté des Sciences Ben M’Sik, Casablanca Maroc (Morocco); Guttin, Christophe; Richard, Jacques; Garden, Jean-Luc [Institut NÉEL, CNRS, 25 Avenue des Martyrs, F-38042 Grenoble (France); University Grenoble Alpes, Institut NEEL, F-38042 Grenoble (France)

    2015-11-15

    We present a nanocalorimeter designed for the measurement of the dynamic heat capacity of thin films. The microfabricated sensor, the thermal conditioning of the sensor, as well as the highly stable and low noise electronic chain allow measurements of the real and imaginary parts of the complex specific heat with a resolution Δ C/C of about 10{sup −5}. The performances of this quasi-differential nanocalorimeter were tested on a model of polymeric glass-former, the polyvinyl acetate (PVAc). The high stability and low noise of the device are essential for accurate studies on non-equilibrium slow relaxing systems such as glasses.

  13. Dicty_cDB: FCL-AC22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC22 (Link to dictyBase) - G03266 DDB0186811 Contig-U14995-1 FCL-...AC22P (Link to Original site) FCL-AC22F 430 FCL-AC22Z 521 FCL-AC22P 951 - - Show FCL-AC22 Library FC...L (Link to library) Clone ID FCL-AC22 (Link to dictyBase) Atlas ID - NBRP ID G03266 dictyBase ID DDB0186811 ...Link to Contig Contig-U14995-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC22Q.Seq.d/ Representative seq. ID FCL-AC22P (Link to Original site) Representative DNA sequence >FCL-

  14. Dicty_cDB: FCL-AC23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC23 (Link to dictyBase) - G01760 DDB0186002 Contig-U16043-1 FCL-...AC23P (Link to Original site) FCL-AC23F 132 FCL-AC23Z 582 FCL-AC23P 714 - - Show FCL-AC23 Library FC...L (Link to library) Clone ID FCL-AC23 (Link to dictyBase) Atlas ID - NBRP ID G01760 dictyBase ID DDB0186002 ...Link to Contig Contig-U16043-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC23Q.Seq.d/ Representative seq. ID FCL-AC23P (Link to Original site) Representative DNA sequence >FCL-

  15. PROSPECTS OF MULTIFILAMENTARY SUPERCONDUCTOR AC 50 Hz APPLICATIONS

    OpenAIRE

    Hlásnik, I.

    1984-01-01

    It is shown that parameters of modern multifilamentary superconductors and their possible improvements allow their application to AC 50 Hz windings working at Bm of about 1 T and giving energy and total cost savings.

  16. Dc to ac converter operates efficiently at low input voltages

    Science.gov (United States)

    1965-01-01

    Self-oscillating dc to ac converter with transistor switching to produce a square wave output is used for low and high voltage power sources. The converter has a high efficiency throughout a wide range of loads.

  17. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  18. A precursor of β-delayed fission:230Ac

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  19. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  20. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  1. Development of the Field of Flexible AC Transmission Systems (FACTS)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Theoretical and technological development of large capacity power electronics and flexible AC transmission systems are one of the most important projects developed by Tsinghua University. The Flexible AC Transmission System (FACTS) technology which uses power electronics to improve the efficiency and quality of the electrical generation, transmission and distribution system is considered to be one of the most significant technological innovations for power systems in the 20th century. The advanced static var generator (ASVG) is a key FACTS device.

  2. Muc5ac mucin expression during rat skin development

    OpenAIRE

    V. Ferretti; Á. Segal-Eiras; Barbeito, C.G.; Croce, M. V.

    2015-01-01

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  3. Theory of the ac spin-valve effect

    OpenAIRE

    Kochan, Denis; Gmitra, Martin; Fabian, Jaroslav

    2011-01-01

    The spin-valve complex magnetoimpedance of symmetric ferromagnet/normal metal/ferromagnet junctions is investigated within the drift-diffusion (standard) model of spin injection. The ac magnetoresistance---the real part difference of the impedances of the parallel and antiparallel magnetization configurations---exhibits an overall damped oscillatory behavior, as an interplay of the diffusion and spin relaxation times. In wide junctions the ac magnetoresistance oscillates between positive and ...

  4. Fractal AC circuits and propagating waves on fractals

    CERN Document Server

    Akkermans, Eric; Dunne, Gerald; Rogers, Luke G; Teplyaev, Alexander

    2015-01-01

    We extend Feynman's analysis of the infinite ladder AC circuit to fractal AC circuits. We show that the characteristic impedances can have positive real part even though all the individual impedances inside the circuit are purely imaginary. This provides a physical setting for analyzing wave propagation of signals on fractals, by analogy with the Telegrapher's Equation, and generalizes the real resistance metric on a fractal, which provides a measure of distance on a fractal, to complex impedances.

  5. AC resistivity of d-wave ceramic superconductors

    OpenAIRE

    Li, Mai Suan; Dominguez, Daniel

    2000-01-01

    We model d-wave ceramic superconductors with a three-dimensional lattice of randomly distributed $\\pi$ Josephson junctions with finite self-inductance. The linear and nonlinear ac resistivity of the d-wave ceramic superconductors is obtained as function of temperature by solving the corresponding Langevin dynamical equations. We find that the linear ac resistivity remains finite at the temperature $T_p$ where the third harmonics of resistivity has a peak. The current amplitude dependence of t...

  6. Update on bedside ultrasound (US) diagnosis of acute cholecystitis (AC).

    Science.gov (United States)

    Zenobii, Maria Francesca; Accogli, Esterita; Domanico, Andrea; Arienti, Vincenzo

    2016-03-01

    Acute cholecystitis (AC) represents a principal cause of morbidity worldwide and is one of the most frequent reasons for hospitalization due to gastroenteric tract diseases. AC should be suspected in presence of clinical signs and of gallstones on an imaging study. Upper abdominal US represents the first diagnostic imaging step in the case of suspected AC. Computed tomography (CT) with intravenous contrast (IV) or magnetic resonance imaging (MRI) with gadolinium contrast and technetium hepatobiliary iminodiacetic acid (Tc-HIDA) can be employed to exclude complications. US examination should be performed with right subcostal oblique, with longitudinal and intercostal scans. Normal gallbladder US findings and AC major and minor US signs are described. Polyps, sludge and gallbladder wall thickening represent the more frequent pitfalls and they must be differentiated from stones, duodenal artifacts and many other non-inflammatory conditions that cause wall thickening, respectively. By means of bedside ultrasound, the finding of gallstones in combination with acute pain, when the clinician presses the gallbladder with the US probe (the sonographic Murphy's sign), has a 92.2 % positive predictive value for AC. In our preliminary experience, bedside US-performed by echoscopy (ES) and/or point-of-care US (POCUS) demonstrated good reliability in detecting signs of AC, and was always integrated with physical examination and performed by a skilled operator.

  7. AC electrophoretic deposition of organic-inorganic composite coatings.

    Science.gov (United States)

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R

    2013-02-15

    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials.

  8. Temperature integration at the AC thermosensory neurons in Drosophila.

    Science.gov (United States)

    Tang, Xin; Platt, Michael D; Lagnese, Christopher M; Leslie, Jennifer R; Hamada, Fumika N

    2013-01-16

    Temperature sensation has a strong impact on animal behavior and is necessary for animals to avoid exposure to harmful temperatures. It is now well known that thermoTRP (transient receptor potential) channels in thermosensory neurons detect a variable range of temperature stimuli. However, little is known about how a range of temperature information is relayed and integrated in the neural circuits. Here, we show novel temperature integration between two warm inputs via Drosophila TRPA channels, TRPA1 and Pyrexia (Pyx). The internal AC (anterior cell) thermosensory neurons, which express TRPA1, detect warm temperatures and mediate temperature preference behavior. We found that the AC neurons were activated twice when subjected to increasing temperatures. The first response was at ∼25°C via TRPA1 channel, which is expressed in the AC neurons. The second response was at ∼27°C via the second antennal segments, indicating that the second antennal segments are involved in the detection of warm temperatures. Further analysis reveals that pyx-Gal4-expressing neurons have synapses on the AC neurons and that mutation of pyx eliminates the second response of the AC neurons. These data suggest that AC neurons integrate both their own TRPA1-dependent temperature responses and a Pyx-dependent temperature response from the second antennal segments. Our data reveal the first identification of temperature integration, which combines warm temperature information from peripheral to central neurons and provides the possibility that temperature integration is involved in the plasticity of behavioral outputs.

  9. A Novel High Performance Bridgeless Ac-Dc Boost Converter

    Directory of Open Access Journals (Sweden)

    S.M.AshrafulAlam Mohon

    2016-08-01

    Full Text Available A new single phase high performance bridgeless AC-DC Boost converter is proposed. The converter is made bridgeless by the use of two unidirectional switches and two diodes at the input ac side for power conversion for both positive and negative half cycle. Because of the high frequency switching, the power factor of the circuit is inherently corrected and it requires a small filter to make the input current near sinusoidal with limited THD. The significant improvement in THD makes the circuit a good choice in applications needing AC-DC conversion with power conditioning. The circuit exhibits such better performances than conventional AC-DC boost converter with variable loads at constant frequency switching with no additional control circuits. The efficiency of the circuit is also satisfactory. Analysis and simulation results of the circuit are obtained by using software simulation. The main advantage of this new AC-DC converter is its superior power quality over conventional AC-DC boost converter

  10. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  11. Controlo de um conversor AC-DC-AC para turbinas eólicas baseadas no PMSG

    OpenAIRE

    Bulhosa, João Paulo Rodrigues

    2009-01-01

    A dissertação teve como objectivo o estudo e implementação do controlo de um conversor AC-DC-AC, constituído por um conversor DC/DC elevador e um inversor de tensão monofásico, para efectuar a ligação à rede de turbinas eólicas baseadas no gerador síncrono de ímanes permanentes. O controlo global do conversor AC-DC-AC seguiu uma estratégia na qual o controlo do conversor elevador e do inversor de tensão monofásico é implementado de modo independente. O primeiro visa maximizar a potência ex...

  12. Study on AC/A ratio in myopia%近视患者AC/A率的临床意义

    Institute of Scientific and Technical Information of China (English)

    肖婉莉; 孙建宁

    2011-01-01

    目的:探讨AC/A率在近视发生发展中的作用及机制.方法:选择30名正视眼者(正视眼组)及90名近视眼者.对近视眼者根据屈光程度分为轻、中、高度近视眼3组;根据平时戴镜情况,分为从未戴镜、间断戴镜和持续戴镜组.采用同视机法测量AC/A率并进行分析和比较.结果:轻度近视眼组AC/A率平均值为(3.22±1.51)Δ/D,中度(3.46±1.00)Δ/D,高度(3.97±1.36)Δ/D,均高于正视眼组(P<0.05).从未戴镜组AC/A率高于间断戴镜及持续戴镜组(P<0.05).结论:近视患者高AC/A率是调节与辐辏功能不协调的一种表现,高AC/A率可导致眼球近视性改变.近视患者应进行矫正,恢复调节与辐辏的平衡.%Objective: To assess the difterence of accommodative convergence to accommodation (AC/A) ratio in myopia and emmetropia, then evaluate the relationship between AC/A ratio and myopia. Methods: Thirty emmetropia and 90 myopia cases were included in this study. The myopia cases were divided into mild myopia,moderate myopia and high myopia. The AC/A ratios were measured with a synoptophore, and the results were analyzed. Results: Average values of mild myopia group, moderate myopia group and high myopia group were (3.22 ± 1.51 ) Δ/D, (3.46 ± 1.00) Δ/D, (3.46 ± 1.00) Δ/D, a significant difference was found between each group and emmetropia group ( P < 0.05 ). The AC/A ratio of non- wearing glasses group was higher than that of discontinuous wearing and continued wearing glasses group. Conclusion: The increased AC/A ratio represents the incoordination of accommodations and convergences, which can lead to an aggravation of myopia, which should be readjusted.

  13. dc and ac Josephson effect in a superconductor endash Luttinger-liquid endash superconductor system

    International Nuclear Information System (INIS)

    We calculate both the dc and the ac Josephson current through a 1-D system of interacting electrons, connected to two superconductors by tunnel junctions. We treat the (repulsive) Coulomb interaction in the framework of the one-channel, spin-1/2 Luttinger model. The Josephson current is obtained for two geometries of experimental relevance: a quantum wire and a ring. At T=0, the critical current is found to decay algebraically with increasing distance d between the junctions. The decay is characterized by an exponent which depends on the strength of the interaction. At finite temperatures T, lower than the superconducting transition temperature Tc, there is a crossover from algebraic to exponential decay of the critical current as a function of d, at a distance of the order of ℎvF/kBT. Moreover, the dependence of critical current on temperature shows nonmonotonic behavior. If the Luttinger liquid is confined to a ring of circumference L, coupled capacitively to a gate voltage and threaded by a magnetic flux, the Josephson current shows remarkable parity effects under the variation of these parameters. For some values of the gate voltage and applied flux, the ring acts as a π junction. These features are robust against thermal fluctuations up to temperatures on the order of ℎvF/kBL. For the wire geometry, we have also studied the ac-Josephson effect. The amplitude and the phase of the time-dependent Josephson current are affected by electron-electron interactions. Specifically, the amplitude shows pronounced oscillations as a function of the bias voltage due to the difference between the velocities of spin and charge excitations in the Luttinger liquid. Therefore, the ac-Josephson effect can be used as a tool for the observation of spin-charge separation. copyright 1996 The American Physical Society

  14. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  15. Gifts from Exoplanetary Transits

    OpenAIRE

    Narita, Norio

    2009-01-01

    The discovery of transiting extrasolar planets has enabled us a number of interesting stduies. Transit photometry reveals the radius and the orbital inclination of transiting planets, and thereby we can learn the true mass and the density of respective planets by the combined information of radial velocity measurements. In addition, follow-up observations of transiting planets such as secondary eclipse, transit timing variations, transmission spectroscopy, and the Rossiter-McLaughlin effect p...

  16. Magic Wavelength for the Hydrogen 1S-2S Transition

    Science.gov (United States)

    Kawasaki, Akio

    2016-05-01

    The state of the art precision measurement of the transition frequencies of neutral atoms is performed with atoms trapped by the magic wavelength optical lattice that cancels the ac Stark shift of the transitions. Trapping with magic wavelength lattice is also expected to improve the precision of the hydrogen 1S-2S transition frequency, which so far has been measured only with the atomic beam. In this talk, I discuss the magic wavelength for the hydrogen 1S-2S transition, and the possibility of implementing the optical lattice trapping for hydrogen. Optical trapping of hydrogen also opens the way to perform magnetic field free spectroscopy of antihydrogen for the test of CPT theorem.

  17. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae)

    Indian Academy of Sciences (India)

    Manoj Chugh; B R Gulati; S K Gakhar

    2010-03-01

    A repertoire of monoclonal antibodies (mAbs) was generated against the midgut proteins of Anopheles culicifacies mosquitoes. The mAbs AC-43 and AC-29 significantly inhibited Plasmodium vivax development inside the mosquito midgut. The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 recognized 52, 44, 40 and 29 kDa polypeptides. These female midgut-specific polypeptides are shared between An. culicifacies and An. stephensi, two major vectors of malaria in India. Deglycosylation assays revealed that -linked carbohydrates are the major components in epitopes corresponding to AC-43 and AC-29. Gold particle labelling revealed that both these mAbs preferentially bind to glycoproteins at the apical microvilli and the microvillus-associated network present inside transverse sections of the gut epithelium. These regions are particularly known to have receptors for ookinetes, which enable them to cross this epithelial barrier and provide them with certain necessary chemicals or components for further development into oocysts. Therefore, these glycoproteins appear to be potential candidates for a vectordirected transmission-blocking vaccine (TBV).

  18. Perceptions of breath alcohol concentration (BrAC) levels among a sample of bar patrons with BrAC values of 0.08% or higher.

    Science.gov (United States)

    Martin, Ryan J; Chaney, Beth H; Cremeens-Matthews, Jennifer; Vail-Smith, Karen

    2016-09-01

    Breath alcohol concentration (BrAC) is a commonly used measure of alcohol intoxication. Because of the potential negative consequences of excessive alcohol consumption, it is important to examine how accurately intoxicated individuals can estimate their BrAC values, especially individuals over the legal BrAC driving threshold (i.e., 0.08%). To better understand perceptions of BrAC values among intoxicated individuals, this field study examined actual BrAC values and BrAC range estimates (0.08% and above, 0.02-0.07%, less than 0.02%) among a sample of bar patrons (N = 454) with BrAC levels at 0.08% or higher. Bivariate and multivariate analyses were conducted to examine the relationship between actual BrAC values and perceived BrAC levels. We also examined whether the following demographic and drinking variables were associated with underestimating BrAC in this sample: gender, age, race, college student status, plans to get home, and hazardous drinking. Results indicated that the majority (60.4%) of participants underestimated their BrAC (i.e., less than 0.08%) and lower BrAC values correlated with underestimating BrAC ranges (p young (less than 21) intoxicated females are a group at high risk for sexual assault on college campuses. (PsycINFO Database Record PMID:27631614

  19. 21 CFR 880.6320 - AC-powered medical examination light.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate...

  20. AC electrified jets in a flow-focusing device: Jet length scaling.

    Science.gov (United States)

    Castro-Hernández, Elena; García-Sánchez, Pablo; Alzaga-Gimeno, Javier; Tan, Say Hwa; Baret, Jean-Christophe; Ramos, Antonio

    2016-07-01

    We use a microfluidic flow-focusing device with integrated electrodes for controlling the production of water-in-oil drops. In a previous work, we reported that very long jets can be formed upon application of AC fields. We now study in detail the appearance of the long jets as a function of the electrical parameters, i.e., water conductivity, signal frequency, and voltage amplitude. For intermediate frequencies, we find a threshold voltage above which the jet length rapidly increases. Interestingly, this abrupt transition vanishes for high frequencies of the signal and the jet length grows smoothly with voltage. For frequencies below a threshold value, we previously reported a transition from a well-behaved uniform jet to highly unstable liquid structures in which axisymmetry is lost rather abruptly. These liquid filaments eventually break into droplets of different sizes. In this work, we characterize this transition with a diagram as a function of voltage and liquid conductivity. The electrical response of the long jets was studied via a distributed element circuit model. The model allows us to estimate the electric potential at the tip of the jet revealing that, for any combination of the electrical parameters, the breakup of the jet occurs at a critical value of this potential. We show that this voltage is around 550 V for our device geometry and choice of flow rates. PMID:27375826

  1. The AC (Alternating Current) Electrical Behavior of Multi-layered Thermoelectric Devices

    Science.gov (United States)

    Alim, Mohammad A.; Budak, Satilmis; Bhattacharjee, Sudip

    2016-08-01

    In this study the ac (alternating current) small-signal electrical data in the frequency range 5 Hz ≤ f ≤ 13 MHz are obtained for the multi-layered thermoelectric (TE) devices to extract underlying operative mechanisms via an equivalent circuit model. This model is developed from the complex plane plots in conjunction with the Bode plot. It is observed that the inductive behavior is prevalent for both unbombarded and bombarded TE devices regardless of the doses as both types are observed as somewhat weak in thermoelectric properties. The bombarded multi-layered devices followed a systematic pattern in ac behavior via semicircular relaxation both in the impedance and admittance planes for the same measured data. This pattern is attributed to the transition from one lumped behavior to two distinct mechanisms. It is observed that the␣conductive nature of the equivalent circuit model via non-blocking (non-capacitive) elements, attributed to the underlying operative electrical paths between the two opposite electrodes across the multi-layered device exists, satisfying direct current conditions of the equivalent circuit model. The inductive behavior at high frequencies originates from the conductive aspect of the lumped response of the device in addition to the contribution of the electrode leads. Thus, the proposed equivalent circuit model contains external inductance that verifies a meaningful representation of the multi-layered TE device, though weak in thermoelectric properties.

  2. A.c. susceptibility study of CaCl2 doped copper–zinc ferrite system

    Indian Academy of Sciences (India)

    A Y Lipare; P N Vasambekar; A S Vaingankar

    2003-08-01

    Polycrystalline soft ferrites, Zn$_x$ Cu$_{1–x}$ Fe2O4 ( = 0.30, 0.50, 0.70, 0.80 and 0.90), doped with controlled amount of calcium chloride (CaCl2) were prepared by standard ceramic route and studied for a.c. susceptibility. X-ray diffraction studies of the compositions reveal formation of single-phase cubic spinel. The values of lattice constant increase as doping percentage of CaCl2 increased from 0.01% to 0.05% and afterwards decrease slightly. The presence of chlorine ions is confirmed by absorption peak in far IR spectra near 650 cm-1 for all the samples. The variation of a.c. susceptibility with temperature shows the existence of single domain structure for = 0.3 and exhibits transition from single domain to multidomain structure with increased Ca2+ contents from 0.01 to 0.1%. The composition, = 0.5, shows multidomain structure independent of Ca2+ content. The samples for = 0.70, 0.80 and 0.90 show paramagnetic behaviour at and above room temperature.

  3. Ac-dc conversion effect in Y-Ba-Cu-O ceramics

    International Nuclear Information System (INIS)

    In Y-Ba-Cu-O ceramics, the dc voltage (V/sub dc/ ) induced by an rf current of 2--20 MHz, which had been previously reported as ''reverse ac Josephson effect,'' was observed at 77--300 K. The observed V/sub dc/ is not found to be due to reverse ac Josephson effect but due to nonlinear current-voltage characteristics, as in the case of BaPb/sub 1-//sub x/Bi/sub x/O3. However, behavior of the V/sub dc/ is different from that in BaPb/sub 1-//sub x/Bi/sub x/O3, which was related to bulk superconducting transition. The V/sub dc/ is observed only in the sample with particular electrical contacts and only when the rf current can flow through the potential electrical contacts. The origin of the rf-to-dc conversion effect in Y-Ba-Cu-O is ascribed to local nonlinear resistance near potential contacts

  4. Single stage AC-DC converter for Galfenol-based micro-power energy harvesters

    Science.gov (United States)

    Cavaroc, Peyton; Curtis, Chandra; Naik, Suketu; Cooper, James

    2014-06-01

    Military based sensor systems are often hindered in operational deployment and/or other capabilities due to limitations in their energy storage elements. Typically operating from lithium based batteries, there is a finite amount of stored energy which the sensor can use to collect and transmit data. As a result, the sensors have reduced sensing and transmission rates. However, coupled with the latest advancements in energy harvesting, these sensors could potentially operate at standard sensing and transition rates as well as dramatically extend lifetimes. Working with the magnetostrictive material Galfenol, we demonstrate the production of enough energy to supplement and recharge a solid state battery thereby overcoming the deficiencies faced by unattended sensors. As with any vibration-based energy harvester, this solution produces an alternating current which needs to be rectified and boosted to a level conducive to recharge the storage element. This paper presents a power converter capable of efficiently converting an ultra-low AC voltage to a solid state charging voltage of 4.1VDC. While we are working with Galfenol transducers as our energy source, this converter may also be applied with any AC producing energy harvester, particularly at operating levels less than 2mW and 200mVAC.

  5. The AC (Alternating Current) Electrical Behavior of Multi-layered Thermoelectric Devices

    Science.gov (United States)

    Alim, Mohammad A.; Budak, Satilmis; Bhattacharjee, Sudip

    2016-11-01

    In this study the ac (alternating current) small-signal electrical data in the frequency range 5 Hz ≤ f ≤ 13 MHz are obtained for the multi-layered thermoelectric (TE) devices to extract underlying operative mechanisms via an equivalent circuit model. This model is developed from the complex plane plots in conjunction with the Bode plot. It is observed that the inductive behavior is prevalent for both unbombarded and bombarded TE devices regardless of the doses as both types are observed as somewhat weak in thermoelectric properties. The bombarded multi-layered devices followed a systematic pattern in ac behavior via semicircular relaxation both in the impedance and admittance planes for the same measured data. This pattern is attributed to the transition from one lumped behavior to two distinct mechanisms. It is observed that the conductive nature of the equivalent circuit model via non-blocking (non-capacitive) elements, attributed to the underlying operative electrical paths between the two opposite electrodes across the multi-layered device exists, satisfying direct current conditions of the equivalent circuit model. The inductive behavior at high frequencies originates from the conductive aspect of the lumped response of the device in addition to the contribution of the electrode leads. Thus, the proposed equivalent circuit model contains external inductance that verifies a meaningful representation of the multi-layered TE device, though weak in thermoelectric properties.

  6. AC Read-Out Circuits for Single Pixel Characterization of TES Microcalorimeters and Bolometers

    Science.gov (United States)

    Gottardi, L.; van de Kuur, J.; Bandler, S.; Bruijn, M.; de Korte, P.; Gao, J. R.; den Hartog, R.; Hijmering, R. A.; Hoevers, H.; Koshropanah, P.; Kilbourne, C.; Lindemann, M. A.; Parra Borderias, M.; Ridder, M.

    2011-01-01

    SRON is developing Frequency Domain Multiplexing (FDM) for the read-out of transition edge sensor (TES) soft x-ray microcalorimeters for the XMS instrument of the International X-ray Observatory and far-infrared bolometers for the SAFARI instrument on the Japanese mission SPICA. In FDM the TESs are AC voltage biased at frequencies from 0.5 to 6 MHz in a superconducting LC resonant circuit and the signal is read-out by low noise and high dynamic range SQUIDs amplifiers. The TES works as an amplitude modulator. We report on several AC bias experiments performed on different detectors. In particular, we discuss the results on the characterization of Goddard Space Flight Center x-ray pixels and SRON bolometers. The paper focuses on the analysis of different read-out configurations developed to optimize the noise and the impedance matching between the detectors and the SQUID amplifier. A novel feedback network electronics has been developed to keep the SQUID in flux locked loop, when coupled to superconducting high Q circuits, and to optimally tune the resonant bias circuit. The achieved detector performances are discussed in view of the instrument requirement for the two space missions.

  7. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...

  8. Behaviour analysis of AC-600 passive safety systems

    International Nuclear Information System (INIS)

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  9. AC susceptibility studies of the superconductivity of PrOs{sub 4}Sb{sub 12}

    Energy Technology Data Exchange (ETDEWEB)

    Drobnik, S. [Physikalisches Institut, Universitaet Karlsruhe, Wolfgang Gaede Str. 1, D-76128 Karlsruhe (Germany); Forschungszentrum Karlsruhe, Institut fuer Festkoerperphysik, D-76021 Karlsruhe (Germany); Grube, K. [Forschungszentrum Karlsruhe, Institut fuer Festkoerperphysik, D-76021 Karlsruhe (Germany); Pfleiderer, C. [Physikalisches Institut, Universitaet Karlsruhe, Wolfgang Gaede Str. 1, D-76128 Karlsruhe (Germany) and Forschungszentrum Karlsruhe, Institut fuer Festkoerperphysik, D-76021 Karlsruhe (Germany)]. E-mail: christian.pfleiderer@pi.uka.de; Loehneysen, H.V. [Physikalisches Institut, Universitaet Karlsruhe, Wolfgang Gaede Str. 1, D-76128 Karlsruhe (Germany); Forschungszentrum Karlsruhe, Institut fuer Festkoerperphysik, D-76021 Karlsruhe (Germany); Bauer, E.D. [Department of Physics and Institute of Pure and Applied Physical Sciences, University of California at San Diego, La Jolla, CA 92093 (United States); Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Maple, M.B. [Department of Physics and Institute of Pure and Applied Physical Sciences, University of California at San Diego, La Jolla, CA 92093 (United States)

    2005-04-30

    We report the superconducting phase diagram of PrOs{sub 4}Sb{sub 12} deduced from the real-part {chi}{sup '} and the imaginary part {chi}{sup '}' of the AC susceptibility. The double transition at T{sub c1}=1.85K and T{sub c2}=1.75K seen in the specific heat may be related to features in {chi}{sup '} and {chi}{sup '}', where full diamagnetic shielding is observed below T{sub c2} only. As function of magnetic field the phase bounded by T{sub c2} displays features reminiscent of the peak effect.

  10. Analysis of AC loss in superconducting power devices calculated from short sample data

    OpenAIRE

    Rabbers, J.J.; Haken, ten, Bennie; Kate, ten, F.J.W.

    2003-01-01

    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile and the transport current, the local AC loss is calculated. Integration over the conductor length yields the AC loss of the device. The total AC loss of the device is split up in different compone...

  11. Temas de Física para Ingeniería: Acústica

    OpenAIRE

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  12. Magic wavelengths for the 5s-18s transition in rubidium

    NARCIS (Netherlands)

    Goldschmidt, E.A.; Norris, D.G.; Koller, S.B.; Wyllie, R.; Brown, R.C.; Porto, J.; Safronova, M.S.; Safronova, U.I.

    2015-01-01

    Magic wavelengths, for which there is no differential ac Stark shift for the ground and excited state of the atom, allow trapping of excited Rydberg atoms without broadening the optical transition. This is an important tool for implementing quantum gates and other quantum information protocols with

  13. 75 FR 20541 - Homeless Emergency Assistance and Rapid Transition to Housing: Defining “Homeless”

    Science.gov (United States)

    2010-04-20

    ... the proposal by name and docket number (FR-5333-P-01) and must be sent to: HUD Desk Officer, Office of... URBAN DEVELOPMENT 24 CFR Part 577 RIN 2506-AC26 Homeless Emergency Assistance and Rapid Transition to Housing: Defining ``Homeless'' AGENCY: Office of the Assistant Secretary for Community Planning...

  14. Energy Released During the H-L Back Transition

    Science.gov (United States)

    Eldon, D.; Kolemen, E.; Gohil, P.; McKee, G. R.; Yan, Z.; Schmitz, L.

    2015-11-01

    Prompt energy loss (ΔW) at the H-L transition, as a fraction of total stored energy before the transition, is about 30 % and is insensitive to density in ITER-similar DIII-D plasmas. Occasionally, some ELMs will appear before the transition and reduce total energy, thus reducing ΔW across the following transition. Other results (not in the ITER-similar shape) have shown that ELMs can be triggered in low powered H-modes, prior to H-L transitions, when the plasma is stable to ideal P-B modes (these are not typical type-I ELMs, despite superficial similarities) and E × B shear is strong. These are indeed ELMs occurring in H-mode and not part of a dithering transition. Finally, ELM ΔW is sensitive to edge toroidal rotation and becomes smaller than uncertainty (point to a strategy where ΔW for the H-L transition may be reduced by the presence of (not type-I) ELMs before the transition, and ΔW for the ELMs may be reduced by controlling rotation. Work supported by the US Department of Energy under DE-AC02-09CH11466 and DE-FC02-04ER54698.

  15. 一种简单新型拓扑Cuk AC/AC变换器及其仿真研究%A New Simple Topology of Cuk AC/AC Converter and Its Simulation

    Institute of Scientific and Technical Information of China (English)

    陈溪; 刘韬; 谭光慧; 纪延超

    2006-01-01

    由Cuk DC/DC变换器的拓扑结构导出一种只具有两个开关的PWM AC/AC变换器的简单新型拓扑--Cuk AC/AC变换器.给出单相和三相Cuk AC/AC变换器的拓扑结构,分析Cuk AC/AC变换器的外特性及小信号特性.仿真结果验证了所提的Cuk AC/AC变换器的合理性和可行性.

  16. Modelling ac ripple currents in HTS coated conductors

    Science.gov (United States)

    Xu, Zhihan; Grilli, Francesco

    2015-10-01

    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  17. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  18. AC losses in circular arrangements of parallel superconducting tapes

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;

    1998-01-01

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  19. AC Zeeman potentials for atom chip-based ultracold atoms

    Science.gov (United States)

    Fancher, Charles; Pyle, Andrew; Ziltz, Austin; Aubin, Seth

    2015-05-01

    We present experimental and theoretical progress on using the AC Zeeman force produced by microwave magnetic near-fields from an atom chip to manipulate and eventually trap ultracold atoms. These AC Zeeman potentials are inherently spin-dependent and can be used to apply qualitatively different potentials to different spin states simultaneously. Furthermore, AC Zeeman traps are compatible with the large DC magnetic fields necessary for accessing Feshbach resonances. Applications include spin-dependent trapped atom interferometry and experiments in 1D many-body physics. Initial experiments and results are geared towards observing the bipolar detuning-dependent nature of the AC Zeeman force at 6.8 GHz with ultracold 87Rb atoms trapped in the vicinity of an atom chip. Experimental work is also underway towards working with potassium isotopes at frequencies of 1 GHz and below. Theoretical work is focused on atom chip designs for AC Zeeman traps produced by magnetic near-fields, while also incorporating the effect of the related electric near-fields. Electromagnetic simulations of atom chip circuits are used for mapping microwave propagation in on-chip transmission line structures, accounting for the skin effect, and guiding impedance matching.

  20. Impedance, AC conductivity and dielectric behavior Adeninium Trichloromercurate (II)

    Science.gov (United States)

    Fersi, M. Amine; Chaabane, I.; Gargouri, M.

    2016-09-01

    In this work, we report the measurements impedance spectroscopy technique for the organic-inorganic hybrid compound (C5H6N5) HgCl3, 11/2H2O measured in the 209 Hz-5 MHz frequency range from 378 to 428 K. Besides, the Cole-Cole (Z″ versus Z‧) plots were well fitted to an equivalent circuit built up by a parallel combination of resistance (R), fractal capacitance (CPE) and capacitance (C). Furthermore, the AC conductivity was investigated as a function of temperature and frequency in the same range. The experiment results indicated that AC conductivity (σac) was proportional to σdc + A ωS . The obtained results are discussed in terms of the correlated barrier hopping (CBH) model. An agreement between the experimental and theoretical results suggests that the AC conductivity behavior of Adeninium Trichloromercurate (II) can be successfully explained by CBH model. The contribution of single polaron hopping to AC conductivity in a present alloy was also studied.

  1. Microstructure and mechanical properties of AC AlSi9CuX alloys

    Directory of Open Access Journals (Sweden)

    L.A. Dobrzański

    2007-10-01

    Full Text Available Purpose: In order to gain a better understanding of how to control the as-cast microstructure, it is important to understand the evaluation of microstructure during solidification and understanding how influence the changes of chemical concentration on this microstructure and mechanical properties. In this research, the effect of Cu content on the microstructure and mechanical properties of AC AlSi9CuX series alloys has been investigated.Design/methodology/approach: The experimental alloy used in this investigation were prepared at the University of Windsor (Canada in the Light Metals Casting Laboratory, by mixing the AC AlSi5Cu1(Mg commercial alloys and two master alloys AlSi49 and AlCu55, in a 10 kg capacity ceramic crucible. Optical microscope, transition electron microscope and scanning electron microscope were used to characterize the microstructure and intermetallic phases. Secondary dendrite arm spacing measurements were carried out using an Leica Q-WinTM image analyzer. Compression tests were conducted at room temperature using a Zwick universal testing machine. Rockwell F–scale hardness tests were conducted at room temperature using a Zwick HR hardness testing machine. Vickers microhardness tests were conducted using a DUH 202 microhardness testing machine.Findings: It was found that the increase of Cu content to 2 wt% leads to change of the Al+Si eutectic morphology, resulting in a grate increase in the ultimate tensile strength and ductility values compared to the alloys include 1 and 4 wt % of Cu. Based on the X–ray phase analysis was found, that change of Cu content don’t influences on the phases composition of investigated alloy.Practical implications: The aim of this work is describe in detail the solidification process in a number of AC AlSi9CuX foundry alloys. In investigated alloys there were identified five phases, which can suggest together witch thermal analysis, that in these alloys occur four solidification reactions

  2. COMPARISON OF BACTERIAL ADSORPTION AND ANTIBACTERIAL PROPERTIES BETWEEN AC AND AC(Ag)%AC及AC(Ag)对细菌的吸附及灭菌功能的对比研究

    Institute of Scientific and Technical Information of China (English)

    万怡灶; 王玉林; 董向红; 周福刚; 成国祥; 温廷益; 韩森

    2000-01-01

    测定了活性碳(AC)及载银活性碳(AC(Ag))的比表面积和孔径分布曲线,对比研究了AC及AC(Ag))对大肠杆菌的吸附能力和灭菌性能.结果表明,载银后,虽然AC(Ag)的比表面积下降,但由于银的存在,使其吸附的大肠杆菌数量高于AC,而吸附速率低于AC.灭菌试验表明,AC对大肠杆菌没有杀灭能力,而AC(Ag)对大肠杆菌有较好的灭菌功能.

  3. Variable transposition of eight maize activator (ac) elements located on the short arm of chromosome 1.

    Science.gov (United States)

    Sheridan, William F

    2011-09-01

    Eight Activator (Ac) transposable elements mapped to the maize chromosome arm 1S were assessed for Ac transposition rates. For each of the Ac stocks, plants homozygous for the single Ac element and the Ds reporter r1-sc:m3 on chromosome 10 were crossed as females by a homozygous r1-sc:m3 tester color-converted W22 line. The resulting ears produced mostly coarsely spotted kernels and a low frequency of either near-colorless fine-spotted kernels or nonspotted kernels. The relative frequency of these two types of near-colorless kernels differed among the eight Ac stocks. The extent to which increased Ac dosage results in nonspotted kernels may be Ac-specific. Although all of the Ac elements are in near-isogenic inbred W22 lines, they varied to a large extent in their transposition frequency. These differences might possibly result from structural differences among the Ac elements. Because one pair of Ac elements derived from Ac33 on chromosome arm 5S differed about 13-fold in transposition frequency and a second pair of Ac elements derived from Ac12 on chromosome arm 1S differed about 3-fold in transposition frequency, this is not a likely explanation for all eight Ac elements. The data presented here support the notion that the differences in transposition frequency of the eight Ac elements may be a reflection of variability in Ac transcription or accessibility of the transposase to the Ac element, resulting from differences in the chromatin environments wherein the Ac elements are located. This is the first report of variability in transposition rates among different Ac donor lines.

  4. The Managerial Transition.

    Science.gov (United States)

    Kneeland, Steven J.

    1980-01-01

    Having identified the problem of managerial transition in a previous article (CE 510 277), the author outlines a strategy for change which includes performance appraisal, definition of the management structure, and counselling for the individual in transition. (SK)

  5. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  6. Strongly nonlinear dynamics of electrolytes in large ac voltages

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    We study the response of a model microelectrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes...... in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasiequilibrium structure of the double layers. The former leads to the prediction of “ac capacitive desalination” since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion...... nonlinear responses to large ac voltages, such as Faradaic reactions, electro-osmotic instabilities, and induced-charge electrokinetic phenomena....

  7. The minimization of ac phase noise in interferometric systems

    DEFF Research Database (Denmark)

    Filinski, Ignacy; Gordon, R A

    1994-01-01

    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using....... Such a change will lead to a reduction of both low-frequency and high-frequency ac phase noise by more than an order of magnitude and can be carried out for all interferometers with the exception of multiple pass optical systems and high-resolution FFT spectrometers. It is pointed out that most homemade air...

  8. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  9. Offshore windfarm connection with low frequency AC transmission technology

    DEFF Research Database (Denmark)

    Qin, Nan; Xu, Zhao; You, Shi;

    2009-01-01

    This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared to the c......This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared...... to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...

  10. Experiments on Corona Discharge Under AC and DC Composite Voltage

    Institute of Scientific and Technical Information of China (English)

    ZHU Zhengyi; LI Ruihai; WANG Guoli; CHEN Can; JIA Zhidong; GUAN Zhicheng

    2012-01-01

    Converter transformers are one of the most important electrical apparatuses in the ultra high voltage(UHV) DC transmission systems.The valve side and the low voltage(LV) bushing are stressed by long-term AC and DC composite voltage leading to significant partial discharge(PD) and posing great danger to the insulation system.In this paper AC and DC composite voltage is applied on a metal needle-plate model to produce PD signal sequences,and then the pulse waveshape and frequency spectrum are analyzed and compared with PD signals under conventional AC or DC voltage.In the end,the phase-resolved distribution is analyzed to depict the new characteristics of PD under this composite voltage.

  11. Harmonic-free line-commutated ac/dc rectifiers

    Energy Technology Data Exchange (ETDEWEB)

    Villablanca, Miguel E. [Electrical Engineering Department, University of Santiago, P.O. Box 10233, Santiago (Chile)

    2009-11-15

    In this paper both a method and apparatus are applied to different configurations of line-commutated ac/dc rectifiers to reduce the distortion of currents flowing from the ac supply. The load may be either inductive or capacitive. The technology involves an accurate shaping of the dc current by using two self-commutated switches. This dc-current shaping is reflected back into the shaping of the ac input currents, which become pure sine waves. Thyristor-based rectifying operation is possible with a simple control circuit, which is able to deal with both rapid load variations and failures in the self-commutated switches. Furthermore, the overlap conduction of bridge thyristors is eliminated completely. Experimental verification is provided from a 400-V 30-kVA 50-Hz laboratory prototype. (author)

  12. Theory of the ac spin-valve effect.

    Science.gov (United States)

    Kochan, Denis; Gmitra, Martin; Fabian, Jaroslav

    2011-10-21

    The spin-valve complex magnetoimpedance of symmetric ferromagnet-normal-metal-ferromagnet junctions is investigated within the drift-diffusion (standard) model of spin injection. The ac magnetoresistance-the real part difference of the impedances of the parallel and antiparallel magnetization configurations-exhibits an overall damped oscillatory behavior, as an interplay of the diffusion and spin relaxation times. In wide junctions the ac magnetoresistance oscillates between positive and negative values, reflecting resonant amplification and depletion of the spin accumulation, while the line shape for thin tunnel junctions is predicted to be purely Lorentzian. The ac spin-valve effect could be a technique to extract spin transport and spin relaxation parameters in the absence of a magnetic field and for a fixed sample size. PMID:22107552

  13. Measurement and comparison of AC parameters of silicon (BSR and BSFR) and gallium arsenide (GaAs/Ge) solar cells used in space applications

    Energy Technology Data Exchange (ETDEWEB)

    Anil Kumar, R.; Suresh, M.S. [ISRO Satellite Centre, ISRO, Bangalore 560, 017 Kolhapur (India); Nagaraju, J. [Department of Instrumentation, Indian Institute of Science, Bangalore 560, 012 Kolhapur (India)

    2000-01-15

    The AC parameters of silicon (BSR and BSFR) solar cells and GaAs/Ge solar cell have been measured using impedance spectroscopy. Each cell capacitance, dynamic resistance and series resistance were measured and compared. GaAs/Ge solar cell has shown only the transition capacitance throughout its operating range while silicon (BSR and BSFR) solar cells exhibited both transition and diffusion capacitance. The theoretical and experimental values of dynamic resistance were compared and found in good agreement while the diode factor in silicon solar cells varies from 2 to 1, where as in GaAs/Ge solar cell it varies from 4 to 2 to 1.

  14. F2AC: A Lightweight, Fine-Grained, and Flexible Access Control Scheme for File Storage in Mobile Cloud Computing

    Directory of Open Access Journals (Sweden)

    Wei Ren

    2016-01-01

    Full Text Available Current file storage service models for cloud servers assume that users either belong to single layer with different privileges or cannot authorize privileges iteratively. Thus, the access control is not fine-grained and flexible. Besides, most access control methods at cloud servers mainly rely on computationally intensive cryptographic algorithms and, especially, may not be able to support highly dynamic ad hoc groups with addition and removal of group members. In this paper, we propose a scheme called F2AC, which is a lightweight, fine-grained, and flexible access control scheme for file storage in mobile cloud computing. F2AC can not only achieve iterative authorization, authentication with tailored policies, and access control for dynamically changing accessing groups, but also provide access privilege transition and revocation. A new access control model called directed tree with linked leaf model is proposed for further implementations in data structures and algorithms. The extensive analysis is given for justifying the soundness and completeness of F2AC.

  15. Cities in Transition

    OpenAIRE

    Shepotylo Oleksandr

    2012-01-01

    This paper looks at the urban development of transition countries in 1991–2010, primarily focusing on the last decade. Cities in transition face a unique set of challenges that came forth due to interplay of the legacy of socialist urban policies and the transition to the market economy. The socialist urban policies restrained growth of the largest cities and distorted the spatial equilibrium towards more uniform distribution of urban population. The transition to the market economy reduces d...

  16. Cosmological phase transitions

    Energy Technology Data Exchange (ETDEWEB)

    Kolb, E.W. [Fermi National Accelerator Lab., Batavia, IL (United States)]|[Chicago Univ., IL (United States)

    1993-10-01

    If modern ideas about the role of spontaneous symmetry breaking in fundamental physics are correct, then the Universe should have undergone a series of phase transitions early in its history. The study of cosmological phase transitions has become an important aspect of early-Universe cosmology. In this lecture I review some very recent work on three aspects of phase transitions: the electroweak transition, texture, and axions.

  17. Introducing high performance distributed logging service for ACS

    Science.gov (United States)

    Avarias, Jorge A.; López, Joao S.; Maureira, Cristián; Sommer, Heiko; Chiozzi, Gianluca

    2010-07-01

    The ALMA Common Software (ACS) is a software framework that provides the infrastructure for the Atacama Large Millimeter Array and other projects. ACS, based on CORBA, offers basic services and common design patterns for distributed software. Every properly built system needs to be able to log status and error information. Logging in a single computer scenario can be as easy as using fprintf statements. However, in a distributed system, it must provide a way to centralize all logging data in a single place without overloading the network nor complicating the applications. ACS provides a complete logging service infrastructure in which every log has an associated priority and timestamp, allowing filtering at different levels of the system (application, service and clients). Currently the ACS logging service uses an implementation of the CORBA Telecom Log Service in a customized way, using only a minimal subset of the features provided by the standard. The most relevant feature used by ACS is the ability to treat the logs as event data that gets distributed over the network in a publisher-subscriber paradigm. For this purpose the CORBA Notification Service, which is resource intensive, is used. On the other hand, the Data Distribution Service (DDS) provides an alternative standard for publisher-subscriber communication for real-time systems, offering better performance and featuring decentralized message processing. The current document describes how the new high performance logging service of ACS has been modeled and developed using DDS, replacing the Telecom Log Service. Benefits and drawbacks are analyzed. A benchmark is presented comparing the differences between the implementations.

  18. Transitivity of Preferences

    Science.gov (United States)

    Regenwetter, Michel; Dana, Jason; Davis-Stober, Clintin P.

    2011-01-01

    Transitivity of preferences is a fundamental principle shared by most major contemporary rational, prescriptive, and descriptive models of decision making. To have transitive preferences, a person, group, or society that prefers choice option "x" to "y" and "y" to "z" must prefer "x" to "z". Any claim of empirical violations of transitivity by…

  19. Aligned Immobilization of Proteins Using AC Electric Fields.

    Science.gov (United States)

    Laux, Eva-Maria; Knigge, Xenia; Bier, Frank F; Wenger, Christian; Hölzel, Ralph

    2016-03-01

    Protein molecules are aligned and immobilized from solution by AC electric fields. In a single-step experiment, the enhanced green fluorescent proteins are immobilized on the surface as well as at the edges of planar nanoelectrodes. Alignment is found to follow the molecules' geometrical shape with their longitudinal axes parallel to the electric field. Simultaneous dielectrophoretic attraction and AC electroosmotic flow are identified as the dominant forces causing protein movement and alignment. Molecular orientation is determined by fluorescence microscopy based on polarized excitation of the proteins' chromophores. The chromophores' orientation with respect to the whole molecule supports X-ray crystal data. PMID:26779699

  20. Droop-free Distributed Control for AC Microgrids

    DEFF Research Database (Denmark)

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.;

    2016-01-01

    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...