Microstructural characterisation and change in a.c. magnetic susceptibility of duplex stainless steel during spinodal decomposition

Energy Technology Data Exchange (ETDEWEB)

Lo, K.H., E-mail: KHLO@umac.m [Department of Electromechanical Engineering, University of Macau, Macau (China); Department of Physics and Materials Science, City University of Hong Kong (Hong Kong); Lai, J.K.L. [Department of Physics and Materials Science, City University of Hong Kong (Hong Kong)

2010-06-15

The microstructural changes during long-term (up to 10,000 h) spinodal decomposition in a duplex stain less steel, 7MoPLUS, have been characterised using TEM, a.c. magnetic susceptibility, X-ray diffractometry, microhardness measurement and optical microscopy. The microstructural changes and deformation microstructures of ferrite and austenite upon spinodal decomposition are characterised. The use of a.c. magnetic susceptibility to study the progress of spinodal decomposition is discussed. Above 450 {sup o}C, recent research by K.L. Weng et al. Mater. Sci. Eng. A 379 (2004) 119 has established that spinodal decomposition leads to crisscrossing of dislocations and the development of mottled contrast in the ferrite phase. The present work has shown that at 350 {sup o}C (the low-end of the spinodal range), crisscrossing of dislocations still occurs, but mottled contrast is absent. The G phase tends to be in contact with dislocations and its precipitation lags behind the occurrence of spinodal decomposition. No noticeable microstructural changes could be observed in the austenite phase in the spinodal temperature regime.

An ac susceptibility study in capped Ni/Ni(OH)2 core-shell nanoassemblies: dual peak observations

International Nuclear Information System (INIS)

Godsell, Jeffrey F; Roy, Saibal; Bala, Tanushree; Ryan, Kevin M.

2011-01-01

In this study, the ac susceptibility (χ' and χ'') variation with temperature (10-100 K) for oleic acid (OA) capped Ni/Ni(OH) 2 core-shell nanoparticle assemblies are reported at frequencies varying from 0.1 to 1000 Hz. Nanoparticle assemblies, with two average particle diameters of ∼34 nm and ∼14 nm, were synthesized using a wet chemical synthesis approach. Two peaks in the ac susceptibility versus temperature curves are clearly discernable for each of the samples. The first, occurring at ∼22 K was attributed to the paramagnetic/antiferromagnetic transition of the Ni(OH) 2 present in the shell. The second higher temperature peak was attributed to the superparamagnetic blocking of the pure Ni situated at the core of the nanoparticles. The higher temperature peaks in both the χ' and χ'' curves were observed to increase with increasing frequency. Thus the Neel and the blocking temperatures for such core-shell nanoassemblies were clearly identified from the ac analysis, whereas they were not discernible (superimposed) even from very low dc (FC/ZFC) field measurements. Interparticle interactions within the assemblies were studied through the fitting of phenomenological laws to the experimental datasets. It is observed that even with an OA capping layer, larger Ni/Ni(OH) 2 nanoparticles experience a greater degree of sub-capping layer oxidation thus producing lower magnetic interaction strengths.

Ac susceptibility studies on Bi-Sr-Ca-Cu-O system

International Nuclear Information System (INIS)

Chakravarti, Arani; Mukherjee, C.D.; Ranganathan, R.; Chatterjee, N.; Raychaudhuri, A.K.

1991-01-01

We report the low a.c. susceptibility data χ'(T,Hsub(rms)), χsup(double inverted commas)(T,Hsub(rms)) for the newly prepared superconducting system Bi x Sr 4 Ca 2 Cu 4 O y (x=0.5, 1.0 and 1.5) containing Bi at concentrations lower than that in the conventional Bi-based system. The experimental results are discussed in the light of existing theories. (author). 10 refs., 3 figs

Whole tissue AC susceptibility after superparamagnetic iron oxide contrast agent administration in a rat model

International Nuclear Information System (INIS)

Lazaro, Francisco Jose; Gutierrez, Lucia; Rosa Abadia, Ana; Soledad Romero, Maria; Lopez, Antonio; Jesus Munoz, Maria

2007-01-01

A magnetic AC susceptibility characterisation of rat tissues after intravenous administration of superparamagnetic iron oxide (Endorem ( R)), at the same dose as established for Magnetic Resonance Imaging (MRI) contrast enhancement in humans, has been carried out. The measurements reveal the presence of the contrast agent as well as that of physiological ferritin in liver and spleen while no traces have been magnetically detected in heart and kidney. This preliminary work opens suggestive possibilities for future biodistribution studies of any type of magnetic carriers

Magnetic-susceptibility and heat-capacity measurements on PrRhSb

International Nuclear Information System (INIS)

Malik, S.K.; Takeya, H.; Gschneidner, K.A. Jr.

1994-01-01

Magnetic-susceptibility (ac and dc) and heat-capacity measurements have been carried out on the compound PrRhSb. These measurements reveal two magnetic transitions in this compound---one at about 18 K and the other around 6 K. In the dc susceptibility the 18-K transition is evident as the temperature below which a magnetic correlation sets in and the susceptibility is found to be field dependent. The lower transition manifests as a peak in the susceptibility of zero-field-cooled samples which were measured in low applied fields. The electronic-specific-heat coefficient, γ, is found to be 33 mJ/mol K 2 between 40 and 70 K after correcting for the lattice contribution taken to be the same as in its La analog. The γ value is fairly large for a Pr compound and may be indicative of moderately heavy quasiparticles. A Kondo-type interaction of the Pr 4f electrons with the conduction electrons may be responsible for high-magnetic-ordering temperatures and the moderately large γ value in this compound

Vortex dynamics and irreversibility line in optimally doped SmFeAsO0.8F0.2 from ac susceptibility and magnetization measurements

Science.gov (United States)

Prando, G.; Carretta, P.; de Renzi, R.; Sanna, S.; Palenzona, A.; Putti, M.; Tropeano, M.

2011-05-01

Ac susceptibility and static magnetization measurements were performed in the optimally doped SmFeAsO0.8F0.2 superconductor. The field-temperature phase diagram of the superconducting state was drawn, and, in particular, the features of the flux lines were derived. The dependence of the intragrain depinning energy on the magnetic field intensity was derived in the thermally activated flux-creep framework, enlightening a typical 1/H dependence in the high-field regime. The intragrain critical current density was extrapolated in the zero-temperature and zero-magnetic-field limit, showing a remarkably high value Jc0(0)~2×107 A/cm2, which demonstrates that this material is rather interesting for potential future technological applications.

Measuring Nematic Susceptibilities from the Elastoresistivity Tensor

Science.gov (United States)

Hristov, A. T.; Shapiro, M. C.; Hlobil, Patrick; Maharaj, Akash; Chu, Jiun-Haw; Fisher, Ian

The elastoresistivity tensor mijkl relates changes in resistivity to the strain on a material. As a fourth-rank tensor, it contains considerably more information about the material than the simpler (second-rank) resistivity tensor; in particular, certain elastoresistivity coefficients can be related to thermodynamic susceptibilities and serve as a direct probe of symmetry breaking at a phase transition. The aim of this talk is twofold. First, we enumerate how symmetry both constrains the structure of the elastoresistivity tensor into an easy-to-understand form and connects tensor elements to thermodynamic susceptibilities. In the process, we generalize previous studies of elastoresistivity to include the effects of magnetic field. Second, we describe an approach to measuring quantities in the elastoresistivity tensor with a novel transverse measurement, which is immune to relative strain offsets. These techniques are then applied to BaFe2As2 in a proof of principle measurement. This work is supported by the Department of Energy, Office of Science, Basic Energy Sciences, Materials Sciences and Engineering Division, under Contract DE-AC02-76SF00515.

Susceptibility of The Asian Corn Borer, Ostrinia furnacalis, to Bacillus thuringiensis Toxin CRY1AC

Directory of Open Access Journals (Sweden)

Aye Kyawt Kyawt Ei

2008-07-01

Full Text Available The larval susceptibility of the Asian corn borer, Ostrinia furnacalis (Guenee (Lepidoptera: Crambidae, to a Bacillus thuringiensis protein (Cry1Ac was evaluated using insect feeding bioassays. The founding population of O. furnacalis was originally collected from the experimental station of UGM at Kalitirto and had been reared in the laboratory for three generations using an artificial diet “InsectaLf”. The tested instars were exposed on diets treated with a series of concentrations of Cry1Ac for one week. The LC50 values on the seventh day after treatment for 1st, 2nd, 3rd and 4th instars were 7.79, 21.12, 113.66, and 123.17 ppm, respectively, showing that the higher the instars the lesser the susceptibility to Cry1Ac. When the neonates were exposed to sublethal concentrations of Cry1Ac (0.0583, 0.116, and 0.5830 ppm, growth and development of the surviving larvae were inhibited. The fecundity and viability of females produced from treated larvae decreased with increasing the concentrations. These findings indicate that Cry1Ac is toxic to larva of O. furnacalis and has chronic effects to larvae surviving from Cry1Ac ingestion.   Kepekaan larva penggerek batang jagung Asia, Ostrinia furnacalis (Guenee (Lepidoptera: Crambidae, terhadap protein Bacillus thuringiensis Cry1Ac diuji dengan metode celup pakan. Larva berasal dari pertanaman jagung di KP-4, UGM di Kalitirto dan telah dikembangbiakkan di laboratorium menggunakan pakan buatan (InsectaLF selama tiga generasi sebelum digunakan untuk pengujian. Larva O. furnacalis yang diuji dipaparkan pada pakan buatan yang telah dicelupkan pada seri konsentrasi Cry1Ac. Nilai LC50 pada hari ketujuh setelah perlakukan untuk instar 1, 2, 3, dan 4 berturut-turut adalah 0,79; 21,12; 113,66; dan 123,17 ppm. Hal ini menunjukkan bahwa instar yang semakin tinggi tingkat kepekaannya terhadap Cry1Ac semakin menurun. Larva yang baru menetas dan diberi pakan yang telah dicelupkan pada konsentrasi sublethal Cry1Ac

A toxin-binding alkaline phosphatase fragment synergizes Bt toxin Cry1Ac against susceptible and resistant Helicoverpa armigera.

Directory of Open Access Journals (Sweden)

Wenbo Chen

Full Text Available Evolution of resistance by insects threatens the continued success of pest control using insecticidal crystal (Cry proteins from the bacterium Bacillus thuringiensis (Bt in sprays and transgenic plants. In this study, laboratory selection with Cry1Ac yielded five strains of cotton bollworm, Helicoverpa armigera, with resistance ratios at the median lethal concentration (LC50 of activated Cry1Ac ranging from 22 to 1700. Reduced activity and reduced transcription of an alkaline phosphatase protein that binds Cry1Ac was associated with resistance to Cry1Ac in the four most resistant strains. A Cry1Ac-binding fragment of alkaline phosphatase from H. armigera (HaALP1f was not toxic by itself, but it increased mortality caused by Cry1Ac in a susceptible strain and in all five resistant strains. Although synergism of Bt toxins against susceptible insects by toxin-binding fragments of cadherin and aminopeptidase N has been reported previously, the results here provide the first evidence of synergism of a Bt toxin by a toxin-binding fragment of alkaline phosphatase. The results here also provide the first evidence of synergism of a Bt toxin by any toxin-binding peptide against resistant insects.

Refined candidate region specified by haplotype sharing for Escherichia coli F4ab/F4ac susceptibility alleles in pigs

DEFF Research Database (Denmark)

Jacobsen, Mette Juul; Kracht, Steffen Skaarup; Esteso, G.

2009-01-01

Infection of the small intestine by enterotoxigenic Escherichia coli F4ab/ac is a major welfare problem and financial burden for the pig industry. Natural resistance to this infection is inherited as a Mendelian recessive trait, and a polymorphism in the MUC4 gene segregating for susceptibility....../resistance is presently used in a selection programme by the Danish pig breeding industry. To elucidate the genetic background involved in E. coli F4ab/ac susceptibility in pigs, a detailed haplotype map of the porcine candidate region was established. This region covers approximately 3.7 Mb. The material used...... for the study is a three generation family, where the founders are two Wild boars and eight Large White sows. All pigs have been phenotyped for susceptibility to F4ab/ac using an adhesion assay. Their haplotypes are known from segregation analysis using flanking markes. By a targeted approach, the candidate...

Characterization of magnetic core-shell nanoparticles by fluxgate magnetorelaxometry, ac susceptibility, transmission electron microscopy and photon correlation spectroscopy-A comparative study

International Nuclear Information System (INIS)

Ludwig, Frank; Heim, Erik; Schilling, Meinhard

2009-01-01

We have compared the structure parameters of magnetic core-shell nanoparticles determined from fluxgate magnetorelaxometry measurements applying the moment superposition model with the results from other methods. For the characterization of the magnetic cores, the nanoparticles are immobilized by freeze-drying. The core size distribution estimated for superparamagnetic Fe 3 O 4 magnetic nanoparticles (MNPs) with polyacrylic acid shell agrees well with that from transmission electron microscopy measurements. The distribution of hydrodynamic diameters of nanoparticle suspensions estimated from magnetorelaxometry measurements is in good agreement with that obtained from ac susceptibility and photon correlation spectroscopy measurements. Advantages of magnetorelaxometry compared to the other two integral techniques are that it is fast and the signal is less dominated by larger particles.

Magnetic properties of U(Ni1-xCux)2Si2 solid solutions in the vicinity of x = 0.50 studied by neutron diffraction and AC-susceptibility

International Nuclear Information System (INIS)

Kuznietz, M.; Andre, G.; Bouree, F.; Pinto, H.; Ettedgui, H.; Melamud, M.

1993-01-01

The magnetic properties of two U(Ni 1-x Cu x ) 2 Si 2 solid in the vicinity of x = 0.50 (denoted I and II) have been studied by neutron diffraction and ac-susceptibility. Both materials have ThCr 2 Si 2 -type crystallographic structure. AC-susceptibility shows antiferromagnetic transitions at T N 150±5 K in UNiCuSi 2 (I) and 155±5 K in UNiCuSi 2 (II), followed by several transitions with ferrimagnetic (F) character at lower temperatures. Apart from the transitions to AF-I structure at T N =150K and 152K none of the F transitions is observed by neutron diffraction. Short-range magnetic order, involving several consecutive ferromagnetic planes or ferrimagnetic groups of planes in the AF-I phase, detected by ac-susceptibility and not by neutron diffraction in both materials and therefore significant to x ∼ 0.50, is proposed to explain the unusual susceptibility. (Author)

AC power flow importance measures considering multi-element failures

International Nuclear Information System (INIS)

Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

2017-01-01

Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

Effect of Low-Frequency AC Magnetic Susceptibility and Magnetic Properties of CoFeB/MgO/CoFeB Magnetic Tunnel Junctions

Directory of Open Access Journals (Sweden)

Yuan-Tsung Chen

2014-01-01

Full Text Available In this investigation, the low-frequency alternate-current (AC magnetic susceptibility (χac and hysteresis loop of various MgO thickness in CoFeB/MgO/CoFeB magnetic tunneling junction (MTJ determined coercivity (Hc and magnetization (Ms and correlated that with χac maxima. The multilayer films were sputtered onto glass substrates and the thickness of intermediate barrier MgO layer was varied from 6 to 15 Å. An experiment was also performed to examine the variation of the highest χac and maximum phase angle (θmax at the optimal resonance frequency (fres, at which the spin sensitivity is maximal. The results reveal that χac falls as the frequency increases due to the relationship between magnetization and thickness of the barrier layer. The maximum χac is at 10 Hz that is related to the maximal spin sensitivity and that this corresponds to a MgO layer of 11 Å. This result also suggests that the spin sensitivity is related to both highest χac and maximum phase angle. The corresponding maximum of χac is related to high exchange coupling. High coercivity and saturation magnetization contribute to high exchange-coupling χac strength.

Measuring Gravitational Flexion in ACS Clusters

Science.gov (United States)

Goldberg, David

2005-07-01

We propose measurement of the gravitational "Flexion" signal in ACS cluster images. The flexion, or "arciness" of a lensed background galaxy arises from variations in the lensing field. As a result, it is extremely sensitive to small scale perturbations in the field, and thus, to substructure in clusters. Moreover, because flexion represents gravitationally induced asymmetries in the lensed image, it is completely separable from traditional measurements of shear, which focus on the induced ellipticity of the image, and thus, the two signals may be extracted simultaneously. Since typical galaxies are roughly symmetric upon 180 degree rotation, even a small induced flexion can potentially produce a noticeable effect {Goldberg & Bacon, 2005}. We propose the measurement of substructure within approximately 4 clusters with high-quality ACS data, and will further apply a test of a new tomographic technique whereby comparisons of lensed arcs at different redshifts may be used to estimate the background cosmology, and thus place constraints on the equation of state of dark energy.

Ac irreversibility line of bismuth-based high temperature superconductors

International Nuclear Information System (INIS)

Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.

1997-01-01

We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society

AC-Conductivity measurements on γ-aluminium oxynitride

NARCIS (Netherlands)

Willems, H.X.; Hal, van P.F.; Metselaar, R.; With, de G.

1995-01-01

AC-conductivity measurements were performed on aluminium oxynitrides (Alons) because of their interesting defect structure. Although it became apparent that these Alons are not stable in the temperature range used, the electrical properties of the materials could be measured with impedance

Accuracy of magnetic resonance based susceptibility measurements

Science.gov (United States)

Erdevig, Hannah E.; Russek, Stephen E.; Carnicka, Slavka; Stupic, Karl F.; Keenan, Kathryn E.

2017-05-01

Magnetic Resonance Imaging (MRI) is increasingly used to map the magnetic susceptibility of tissue to identify cerebral microbleeds associated with traumatic brain injury and pathological iron deposits associated with neurodegenerative diseases such as Parkinson's and Alzheimer's disease. Accurate measurements of susceptibility are important for determining oxygen and iron content in blood vessels and brain tissue for use in noninvasive clinical diagnosis and treatment assessments. Induced magnetic fields with amplitude on the order of 100 nT, can be detected using MRI phase images. The induced field distributions can then be inverted to obtain quantitative susceptibility maps. The focus of this research was to determine the accuracy of MRI-based susceptibility measurements using simple phantom geometries and to compare the susceptibility measurements with magnetometry measurements where SI-traceable standards are available. The susceptibilities of paramagnetic salt solutions in cylindrical containers were measured as a function of orientation relative to the static MRI field. The observed induced fields as a function of orientation of the cylinder were in good agreement with simple models. The MRI susceptibility measurements were compared with SQUID magnetometry using NIST-traceable standards. MRI can accurately measure relative magnetic susceptibilities while SQUID magnetometry measures absolute magnetic susceptibility. Given the accuracy of moment measurements of tissue mimicking samples, and the need to look at small differences in tissue properties, the use of existing NIST standard reference materials to calibrate MRI reference structures is problematic and better reference materials are required.

Study on AC loss measurements of HTS power cable for standardizing

Science.gov (United States)

Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi

2017-09-01

High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..

Ac irreversibility line of bismuth-based high temperature superconductors

Energy Technology Data Exchange (ETDEWEB)

Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)

1997-09-01

We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}

Calorimetric method of ac loss measurement in a rotating magnetic field

Energy Technology Data Exchange (ETDEWEB)

Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)

2010-07-15

A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

Direct amplitude detuning measurement with ac dipole

Directory of Open Access Journals (Sweden)

S. White

2013-07-01

Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

Measurements of temperature dependence of 'localized susceptibility'

CERN Document Server

Shiozawa, H; Ishii, H; Takayama, Y; Obu, K; Muro, T; Saitoh, Y; Matsuda, T D; Sugawara, H; Sato, H

2003-01-01

The magnetic susceptibility of some rare-earth compounds is estimated by measuring magnetic circular dichroism (MCD) of rare-earth 3d-4f absorption spectra. The temperature dependence of the magnetic susceptibility obtained by the MCD measurement is remarkably different from the bulk susceptibility in most samples, which is attributed to the strong site selectivity of the core MCD measurement.

Electron paramagnetic resonance and AC susceptibility studies of Mn and Gd doped 1:2:3 superconductors

International Nuclear Information System (INIS)

La Robina, M.A.

1997-01-01

For many years superconductivity was considered to be a low temperature phenomenon occurring below ∼ 25K. All this changed in April 1986 when J. G. Bednorz and K. A. Muller showed that the oxide La 2-x Ba x CuO 4 becomes a superconductor at ∼ 30K. Later in December 1986 the oxides La 2-x Sr x CuO 4 and La 2-x Ba x CuO 4 synthesised under high pressure, were shown to superconduct at ∼ 40K and ∼ 50K, respectively. Finally in February 1987, Chu synthesised the classic superconductor YBa 2 Cu 3 O 6.8 , the so-called 1:2:3 material, which has a critical temperature circa 92K. In this thesis, electron paramagnetic resonance (EPR) and susceptibility measurements are reported on various superconductors. In 1987 Bowden et al., showed that pure phase 1:2:3 samples are characterised by an absence of Cu EPR signals. This contrasts sharply with the Green phase material, Y 2 Ba 1 Cu 1 O 5 , which shows a very large EPR signal with a g eff of 2.08. In an attempt to induce EPR signals, Mn doped 1:2:3 samples have been synthesised and characterised with EPR , AC susceptibility, XRD and SEM measurements. It is shown that Mn EPR signals are not evident in the Mn doped samples with a g eff of 2.09. Also, below T c the EPR signals of the lightly doped Mn samples vanish. It is argued that this is due to fluxoids motion within the superconductor, which gives rise to very large non-reproducible signals. It is suggested that the signals originate from Cu, impurity contaminants and multiple phases produced when the 1:2:3 superconductor is doped with Manganese (author)

Aperture measurements with AC dipole

CERN Document Server

Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

2018-01-01

During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

AC loss measurement of superconducting dipole magnets by the calorimetric method

International Nuclear Information System (INIS)

Morita, Y.; Hara, K.; Higashi, N.; Kabe, A.

1996-01-01

AC losses of superconducting dipole magnets were measured by the calorimetric method. The magnets were model dipole magnets designed for the SSC. These were fabricated at KEK with 50-mm aperture and 1.3-m overall length. The magnet was set in a helium cryostat and cooled down to 1.8 K with 130 L of pressurized superfluid helium. Heat dissipated by the magnet during ramp cycles was measured by temperature rise of the superfluid helium. Heat leakage into the helium cryostat was 1.6 W and was subtracted from the measured heat to obtain AC loss of the magnet. An electrical measurement was carried out for calibration. Results of the two methods agreed within the experimental accuracy. The authors present the helium cryostat and measurement system in detail, and discuss the results of AC loss measurement

Absolute method of measuring magnetic susceptibility

Science.gov (United States)

Thorpe, A.; Senftle, F.E.

1959-01-01

An absolute method of standardization and measurement of the magnetic susceptibility of small samples is presented which can be applied to most techniques based on the Faraday method. The fact that the susceptibility is a function of the area under the curve of sample displacement versus distance of the magnet from the sample, offers a simple method of measuring the susceptibility without recourse to a standard sample. Typical results on a few substances are compared with reported values, and an error of less than 2% can be achieved. ?? 1959 The American Institute of Physics.

Effect of dc field on ac-loss peak in a commercial Bi:2223/Ag tape

Science.gov (United States)

Öztürk, Ali; Düzgün, İbrahim; Çelebi, Selahattin

2017-12-01

Measurements of the ac susceptibility in a commercial Bi:2223/Ag tape for some different ac magnetic field amplitudes, Hac, in the presence of bias magnetic field Hdc directed along Hac are reported. It is found that the peak values of the imaginary component of ac susceptibility χ″max versus Hac trace a valley for the orientation where applied field Ha perpendicular to wide face of the tape total. We note that the observation of the valley depends on various parameters such as field dependence parameter n in the critical current density, in the simple power law expression jc = α(T)/Bn, choice of the bias field Hdc together with selected ac field amplitudes Hac, and dimension and geometry of sample studied. Our calculations based on critical state model with jc = α(1 - T/Tcm)p/Bn using the fitting parameters of n = 0.25, p = 2.2, Tcm = 108 K gives quite good results to compare the experimental and calculated curves.

Harmonic and static susceptibilities of YBa2Cu3O7

International Nuclear Information System (INIS)

Ishida, T.; Goldfarb, R.B.; Okayasu, S.; Kazumata, Y.; Franz, J.; Arndt, T.; Schauer, W.

1993-01-01

Intergranular properties of the sintered superconductor YBa 2 Cu 3 O 7 have been studied in terms of complex harmonic magnetic susceptibility χ n χ n ' - iχ n '' (n integer) as well as DC susceptibility χ dc . As functions of temperature T, χ 1 ' and χ 1 '' depend on both the AC magnetic-field amplitude H ac and the magnitude of a superimposed DC field H dc . Only odd-harmonic susceptibilities are observed below the critical temperature, T c , for zero H dc while both odd and even harmonics are observed for nonzero H dc . With T constant, odd-harmonic susceptibilities are even functions of H dc , whereas even-harmonic susceptibilities are odd functions of H dc . Experimental intergranular characteristics of χ n ' and χ n '' are in good agreement with theoretical predictions from a simplified Kim model of magnetization. In contrast, even-harmonic susceptibilities measured for a GdBa 2 Cu 3 O 7 thin film and an YBa 2 Cu 3 O 7 single crystal are not prominent due to missing weak links, whereas odd-harmonic susceptibilities are remarkable. A survey of several models for the harmonic response of superconductors is presented. The DC susceptibility curve for the zero-field-cooled YBa 2 Cu 3 O 7 sample, χ ZFC (T), has a two-step structure arising from intra- and inter-granular components, similar to χ 1 '. DC susceptibility measured upon warming, χ FCW (T), shows a negative peak near T c for the sample cooled rapidly in small DC fields. DC susceptibility measured upon cooling, χ FCC (T), does not show a peak. A negative peak is not seen in measurements on a powdered sample. The negative peak can be explained by intergranular flux depinning upon warming. (orig.)

Mobility of solid vortex matter in 'shaking' ac magnetic fields of variable amplitude

International Nuclear Information System (INIS)

Moreno, A.J.; Valenzuela, S.O.; Pasquini, G.; Bekeris, V.

2004-01-01

The vortex solid in high temperature superconductors exhibits several regimes and dynamical behaviors. A temporarily symmetric magnetic ac field (e.g. sinusoidal, square, triangular) can increase the vortex lattice mobility and a temporarily asymmetric one (e.g. sawtooth) can decrease it. In this work, we study the effect on the mobility of the vortex solid as a function of the amplitude of an ac symmetric 'shaking' field when it is applied to previously prepared high and low mobility configurations. This study was carried out in high quality twinned YBCO single crystals and vortex mobility was studied through ac susceptibility measurements

Measuring ac-loss in high temperature superconducting cable-conductors using four probe methods

DEFF Research Database (Denmark)

Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Olsen, Søren Krüger

1999-01-01

Measuring the ac-loss of superconducting cable conductors have many aspects in common with measuring the ac-loss of single superconducting tapes. In a cable conductor all tapes are connected to each other and to the test circuit through normal metal joints in each end. This makes such measurement...

Development of a nano-tesla magnetic field shielded chamber and highly precise AC-susceptibility measurement coil at μK temperatures

Science.gov (United States)

Kumar, Anil; Prakash, Om; Ramakrishanan, S.

2014-04-01

A special sample measurement chamber has been developed to perform experiments at ultralow temperatures and ultralow magnetic field. A high permeability material known as cryoperm 10 and Pb is used to shield the measurement space consisting of the signal detecting set-up and the sample. The detecting setup consists of a very sensitive susceptibility coil wound on OFHC Cu bobbin.

Thermally-activated vortex dynamics in bismuth calcium strontium copper oxide (Bi2CaSr2Cu2O8+δ) studied by complex susceptibility measurements

NARCIS (Netherlands)

Emmen, J.H.P.M.; Brabers, V.A.M.; Jonge, de W.J.M.

1991-01-01

Complex AC magnetic susceptibility has been measured on Bi2CaSr2Cu2O8+d single crystals with hnc, Hdc|c-axis. It will be shown that field, frequency and temperature dependence of both ¿' and ¿¿ in a constant but sufficiently large DC magnetic field can quantitatively be described by

Experimental infection with Escherichia coli 0149 : F4ac in weaned piglets

DEFF Research Database (Denmark)

Jensen, Gerda M.; Frydendahl, Kai; Svendsen, Ove

2006-01-01

adhesion test made after slaughter of piglets. However, in an experimental infection study with the purpose to obtain diarrhoeic piglets, it would be an advantage to test for susceptibility prior to experimentation. The Mucin 4 gene on porcine chromosome 13 has been proposed as a candidate gene...... for the production of the specific ETEC F4ab/ac receptor, and a DNA marker-based test has been developed to allow genotyping for ETEC F4ab/ac resistance/susceptibility [Jorgensen, C.B., Cirera, S., Archibald, A.L., Anderson, L., Fredholm, M., Edfors-Lilja, I., 2004. Porcine polymorphisms and methods for detecting...... them. International application published under the patent cooperation treaty (PCT). PCT/DK2003/000807 or WO2004/048606-A2]. The aim of this study was to test an experimental model for ETEC O149:F4ac-induced diarrhoea in piglets, selected for susceptibility towards ETEC O149:F4ac adhesion prior...

Measurement of AC losses in superconducting tapes by reproduction of thermometric dynamic response

Energy Technology Data Exchange (ETDEWEB)

Ligneris, Benoit des; Aubin, Marcel; Cave, Julian

2003-04-15

We have developed a dynamic response thermometric method for the measurement of AC losses in high T{sub c} superconductors. This method is based on the comparison of a temperature response caused by a known dissipation in the sample with that produced by the AC losses. By passing a DC current and measuring the DC voltage and corresponding temperature response the sample can be used as its own power dissipation reference. The advantages of this method are the short measurement duration time and the possibility to vary many experimental conditions: for example, AC and DC transport currents and AC, DC and rotating applied magnetic fields. In this article we present the basic method using variable short pulses of constant DC current for calibration and similarly of constant amplitude AC current to create the losses. The losses are obtained by numerical modelling and comparison of the thermometric dynamic response in the two above conditions. Finally, we present some experimental results for a Bi2223 superconducting tape at 50 Hz and 77 K.

Magneto-optical measurements on high-temperature superconductors influenced by AC-fields

International Nuclear Information System (INIS)

Che'Rose, Simon

2007-01-01

In this work magneto-optical measurements on YBa 2 Cu 3 O 7-x and MgB 2 thin films were done. For YBCO the influence of AC-pulses on the flux and current density of a thin film with transport current was investigated. For MgB 2 the influence of AC-fields on the homogenous and dendritic flux penetration was researched. (orig.)

Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven

International Nuclear Information System (INIS)

Smedley, K.

1992-04-01

The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab

Magnetisation and AC susceptibility studies of La1-xSrxFe0.8Cr0.2O3-δ (0.0

International Nuclear Information System (INIS)

Ferreira, L.P.; Cruz, M.M.; Ramos, T.; Sa, M.A.; Carvalho, M.D.; Godinho, M.

2007-01-01

Magnetisation and AC magnetic susceptibility measurements have been performed in the perovskite-type compounds La 1-x Sr x Fe 0.8 Cr 0.2 O 3-δ (x=0.2, 0.4, 0.6 and 0.8). All compounds show an overall antiferromagnetic behaviour mainly attributed to predominant Fe 3+ -O-Fe 3+ interactions. For 0.2 ord . The coexistence of AFM and FM interactions leads to reentrant magnetic behaviour for the x=0.4 compound and to spin-glass like behaviour for x=0.8. Between x=0.6 and 0.8, the similar magnetic moments found in the paramagnetic region indicate that the Fe/Cr valences do not change significantly, pointing towards an increased role for oxygen vacancy formation in the charge compensation mechanism

Magnetic relaxation phenomena in the chiral magnet Fe1 -xCoxSi : An ac susceptibility study

Science.gov (United States)

Bannenberg, L. J.; Lefering, A. J. E.; Kakurai, K.; Onose, Y.; Endoh, Y.; Tokura, Y.; Pappas, C.

2016-10-01

We present a systematic study of the ac susceptibility of the chiral magnet Fe1 -xCoxSi with x =0.30 covering four orders of magnitude in frequencies from 0.1 Hz to 1 kHz, with particular emphasis to the pronounced history dependence. Characteristic relaxation times ranging from a few milliseconds to tens of seconds are observed around the skyrmion lattice A phase, the helical-to-conical transition and in a region above TC. The distribution of relaxation frequencies around the A phase is broad, asymmetric, and originates from multiple coexisting relaxation processes. The pronounced dependence of the magnetic phase diagram on the magnetic history and cooling rates as well as the asymmetric frequency dependence and slow dynamics suggest more complicated physical phenomena in Fe0.7Co0.3Si than in other chiral magnets.

Magnetic susceptibility measurements on Bi - Sn alloys

International Nuclear Information System (INIS)

Mustaffa bin Haji Abdullah

1985-01-01

Magnetic susceptibility measurements on eight samples of tin-rich and three samples of bismuth-rich Bi-Sn alloys were made from 85K to 300K by Faraday's method. The susceptibilities of the eight tin-rich samples are positive and greater than the susceptibility of pure tin. The values are approximately constant at low temperatures but decreasing a little bit with increasing temperature. This result is interpreted as due to the predominant contribution of the Pauli spin paramagnetic susceptibility. A small decrease in susceptibility with temperature is interpreted as due to the effect of the second order term in the expression for spin paramagnetic susceptibility. The fluctuation of the susceptibility for alloys of different composition is interpreted as due to the effect of the density of states at the Fermi levels. The three samples of bismuth-rich alloys show a transition to diamagnetic property, where the diamagnetism is increased with temperature. This result is predominant and due to the diamagnetic contribution from the ions. The increase in susceptibility with temperature is interpreted as due to an increase in the effective radii of the ions due to thermal expansion. (author)

AC susceptibility, XRD and DSC studies of Sm1-xGdxMn2Si2 silicides

International Nuclear Information System (INIS)

Kervan, S.; Kilic, A.; Gencer, A.

2004-01-01

X-ray powder diffraction, AC susceptibility and differential scanning calorimetry (DSC) studies were performed on the polycrystalline Sm 1-x Gd x Mn 2 Si 2 (0≤x≤1) compounds. All compounds investigated crystallize in the body-centered tetragonal ThCr 2 Si 2 -type structure with the space group I4/mmm. Substitution of Gd for Sm leads to a linear decrease of the lattice constants and the unit cell volume. The lattice constants and the unit cell volume obey Vegard's law. At low temperatures, the rare earth sublattice orders and reconfigures the ordering in the Mn sublattice. The samples with x=0.6 and 0.8 exhibit spin reorientation phenomenon. The Neel temperature T N (Mn) determined by DSC technique and the Curie temperature T C (RE) increase linearly with increasing Gd content x. The results are summarized in the x-T magnetic phase diagram

Measurement of AC losses in a racetrack superconducting coil made from YBCO coated conductor

DEFF Research Database (Denmark)

Seiler, Eugen; Abrahamsen, Asger Bech; Kovac, Jan

2012-01-01

to reinforce it. The AC loss is measured versus the transport current Ia with the coil immersed in liquid nitrogen. Measurements at frequencies 21 Hz, 36 Hz and 72 Hz are compared. The AC losses follow I2 a dependence at low current amplitudes and I3 a at high amplitudes. After cutting the inner steel frame...

ac driving amplitude dependent systematic error in scanning Kelvin probe microscope measurements: Detection and correction

International Nuclear Information System (INIS)

Wu Yan; Shannon, Mark A.

2006-01-01

The dependence of the contact potential difference (CPD) reading on the ac driving amplitude in scanning Kelvin probe microscope (SKPM) hinders researchers from quantifying true material properties. We show theoretically and demonstrate experimentally that an ac driving amplitude dependence in the SKPM measurement can come from a systematic error, and it is common for all tip sample systems as long as there is a nonzero tracking error in the feedback control loop of the instrument. We further propose a methodology to detect and to correct the ac driving amplitude dependent systematic error in SKPM measurements. The true contact potential difference can be found by applying a linear regression to the measured CPD versus one over ac driving amplitude data. Two scenarios are studied: (a) when the surface being scanned by SKPM is not semiconducting and there is an ac driving amplitude dependent systematic error; (b) when a semiconductor surface is probed and asymmetric band bending occurs when the systematic error is present. Experiments are conducted using a commercial SKPM and CPD measurement results of two systems: platinum-iridium/gap/gold and platinum-iridium/gap/thermal oxide/silicon are discussed

Ac loss measurement of SSC dipole magnets

International Nuclear Information System (INIS)

Delchamps, S.; Hanft, R.; Jaffery, T.; Kinney, W.; Koska, W.; Lamm, M.J.; Mazur, P.O.; Orris, D.; Ozelis, J.P.; Strait, J.; Wake, M.

1992-09-01

AC losses in full length and 1.5 m model SSC collider dipoles were successfully measured by the direct observation of energy flow into and out of magnets during a ramp cycle. The measurement was performed by using two double-integrating type digital volt meters (DVM's) for current and voltage measurement. Measurements were performed for six is m long ASST magnets and five 1.5 m long model magnets, inducting one 40 mm diameter magnet. There were large variations in the eddy current losses. Since these magnets use conductors with slight deviations in their internal structures and processing of the copper surface depending on the manufacturer, it is likely that there are differences in the contact resistance between strands. Correlation between the ramp rate dependence of the,quench current and the eddy current loss was evident

Inheritance Patterns, Dominance and Cross-Resistance of Cry1Ab- and Cry1Ac-Selected Ostrinia furnacalis (Guenée

Directory of Open Access Journals (Sweden)

Tiantao Zhang

2014-09-01

Full Text Available Two colonies of Asian corn borer, Ostrinia furnacalis (Guenée, artificially selected from a Bt-susceptible colony (ACB-BtS for resistance to Cry1Ab (ACB-AbR and Cry1Ac (ACB-AcR toxins, were used to analyze inheritance patterns of resistance to Cry1 toxins. ACB-AbR and ACB-AcR evolved significant levels of resistance, with resistance ratios (RR of 39-fold and 78.8-fold to Cry1Ab and Cry1Ac, respectively. The susceptibility of ACB-AbR larvae to Cry1Ac and Cry1F toxins, which had not previously been exposed, were significantly reduced, being >113-fold and 48-fold, respectively. Similarly, susceptibility of ACB-AcR larvae to Cry1Ab and Cry1F were also significantly reduced (RR > nine-fold, RR > 18-fold, respectively, indicating cross-resistance among Cry1Ab, Cry1Ac, and Cry1F toxins. However, ACB-AbR and ACB-AcR larvae were equally susceptible to Cry1Ie as were ACB-BtS larvae, indicating no cross-resistance between Cry1Ie and Cry1Ab or Cry1Ac toxins; this may provide considerable benefits in preventing or delaying the evolution of resistance in ACB to Cry1Ab and Cry1Ac toxins. Backcrossing studies indicated that resistance to Cry1Ab toxin was polygenic in ACB-AbR, but monogenic in ACB-AcR, whilst resistance to Cry1Ac toxin was primarily monogenic in both ACB-AbR and ACB-AcR, but polygenic as resistance increased.

Influences of Cry1Ac broccoli on larval survival and oviposition of diamondback moth.

Science.gov (United States)

Yi, Dengxia; Cui, Shusong; Yang, Limei; Fang, Zhiyuan; Liu, Yumei; Zhuang, Mu; Zhang, Yangyong

2015-01-01

Larval survival and oviposition behavior of three genotypes of diamondback moth, Plutella xylostella L. (Lepidoptera: Plutellidae), (homozygous Cry1Ac-susceptibile, Cry1Ac-resistant, and their F1 hybrids), on transgenic Bacillus thuringiensis (Bt) broccoli expressing different levels of Cry1Ac protein were evaluated in laboratory. These Bt broccoli lines were designated as relative low, medium, and high, respectively, according to the Cry1Ac content. Untransformed brocccoli plants were used as control. Larval survival of diamondback moth on non-Bt leaves was not significantly different among the three genotypes. The Cry1Ac-resistant larvae could survive on the low level of Bt broccoli plants, while Cry1Ac-susceptible and F1 larvae could not survive on them. The three genotypes of P. xylostella larvae could not survive on medium and high levels of Bt broccoli. In oviposition choice tests, there was no significant difference in the number of eggs laid by the three P. xylostella genotypes among different Bt broccoli plants. The development of Cry1Ac-susceptible and Cry1Ac-resistant P. xylostella on intact Bt plants was also tested in greenhouse. All susceptible P. xylostella larvae died on all Bt plants, while resistant larvae could survive on broccoli, which expresses low Cry1Ac protein under greenhouse conditions. The results of the greenhouse trials were similar to that of laboratory tests. This study indicated that high dose of Bt toxins in broccoli cultivars or germplasm lines is required for effective resistance management. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

Influence of the interaction between the inter- and intragranular magnetic responses in the analysis of the ac susceptibility of a granular FeSe0.5Te0.5 superconductor

Science.gov (United States)

Mancusi, D.; Polichetti, M.; Cimberle, M. R.; Pace, S.

2015-09-01

The temperature-dependent fundamental ac susceptibility of a granular superconductor in the absence of dc fields has been analyzed by developing a phenomenological model for effective magnetic fields, taking into account the influence of the magnetic interaction between the intergranular and the intragranular magnetizations due to demagnetizing effects. For this purpose a policrystal Fe-based superconductor FeSe0.5Te0.5 sample has been studied. By the frequency dependence of the peaks of the temperature-dependent imaginary part of the fundamental complex susceptibility, the dependence on temperature of the characteristic times both for intergranular and intragranular relaxations of magnetic flux are derived, and the corresponding relaxation processes due to combinations of the flux creep, the flux flow and the thermally activated flux flow regimes are identified on the basis of the effective magnetic fields both at the sample surface and at the grains’ surfaces. Such characteristic times, through the Havriliak-Negami function, determine the temperature and the frequency dependences of the complex susceptibility. The comparison of the numerically obtained curves with the experimental ones confirms the relevance, for identifying the intergranular and intragranular contributions to the ac magnetic response and the corresponding flux dynamical regimes, of the interaction between the intergranular and intragranular magnetizations due to demagnetizing effects.

A wide-frequency range AC magnetometer to measure the specific absorption rate in nanoparticles for magnetic hyperthermia

International Nuclear Information System (INIS)

Garaio, E.; Collantes, J.M.; Garcia, J.A.; Plazaola, F.; Mornet, S.; Couillaud, F.; Sandre, O.

2014-01-01

Measurement of specific absorption rate (SAR) of magnetic nanoparticles is crucial to assert their potential for magnetic hyperthermia. To perform this task, calorimetric methods are widely used. However, those methods are not very accurate and are difficult to standardize. In this paper, we present AC magnetometry results performed with a lab-made magnetometer that is able to obtain dynamic hysteresis-loops in the AC magnetic field frequency range from 50 kHz to 1 MHz and intensities up to 24 kA m −1 . In this work, SAR values of maghemite nanoparticles dispersed in water are measured by AC magnetometry. The so-obtained values are compared with the SAR measured by calorimetric methods. Both measurements, by calorimetry and magnetometry, are in good agreement. Therefore, the presented AC magnetometer is a suitable way to obtain SAR values of magnetic nanoparticles. - Highlights: • We propose AC magnetometry as a method to measure the specific absorption rate (SAR) of magnetic nanoparticles suitable for magnetic hyperthermia therapy. • We have built a lab-made AC magnetometer, which is able to measure magnetic dynamic hysteresis-loops of nanoparticle dispersions. • The device works with AC magnetic field intensities up to 24 kA m −1 in a frequency range from 75 kHz to 1 MHz. • The SAR values of maghemite nanoparticles around 12 nm in magnetic diameter dispersed in water are measured by the lab-made magnetometer and different calorimetric methods. • Although all methods are in good agreement, several factors (probe location, thermal inertia, losses, etc.) make calorimetric method less accurate than AC magnetometry

Materials with low DC magnetic susceptibility for sensitive magnetic measurements

International Nuclear Information System (INIS)

Khatiwada, R; Kendrick, R; Khosravi, M; Peters, M; Smith, E; Snow, W M; Dennis, L

2016-01-01

Materials with very low DC magnetic susceptibility have many scientific applications. To our knowledge however, relatively little research has been conducted with the goal to produce a totally nonmagnetic material. This phrase in our case means after spatially averaging over macroscopic volumes, it possesses an average zero DC magnetic susceptibility. We report measurements of the DC magnetic susceptibility of three different types of nonmagnetic materials at room temperature: (I) solutions of paramagnetic salts and diamagnetic liquids, (II) liquid gallium–indium alloys and (III) pressed powder mixtures of tungsten and bismuth. The lowest measured magnetic susceptibility among these candidate materials is in the order of 10 −9 cgs volume susceptibility units, about two orders of magnitude smaller than distilled water. In all cases, the measured concentration dependence of the magnetic susceptibility is consistent with that expected for the weighted sum of the susceptibilities of the separate components within experimental error. These results verify the well-known Wiedemann additivity law for the magnetic susceptibility of inert mixtures of materials and thereby realize the ability to produce materials with small but tunable magnetic susceptibility. For our particular scientific application, we are also looking for materials with the largest possible number of neutrons and protons per unit volume. The gallium–indium alloys fabricated and measured in this work possess to our knowledge the smallest ratio of volume magnetic susceptibility to nucleon number density per unit volume for a room temperature liquid, and the tungsten-bismuth pressed powder mixtures possess to our knowledge the smallest ratio of volume magnetic susceptibility to nucleon number density per unit volume for a room temperature solid. This ratio is a figure of merit for a certain class of precision experiments that search for possible exotic spin-dependent forces of Nature. (paper)

Modelling and measurement of ac loss in BSCCO/Ag-tape windings

International Nuclear Information System (INIS)

Oomen, M P; Nanke, R; Leghissa, M

2003-01-01

High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications

Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

Energy Technology Data Exchange (ETDEWEB)

Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

2008-07-01

Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

High susceptibility prevalence for F4+ and F18+Escherichia coli in Flemish pigs.

Science.gov (United States)

Nguyen, Ut V; Coddens, Annelies; Melkebeek, Vesna; Devriendt, Bert; Goetstouwers, Tiphanie; Poucke, Mario Van; Peelman, Luc; Cox, Eric

2017-04-01

F4 and/or F18 enterotoxigenic Escherichia coli (F4 + /F18 + ETEC) are responsible for diarrhea while F18 + verotoxigenic E. coli (F18 + VTEC) cause edema disease in pigs. Both infections can result in severe economic losses, which are mainly the result of the medication, growth retardation and mortality. The susceptibility of piglets to these pathogens is determined by the presence of F4 and F18 receptors (F4R and F18R). Understanding the composition of the susceptibility phenotypes of pigs is useful for animal health and breeding management. This study aimed to determine the prevalence of the F4 ETEC susceptibility phenotypes and F18 + E. coli susceptibility among Flemish pig breeds by using the in vitro villous adhesion assay. In this study, seven F4 ETEC susceptibility phenotypes were found, namely A (F4 ab R + , ac R + , ad R + ; 59.16%), B (F4 ab R + , ac R + , ad R - ; 6.28%), C (F4 ab R + , ac R - , ad R + ; 2.62%), D (F4 ab R - , ac R - , ad R + ; 6.28%), E (F4 ab R - , ac R - , ad R - ; 24.08%), F (F4 ab R + , ac R - , ad R - ; 1.05%) and G (F4 ab R - , ac R + , ad R - ; 0.52%). F4ab and F4ac E. coli showed a stronger degree of adhesion to the intestinal villi (53.40% and 52.88% strong adhesion, respectively), compared to F4ad E. coli (43.46% strong adhesion). Furthermore, the correlation between F4ac and F4ab adhesion was higher (r=0.78) than between F4ac and F4ad adhesion (r=0.41) and between F4ab and F4ad adhesion (r=0.57). For F18 + E. coli susceptibility, seven out of 82 pigs were F18R negative (8.54%), but only two of these seven pigs (2.44%) were also negative for F4R. As such, the chance to identify a pig that is positive for a F4 ETEC variant or F18 + E. coli is 97.56%. Therefore, significant economic losses will arise due to F4 + and/or F18 + E. coli infections in the Flemish pig population due to the high susceptibility prevalence. Copyright © 2016 Elsevier B.V. All rights reserved.

A Correction Formula for the ST Segment Measurements for the AC-coupled Electrocardiograms

DEFF Research Database (Denmark)

Schmid, Ramun; Isaksen, Jonas; Leber, Remo

2017-01-01

Goal: The ST segment of an electrocardiogram (ECG) is very important for the correct diagnosis of an acute myocardial infarction. Most clinical ECGs are recorded using an AC-coupled ECG amplifier. It is well known, that first-order high-pass filters used for the AC coupling can affect the ST...... segment of an ECG. This effect is stronger the higher the filter's cut-off frequency is and the larger the QRS integral is. We present a formula that estimates these changes in the ST segment and therefore allows for correcting ST measurements that are based on an AC-coupled ECG. Methods: The presented...

Impedance Localization Measurements using AC Dipoles in the LHC

CERN Document Server

Biancacci, Nicolo; Papotti, Giulia; Persson, Tobias; Salvant, Benoit; Tomás, Rogelio

2016-01-01

The knowledge of the LHC impedance is of primary importance to predict the machine performance and allow for the HL-LHC upgrade. The developed impedance model can be benchmarked with beam measurements in order to assess its validity and limit. This is routinely done, for example, moving the LHC collimator jaws and measuring the induced tune shift. In order to localize possible unknown impedance sources, the variation of phase advance with intensity between beam position monitors can be measured. In this work we will present the impedance localization measurements performed at injection in the LHC using AC dipoles as exciter as well as the underlying theory.

Voltage-probe-position dependence and magnetic-flux contribution to the measured voltage in ac transport measurements: which measuring circuit determines the real losses?

International Nuclear Information System (INIS)

Pe, T.; McDonald, J.; Clem, J.R.

1995-01-01

The voltage V ab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path C s through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path C s and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent ac loss (the time average of the product IV ab ) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) ac loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real ac losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit dimensions. Corresponding calculations also are presented for a sample of elliptical cross section

Magnetic susceptibility measuring probe utilizing a compensation coil

International Nuclear Information System (INIS)

Bonnet, Jean; Fournet, Julien.

1978-01-01

This invention concerns a magnetic susceptibility measuring probe. It is used, inter alia, in logging, to wit continuous logging of the magnetic susceptibility of the ground throughout the length of a bore hole. The purpose of this invention is to increase the sensitivity of this type of probe by creating a side focusing effect . To this end, it provides for the use of a compensation winding, coaxial with the measurement winding and arranged symmetrically to the latter with respect to the centre of the induction windings [fr

Synthesis, characterization and a.c. magnetic analysis of magnetite nanoparticles

International Nuclear Information System (INIS)

Riani, P.; Napoletano, M.; Canepa, F.

2011-01-01

In the last years, the study of Fe-based magnetic nanoparticles (MNP) has attracted increasing interest either for the physical properties shown by nanosized materials (electric and magnetic properties are strongly affected by dimension and surface effects) either for the different technological applications of these materials (catalysis, drug delivery, magnetic resonance imaging, contaminants removal from groundwater, new exchange coupled magnets, soft nanomagnets for high frequency applications, etc.). In this article, the results obtained in the synthesis and characterization of the Fe 3 O 4 MNP is reported. The magnetite nanoparticles were synthesized by a modified Massart method. Structural characterization was performed using X-ray diffraction analysis and a complete morphological and dimensional study was carried out by means of Transmission Electron Microscopy, and a.c. magnetic susceptibility measured as a function of the frequency of the applied magnetic field. Diameters of the superparamagnetic Fe 3 O 4 nanoparticles are ranging from 2 to 10 nm, as evidenced by all the techniques employed. The size distribution of the hydrated aggregates in solution has been obtained by quantitative analysis of the frequency dependence of the a.c. susceptibility. The mathematical approach adopted will be described and all the obtained results will be compared and discussed.

Peltier ac calorimeter

OpenAIRE

Jung, D. H.; Moon, I. K.; Jeong, Y. H.

2001-01-01

A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

Ten Minutes of α-tACS and Ambient Illumination Independently Modulate EEG α-Power

Directory of Open Access Journals (Sweden)

Heiko I. Stecher

2017-05-01

Full Text Available Transcranial alternating current stimulation (tACS sees increased use in neurosciences as a tool for the exploration of brain oscillations. It has been shown that tACS stimulation in specific frequency bands can result in aftereffects of modulated oscillatory brain activity that persist after the stimulation has ended. The general relationship between persistency of the effect and duration of stimulation is sparsely investigated but previous research has shown that the occurrence of tACS aftereffects depends on the brain state before and during stimulation. Early alpha neurofeedback research suggests that particularly in the alpha band the responsiveness to a manipulation depends on the ambient illumination during measurement. Therefore, in the present study we assessed the brain’s susceptibility to tACS at the individual alpha frequency during darkness compared to ambient illumination. We measured alpha power after 10 min of stimulation in 30 participants while they continuously performed a visual vigilance task. Our results show that immediately after stimulation, the alpha power in the illumination condition for both the stimulated and sham group has increased by only about 7%, compared to about 20% in both groups in the ‘dark’ condition. For the group that did not receive stimulation, the power in darkness remained stable after stimulation, whereas the power in light increased by an additional 10% during the next 30 min. For the group that did receive stimulation, alpha power during these 30 min increased by another 11% in light and 22% in darkness. Since alpha power already increased by about 10% without stimulation, the effect of illumination does not seem to have interacted with the effect of stimulation. Instead, both effects seem to have added up linearly. Although our findings do not show that illumination-induced differences in oscillatory activity influence the susceptibility toward tACS, they stress the importance of

A new method for measuring the wall charge waveforms of AC PDP

International Nuclear Information System (INIS)

Liang Zhihu; Liu Zujun; Liu Chunliang

2004-01-01

A new method is developed to measure the wall charge waveforms in coplanar alternating current plasma display panel (AC PDP). In the method, two groups of display electrodes are selected from a coplanar AC PDP and two capacitors are respectively connected with these two groups of display electrodes in series, and a measuring circuit and a reference circuit are thus constructed. With the help of special processing, discharge takes place in the cells included in the measuring circuit under a normal drive voltage but no discharge takes place in the cells included in the reference circuit under a normal drive voltage. The wall charge waveforms are obtained from the voltage difference between the two capacitors. Using the method, the wall charge waveforms are measured during resetting period, addressing period and sustaining period for the 304.8 mm (12-inch) test PDP panel. The result shows that the wall voltage is about 96 V during the sustaining period. (authors)

Induced AC voltages on pipelines may present a serious hazard

International Nuclear Information System (INIS)

Kirkpatrick, E.L.

1997-01-01

The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP

Low-field susceptibilities of rare-earth spin glass alloys

International Nuclear Information System (INIS)

Sarkissian, B.V.B.

1978-01-01

The low-field AC susceptibilities of the dilute rare-earth spin glass alloys Sc-Gd, Sc-Tb, Pr-Tb and Pr-Gd are reported and compared with low-field DC susceptibilities of the same samples. The similarities between their behaviour and that of Au-Fe spin glass alloys is also considered. When single-ion anisotropy is important, this can cause a dramatic broadening of the sharp peak. Broadening in the AC peak has also observed as the frequency of the deriving field is increased. These data can be qualitatively discussed in terms of a recent magnetic-cluster model for spin glasses. (author)

AC measurements on uranium doped high temperature superconductors

International Nuclear Information System (INIS)

Eisterer, M.

1999-11-01

The subject of this thesis is the influence of fission tracks on the superconducting properties of melt textured Y-123. The critical current densities, the irreversibility lines and the transition temperature were determined by means of ac measurements. The corresponding ac techniques are explored in detail. Deviations of the ac signal from the expectations according to the Bean model were explained by the dependence of the shielding currents on the electric field. This explanation is supported by the influence of the ac amplitude and frequency on the critical current density but also by a comparison of the obtained data with other experimental techniques. Y-123 has to be doped with uranium in order to induce fission tracks. Uranium forms normal conducting clusters, which are nearly spherical, with a diameter of about 300 nm. Fission of uranium-235 by thermal neutrons creates two high energy ions with a total energy of about 160 MeV. Each of these fission products induces a linear defect with a diameter of about 10 nm. The length of one fission track is 2-4 μm. At 77 K the critical current density is enhanced by the pinning action of the uranium clusters, compared to undoped samples. With decreasing temperature this influence becomes negligible. The critical current densities are strongly enhanced due to the irradiation. At low magnetic fields we find extremely high values for melt textured materials, e.g. 2.5x10 9 Am -2 at 77 K and 0.25 T or 6x10 10 Am -2 at 5 K. Since the critical current was found to be inverse proportional to the square root of the applied magnetic field it decreases rapidly as the field increases. This behavior is predicted by simple theoretical considerations, but is only valid at low temperatures as well as in low magnetic fields at high temperatures. At high fields the critical current drops more rapidly. The irreversibility lines are only slightly changed by this irradiation technique. Only a small shift to higher fields and temperatures

Aging, Counterfeiting Configuration Control (AC3)

Science.gov (United States)

2010-01-31

Systems Intergrated Into AC3 CABS - Common As-Built System PRISM - Process Re-inventing Integration Systems for Manufacturing PDM - Product Data...looks forward to deploying the completed tool at Raytheon in a true production environment, for as much as we like the challenge associated with...performance of DoD systems. DoD systems are particularly susceptible to intrusion of counterfeit parts, especially during surge and extended production

Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)

International Nuclear Information System (INIS)

Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.

2007-01-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured

Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)

Science.gov (United States)

Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.

2007-10-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured.

Design and implementation of VUV-CD and LD measurements using an ac modulated polarizing undulator

International Nuclear Information System (INIS)

Yagi-Watanabe, K.; Yamada, T.; Tanaka, M.; Kaneko, F.; Kitada, T.; Ohta, Y.; Nakagawa, K.

2005-01-01

VUV circular dichroism (CD) and linear dichroism (LD) have been successfully measured at wavelengths beyond the conventional limit by using an ac modulated polarizing undulator. We have developed CD and LD measuring technique by polarization modulation at the source, without using transmission type polarizing modulator, to extend to the coverage to wavelengths shorter than 140-bar nm. AIST developed in 1986 ac polarizing undulator by using a electron storage ring 'TERAS' based on an original concept. The undulator which can produce any desired polarization of vertical- and horizontal-linear polarization (VLP and HLP) and right- and left-handed circular polarization (RCP and LCP) is specially well suited to both measurements of CD and LD. With this undulator, the polarization alternate in the order of VLP-RCP-HLP-RCP-VLP-LCP-HLP-LCP-VLP-, i.e. when circular polarization is modulated in f Hz, linear polarization alters in 2f Hz. This allows us simultaneous measurements of CD and LD. Since the TERAS can produce ac-modulated polarized radiation of wavelength as short as 40-bar nm, it is expected to have CD and LD measurement extended to 40-bar nm

AC magnetic measurements of the ALS Booster Synchrotron Dipole Magnet engineering model

International Nuclear Information System (INIS)

Green, M.I.; Hoyer, E.; Keller, R.; Nelson, D.H.

1988-09-01

We made a minimal set of AC magnetic measurements of the engineering model of the ALS Booster Dipole Magnet as part of the process of qualifying its design for production. Magnetic induction integrals over paths approximating electron-beam trajectories were measured with long curved coils connected to an electronic integrator. Magnetic induction was measured with point coils and an integrator and independently with a Hall-effect Gaussmeter. These quantities, and magnet current, were displayed on a commercial digital storage oscilloscope as parametric functions of time. The displayed waveforms were stored, processed and redisplayed as representations of selected magnet parameters. A waveform representing the magnet's effective-length was created by dividing the integral waveform by the magnetic induction waveform. Waveforms of the transfer functions were produced by dividing both the integral waveform and the magnetic induction waveform by the current waveform. Pairs of matched coils, connected in series opposition, provided differential measurements of field uniformity. Quadrupole and sextupole coefficients were derived from the uniformity data. These magnet parameters were measured at 2 and 10 Hz frequencies. Together with measurements of the magnetic field at selected dc levels, the ac measurements demonstrated that the magnet design met specifications and qualified it for production. 7 refs., 7 figs., 3 tabs

Hidden transition in multiferroic and magnetodielectric CuCrO2 evidenced by ac-susceptibility

Science.gov (United States)

Shukla, Kaushak K.; Pal, Arkadeb; Singh, Abhishek; Singh, Rahul; Saha, J.; Sinha, A. K.; Ghosh, A. K.; Patnaik, S.; Awasthi, A. M.; Chatterjee, Sandip

2017-04-01

Ferroelectric polarization, magnetic-field dependence of the dielectric constant and ac and dc magnetizations of frustrated CuCrO2 have been measured. A new spin freezing transition below 32 K is observed which is thermally driven. The nature of the spin freezing is to be a single-ion process. Dilution by the replacements of Cr ions by magnetic Mn ions showed suppression of the spin freezing transition suggesting it to be fundamentally a single-ion freezing process. The observed freezing, which is seemingly associated to geometrical spin frustration, represents a novel form of magnetic glassy behavior.

Ac-loss measurement of coated conductors: The influence of the pick-up coil position

International Nuclear Information System (INIS)

Schmidt, Curt

2008-01-01

The ac-loss measurement by the magnetization method requires calibration for obtaining absolute values. A convenient way of calibration is the calorimetric measurement which yields, within the measuring accuracy, absolute loss values. In the magnetization measurement the hysteresis loop of sample magnetization which determines the losses is measured via the integration of magnetic flux penetrating a pick-up coil. The ratio of flux integral to magnetization integral and hence the calibration factor is however, for a given pick-up coil geometry, not exactly a constant, but depends on the magnetization current pattern within the sample. Especially for thin tapes in perpendicular external field this effect has to be taken into consideration in order to avoid miss measurements. The relation between measured flux and sample magnetization was calculated for special cases of magnetization current distribution in the sample as a function of the pick-up coil position. Furthermore calibration factors were measured as a function of the ac-field amplitude and the result compared with available theoretical models. A good agreement was found between experiment and theory

A low-noise ac-bridge amplifier for ballistocardiogram measurement on an electronic weighing scale

International Nuclear Information System (INIS)

Inan, O T; Kovacs, G T A

2010-01-01

Ballistocardiography is a non-invasive technique for evaluating cardiovascular health. This note presents an ac-bridge amplifier for low-noise ballistocardiogram (BCG) recording from a modified weighing scale. The strain gauges in a commercial scale were excited by an ac source—square or sine wave—and the differential output voltage resulting from the BCG was amplified and demodulated synchronously with the excitation waveform. A standard BCG amplifier, with a simple dc-bridge excitation, was also built and the performance was compared to both the square- and sine-wave excited ac-bridge amplifiers. The total input-referred voltage noise (rms) integrated over the relevant BCG bandwidth of 0.3–10 Hz was found to be 30 nV (square wave source) or 25 nV (sine-wave source) for the ac-bridge amplifier and 52 nV for the standard amplifier: an improvement of 4.8 dB or 6 dB, respectively. These correspond to input-referred force noise (rms) values of 5 mN, 4 mN and 8.3 mN. The improvement in SNR was also observed in recorded waveforms from a seated subject whose BCG signal was measured with both dc- and ac-bridge circuits. (note)

Translation balance for measuring magnetic susceptibilities at high or low temperatures (1962)

International Nuclear Information System (INIS)

Blaise, A.; Peuch, M.A.

1962-01-01

A translation balance is described for the measurement of the magnetic susceptibilities of liquids or solids in the temperature range from 1.7 to 1400 deg. K. Measurements are made within a magnetic field adjustable from 3400 to 16000 oersteds, in any desired atmosphere. Susceptibilities between 10 -8 and 10 -4 u.e.m. C.G.S., can be measured. (authors) [fr

Marker-assisted selection on E. coli F4ab/ac resistance and the effect on neonatal survival in piglets

DEFF Research Database (Denmark)

Jørgensen, Claus Bøttcher; Anderson, Susan I.; Cirera, Susanna

Enterotoxigenic Escherichia coli (ETEC) that express the F4ab or F4ac fimbriae (formerly known as K88ab/ac) are major causes of diarrhea and death in neonatal and young pigs. A locus controlling susceptibility towards ETEC F4ab/ac has previously been mapped to pig chromosome 13q41. A number...

AC loss in YBCO coated conductors at high dB/dt measured using a spinning magnet calorimeter (stator testbed environment)

Science.gov (United States)

Murphy, J. P.; Gheorghiu, N. N.; Bullard, T.; Haugan, T.; Sumption, M. D.; Majoros, M.; Collings, E. W.

2017-09-01

A new facility for the measurement of AC loss in superconductors at high dB/dt has been developed. The test device has a spinning rotor consisting of permanent magnets arranged in a Halbach array; the sample, positioned outside of this, is exposed to a time varying AC field with a peak radial field of 0.566 T. At a rotor speed of 3600 RPM the frequency of the AC field is 240 Hz, the radial dB/dt is 543 T/s and the tangential dB/dt is 249 T/s. Loss is measured using nitrogen boiloff from a double wall calorimeter feeding a gas flow meter. The system is calibrated using power from a known resistor. YBCO tape losses were measured in the new device and compared to the results from a solenoidal magnet AC loss system measurement of the same samples (in this latter case measurements were limited to a field of amplitude 0.1 T and a dB/dt of 100 T/s). Solenoidal magnet system AC loss measurements taken on a YBCO sample agreed with the Brandt loss expression associated with a 0-0.1 T Ic of 128 A. Subsequently, losses for two more YBCO tapes nominally identical to the first were individually measured in this spinning magnet calorimeter (SMC) machine with a Bmax of 0.566 T and dB/dt of up to 272 T/s. The losses, compared to a simplified version of the Brandt expression, were consistent with the average Ic expected for the tape in the 0-0.5 T range at 77 K. The eddy current contribution was consistent with a 77 K residual resistance ratio, RR, of 4.0. The SMC results for these samples agreed to within 5%. Good agreement was also obtained between the results of the SMC AC loss measurement and the solenoidal magnet AC loss measurement on the same samples.

Ac loss measurements on a superconducting transformer for a 25 kA superconducting rectifier

NARCIS (Netherlands)

ten Kate, Herman H.J.; Mulders, J.M.; de Reuver, J.L.; van de Klundert, L.J.M.

1984-01-01

Ac loss measurements have been performed on a superconducting transformer. The transformer is a part of a 25 kA thermally switched superconducting rectifier operating at a frequency of 0.1 Hz. The loss measurements have been automatized by means of a microcomputer sampling four relevant signals and

ACS Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2005-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

Dual role of an ac driving force and the underlying two distinct order–disorder transitions in the vortex phase diagram of Ca3Ir4Sn13

International Nuclear Information System (INIS)

Kumar, Santosh; Singh, Ravi P.; Thamizhavel, A.; Tomy, C.V.; Grover, A.K.

2014-01-01

Highlights: • This work pertains to new findings related to a broad SMP anomaly. • Broad SMP prima facie encompasses two phase transformations in vortex matter. • We demarcated two phase boundaries pertaining to order–disorder transitions which have quasi first-order nature. - Abstract: We present distinct demarcation of the Bragg glass (BG) to multi-domain vortex glass (VG) transition line and the eventual amorphization of the VG phase in a weakly pinned single crystal of the superconducting compound Ca 3 Ir 4 Sn 13 on the basis of comprehension of the different yields about the second magnetization peak (SMP) anomaly in the dc magnetization and the corresponding anomalous feature in the ac susceptibility measurements. The shaking by a small ac magnetic field, inevitably present in the ac susceptibility measurements, is seen to result in contrasting responses in two different portions of the field-temperature (H, T) phase space of the multi-domain VG. In one of the portions, embracing the BG to VG transition across the onset of the SMP anomaly, the ac drive is surprisingly seen to assist the transformation of the well ordered BG phase to a lesser ordered VG phase. The BG phase exists as a superheated state over a small portion of the VG space and this attests to the first order nature of the BG to VG transition

AC loss time constant measurements on Nb3Al and NbTi multifilamentary superconductors

International Nuclear Information System (INIS)

Painter, T.A.

1988-03-01

The AC loss time constant is a previously univestigated property of Nb 3 Al, a superconductor which, with recent technological developments, shows some advantages over the more commonly used superconductors, NbTi and Nb 3 Sn. Four Nb 3 Al samples with varying twist pitches and one NbTi sample are inductively measured for their AC loss time constants. The measured time constants are compared to the theoretical time constant limits imposed by the limits of the transverse resistivity found by Carr [5] and to the theoretical time constants found using the Bean Model as well as to each other. The measured time constants of the Nb 3 Al samples fall approximately halfway between the theoretical time constant limits, and the measured time constants of the NbTi sample is close to the theoretical lower time constant limit. The Bean Model adequately accounts for the variance of the permeability of the Nb 3 Al superconductor in a background magnetic field. Finally, the measured time constant values of the Nb 3 Al samples vary approximately according to the square of their twist pitch. (author)

Measurement of AC electrical characteristics of SSC superconducting dipole magnets

International Nuclear Information System (INIS)

Smedley, K.M.; Shafer, R.E.

1992-01-01

Experiments were conducted to measure the AC electrical characteristics of SSC superconducting dipole magnets over the frequency range of 0.1 Hz to 10 kHz. A magnet equivalent circuit representing the magnet DC inductance, eddy current losses, coil-to-ground and turn-to-turn capacitance, was synthesized from the experimental data. This magnet equivalent circuit can be used to predict the current ripple distribution along the superconducting magnet string and can provide dynamic information for the design of the collider current regulation loop

Low-field susceptibilities of rare earth spin glass alloys

International Nuclear Information System (INIS)

Sarkissian, B.V.B.

1977-01-01

Static susceptibility in various applied fields and AC susceptibility data on Sc 13% Gd and Sc 4.5% Tb spin glass alloys are reported. The data show that the sharp peak at the freezing temperature, Tsub(g), normally observed in the low-field susceptibility of spin glasses containing 3d magnetic impurities is observed here in the case of Gd, which is an S state solute, but not for Tb. On the contrary, for the Sc-Tb alloy a rather rounded maximum is observed which becomes slightly sharper with increasing applied magnetic fields. (author)

The midgut cadherin-like gene is not associated with resistance to Bacillus thuringiensis toxin Cry1Ac in Plutella xylostella (L.).

Science.gov (United States)

Guo, Zhaojiang; Kang, Shi; Zhu, Xun; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Zhang, Youjun

2015-03-01

The Gram-positive bacterium Bacillus thuringiensis (Bt) produces Cry toxins that have been used to control important agricultural pests. Evolution of resistance in target pests threatens the effectiveness of these toxins when used either in sprayed biopesticides or in Bt transgenic crops. Although alterations of the midgut cadherin-like receptor can lead to Bt Cry toxin resistance in many insects, whether the cadherin gene is involved in Cry1Ac resistance of Plutella xylostella (L.) remains unclear. Here, we present experimental evidence that resistance to Cry1Ac or Bt var. kurstaki (Btk) in P. xylostella is not due to alterations of the cadherin gene. The bona fide P. xylostella cadherin cDNA sequence was cloned and analyzed, and comparisons of the cadherin cDNA sequence among susceptible and resistant P. xylostella strains confirmed that Cry1Ac resistance was independent of mutations in this gene. In addition, real-time quantitative PCR (qPCR) indicated that cadherin transcript levels did not significantly differ among susceptible and resistant P. xylostella strains. RNA interference (RNAi)-mediated suppression of cadherin gene expression did not affect larval susceptibility to Cry1Ac toxin. Furthermore, genetic linkage assays using four cadherin gDNA allelic biomarkers confirmed that the cadherin gene is not linked to resistance against Cry1Ac in P. xylostella. Taken together, our findings demonstrate that Cry1Ac resistance of P. xylostella is independent of the cadherin gene. Copyright © 2015 Elsevier Inc. All rights reserved.

Assessment of the E-Selectin rs5361 (561A>C Polymorphism and Soluble Protein Concentration in Acute Coronary Syndrome: Association with Circulating Levels

Directory of Open Access Journals (Sweden)

Elena Sandoval-Pinto

2014-01-01

Full Text Available Introduction. The acute coronary syndrome (ACS is a complex disease where genetic and environmental factors are involved. E-selectin gene is a candidate for ACS progression due to its contribution in the inflammatory process and endothelial function. The rs5361 (561A>C polymorphism in the E-selectin gene has been linked to changes in gene expression, affinity for its receptor, and plasmatic levels; therefore it is associated with an increased risk of cardiovascular disease. The aim of this study was to determine the association of the rs5361 polymorphism with ACS and to measure serum levels of soluble E-selectin (sE-selectin. Materials and Methods. 283 ACS patients and 205 healthy subjects (HS from Western Mexico were included. The polymerase chain reaction-restriction fragment length polymorphism was used to determine the rs5361 polymorphism. The sE-selectin levels were measured by enzyme-linked immunosorbent assay. Results. Neither genotype nor allele frequencies of the rs5361 polymorphism showed statistical differences between groups. The sE-selectin levels were significantly higher in ACS patients compared to HS (54.58 versus 40.41 ng/ml, P=0.02. The C allele had no effect on sE-selectin levels. Conclusions. The rs5361 E-selectin gene polymorphism is not a susceptibility marker for ACS in Western Mexico population. However, sE-selectin may be a biological marker of ACS.

Lack of fitness costs and inheritance of resistance to Bacillus thuringiensis Cry1Ac toxin in a near-isogenic strain of Plutella xylostella (Lepidoptera: Plutellidae).

Science.gov (United States)

Zhu, Xun; Yang, Yanjv; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Guo, Zhaojiang; Kang, Shi; Xia, Jixing; Zhang, Youjun

2016-02-01

Resistance to Bacillus thuringiensis (Bt) formulations in insects may be associated with fitness costs. A lack of costs enables resistance alleles to persist, which may contribute to the rapid development and spread of resistance in populations. To assess the fitness costs associated with Bt Cry1Ac resistance in Plutella xylostella, life tables were constructed for a near-isogenic resistant strain (NIL-R) and a susceptible strain in this study. No fitness costs associated with Cry1Ac resistance in NIL-R were detected, based on the duration of egg and larval stages, the survival of eggs and larvae, adult longevity, fecundity, net reproductive rate, gross reproduction rate, finite rate of increase and mean generation time. Based on log dose-probit lines, resistance in NIL-R is incompletely recessive and results from a single, autosomal, recessive locus; the degree of dominance was estimated to be -0.74 and -0.71 for F1 (resistant ♀ × susceptible ♂) and F1 ' (susceptible ♀ × resistant ♂) progeny respectively. Assessment of near-isogenic Cry1Ac-resistant and Cry1Ac-susceptible strains of P. xylostella indicated that resistance is not accompanied with fitness costs, and that resistance is incompletely recessive. These findings should be useful in managing the development of Bt Cry1Ac resistance. © 2015 Society of Chemical Industry.

Characterisation of five candidate genes within the ETEC F4ab/ac candidate region in pigs

DEFF Research Database (Denmark)

Jacobsen, Mette Juul; Cirera Salicio, Susanna; Joller, David

2011-01-01

by haplotype sharing to a 2.5 Mb region on pig chromosome 13, a region containing 18 annotated genes. FINDINGS: The coding regions of five candidate genes for susceptibility to ETEC F4ab/ac infection (TFRC, ACK1, MUC20, MUC4 and KIAA0226), all located in the 2.5 Mb region, were investigated for the presence...... polymorphism in exon 22 of KIAA0226. Transcriptional profiles of the five genes were investigated in a porcine tissue panel including various intestinal tissues. All five genes were expressed in intestinal tissues at different levels but none of the genes were found differentially expressed between ETEC F4ab/ac...... of the amino acids composition. However, we cannot exclude that the five tested genes are bona fide candidate genes for susceptibility to ETEC F4ab/ac infection since the identified polymorphism might affect the translational apparatus, alternative splice forms may exist and post translational mechanisms might...

Magnetic susceptibility measurements of boring cores obtained from regional hydrological study project

International Nuclear Information System (INIS)

Hasegawa, Ken

2010-02-01

We measured the magnetic susceptibility of boring cores obtained from the Regional Hydrological Study Project to interpret the aeromagnetic survey data which was carried out in Tono area with about 40km square surrounding Tono Geoscience Center. The result of measurements indicates that the magnetic susceptibility of the Toki Granite is not distributed uniformly and the maximum value becomes two orders in magnitude larger than its minimum value. (author)

Quantitative measurements of brain iron deposition in cirrhotic patients using susceptibility mapping.

Science.gov (United States)

Xia, Shuang; Zheng, Gang; Shen, Wen; Liu, Saifeng; Zhang, Long Jiang; Haacke, E Mark; Lu, Guang Ming

2015-03-01

Susceptibility-weighted imaging (SWI) has been used to detect micro-bleeds and iron deposits in the brain. However, no reports have been published on the application of SWI in studying iron changes in the brain of cirrhotic patients. To compare the susceptibility of different brain structures in cirrhotic patients with that in healthy controls and to evaluate susceptibility as a potential biomarker and correlate the measured susceptibility and cadaveric brain iron concentration for a variety of brain structures. Forty-three cirrhotic patients (27 men, 16 women; mean age, 50 ± 9 years) and 34 age- and sex-matched healthy controls (22 men, 12 women; mean age, 47 ± 7 years) were included in this retrospective study. Susceptibility was measured in the frontal white matter, basal ganglia, midbrain, and dentate nucleus and compared with results gathered from two postmortem brain studies. Correlation between susceptibility and clinical biomarkers and neuropsychiatric tests scores was calculated. In cirrhotic patients, the susceptibility of left frontal white matter, bilateral caudate head, and right substantia nigra was higher than that in healthy controls (P brain study (r = 0.835, P = 0.01) in eight deep grey matter structures and another in five brain structures (r = 0.900, P = 0.03). The susceptibility of right caudate head (r = 0.402) and left caudate head (r = 0.408) correlated with neuropsychological test scores (both P brain regions appears to reflect neurocognitive changes. © The Foundation Acta Radiologica 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

Dual role of an ac driving force and the underlying two distinct order–disorder transitions in the vortex phase diagram of Ca{sub 3}Ir{sub 4}Sn{sub 13}

Energy Technology Data Exchange (ETDEWEB)

Kumar, Santosh, E-mail: santoshkumar@phy.iitb.ac.in [Department of Physics, Indian Institute of Technology Bombay, Mumbai 400076 (India); Singh, Ravi P.; Thamizhavel, A. [Department of Condensed Matter Physics and Materials Science, Tata Institute of Fundamental Research, Mumbai 400005 (India); Tomy, C.V., E-mail: tomy@phy.iitb.ac.in [Department of Physics, Indian Institute of Technology Bombay, Mumbai 400076 (India); Grover, A.K. [Department of Condensed Matter Physics and Materials Science, Tata Institute of Fundamental Research, Mumbai 400005 (India); Department of Physics, Panjab University, Chandigarh 160014 (India)

2014-11-15

Highlights: • This work pertains to new findings related to a broad SMP anomaly. • Broad SMP prima facie encompasses two phase transformations in vortex matter. • We demarcated two phase boundaries pertaining to order–disorder transitions which have quasi first-order nature. - Abstract: We present distinct demarcation of the Bragg glass (BG) to multi-domain vortex glass (VG) transition line and the eventual amorphization of the VG phase in a weakly pinned single crystal of the superconducting compound Ca{sub 3}Ir{sub 4}Sn{sub 13} on the basis of comprehension of the different yields about the second magnetization peak (SMP) anomaly in the dc magnetization and the corresponding anomalous feature in the ac susceptibility measurements. The shaking by a small ac magnetic field, inevitably present in the ac susceptibility measurements, is seen to result in contrasting responses in two different portions of the field-temperature (H, T) phase space of the multi-domain VG. In one of the portions, embracing the BG to VG transition across the onset of the SMP anomaly, the ac drive is surprisingly seen to assist the transformation of the well ordered BG phase to a lesser ordered VG phase. The BG phase exists as a superheated state over a small portion of the VG space and this attests to the first order nature of the BG to VG transition.

Magnetic susceptibility of Inconel alloys 718, 625, and 600 at cryogenic temperatures

Science.gov (United States)

Goldberg, Ira B.; Mitchell, Michael R.; Murphy, Allan R.; Goldfarb, Ronald B.; Loughran, Robert J.

1990-01-01

After a hydrogen fuel bleed valve problem on the Discovery Space Shuttle was traced to the strong magnetization of Inconel 718 in the armature of the linear variable differential transformer near liquid hydrogen temperatures, the ac magnetic susceptibility of three samples of Inconel 718 of slightly different compositions, one sample of Inconel 625, and on sample of Inconel 600 were measured as a function of temperature. Inconel 718 alloys are found to exhibit a spin glass state below 16 K. Inconel 600 exhibits three different magnetic phases, the lowest-temperature state (below 6 K) being somewhat similar to that of Inconel 718. The magnetic states of the Inconel alloys and their magnetic susceptibilities appear to be strongly dependent on the exact composition of the alloy.

The use of magnetic susceptibility measurements to determine ...

African Journals Online (AJOL)

This research work presents a study on the application of magnetic susceptibility measurements and geochemical analysis for mapping or assessing heavy metal pollution in the agricultural soil in road proximity. The research work was also done to check any runoff of heavy metals pollution to the Owabi dam which serves ...

Capacitance measurements and AC conductivity of Nickel Phthalocyanine films

International Nuclear Information System (INIS)

Darwish, S.

2005-01-01

A C dark Current measurements of nickel phthalocyanine thin films using ohmic gold electrodes are investigated in the frequency range 30-10 Hz and within the temperature range 295-385 K. The A C conductivity as D Ac is found to vary as within the index s < 1, indicating a dominant hopping process at low temperatures. From the temperature dependence of A C conductivity, free carrier conduction with mean activation energy of 0.31 eV is observed at higher temperatures. Capacitance and loss tangent are found to be decreased with increasing frequency and increase with increasing temperature. Such characteristics are found to be in good qualitative agreement with existing equivalent circuit model assuming ohmic contacts

Time-differential observation of alpha -particle perturbed angular distribution; g-factor measurements for /sup 217/Ac/sup gs/ and /sup 217/Ac/sup m/

CERN Document Server

Maier, K H; Grawe, H; Kluge, H

1981-01-01

The g-factor measurements of the ground state and an isomeric level in /sup 217/Ac using the DPAD method with alpha -decay are described. The results of gamma -ray g-factor measurements for the isomer and a tentative decay scheme produced by alpha - gamma and gamma - gamma coincidence experiments are also presented. An analysis of the alpha - particle angular distributions suggests that nuclear deformation affects the observed anisotropy. (13 refs).

Thermally Assisted Macroscopic Quantum Resonance on a Single-Crystal of Mn12-ac

Science.gov (United States)

Lionti, F.; Thomas, L.; Ballou, R.; Wernsdorfer, W.; Barbara, B.; Sulpice, A.; Sessoli, R.; Gatteschi, D.

1997-03-01

Magnetization measurements have been performed on a single mono-crystal of the molecule Mn12-acetate (L. Thomas, F. Lionti, R. Ballou, R. Sessoli, D. Gatteschi and B. Barbara, Nature, 383, 145 (1996).). Steps were observed in the hysteresis loop for values of the applied field at which level crossings of the collective spin states of each manganese clusters take place. The influence of quartic terms is taken into account. At these fields, the magnetization relaxes at short time scales, being otherwise essentially blocked. This novel behavior is interpreted in terms of resonant quantum tunneling of the magnetization from thermally activated energy levels. Hysteresis loop measurements performed for different field orientations and ac-susceptibility experiments, confirm general trends of this picture.

Binding and Oligomerization of Modified and Native Bt Toxins in Resistant and Susceptible Pink Bollworm.

Directory of Open Access Journals (Sweden)

Josue Ocelotl

Full Text Available Insecticidal proteins from Bacillus thuringiensis (Bt are used extensively in sprays and transgenic crops for pest control, but their efficacy is reduced when pests evolve resistance. Better understanding of the mode of action of Bt toxins and the mechanisms of insect resistance is needed to enhance the durability of these important alternatives to conventional insecticides. Mode of action models agree that binding of Bt toxins to midgut proteins such as cadherin is essential for toxicity, but some details remain unresolved, such as the role of toxin oligomers. In this study, we evaluated how Bt toxin Cry1Ac and its genetically engineered counterpart Cry1AcMod interact with brush border membrane vesicles (BBMV from resistant and susceptible larvae of Pectinophora gossypiella (pink bollworm, a global pest of cotton. Compared with Cry1Ac, Cry1AcMod lacks 56 amino acids at the amino-terminus including helix α-1; previous work showed that Cry1AcMod formed oligomers in vitro without cadherin and killed P. gossypiella larvae harboring cadherin mutations linked with >1000-fold resistance to Cry1Ac. Here we found that resistance to Cry1Ac was associated with reduced oligomer formation and insertion. In contrast, Cry1AcMod formed oligomers in BBMV from resistant larvae. These results confirm the role of cadherin in oligomerization of Cry1Ac in susceptible larvae and imply that forming oligomers without cadherin promotes toxicity of Cry1AcMod against resistant P. gossypiella larvae that have cadherin mutations.

Current distribution and ac susceptibility response of a thin superconducting disc in an axial field: a theoretical approach

Science.gov (United States)

Aruna, S. A.; Zhang, P.; Lin, F. Y.; Ding, S. Y.; Yao, X. X.

2000-04-01

Within the framework of the thermally activated process of the flux line or flux line bundles, and by time integration of the 1D equation of motion of the circulating current density icons/Journals/Common/vecJ" ALT="vecJ" ALIGN="TOP"/> (icons/Journals/Common/rho" ALT="rho" ALIGN="TOP"/> ,t ), which is suitable for thin superconducting films (R >>d ,icons/Journals/Common/le" ALT="le" ALIGN="TOP"/> icons/Journals/Common/lambda" ALT="lambda" ALIGN="TOP"/> ), we present numerical calculations of the current profiles, magnetization hysteresis loops and ac susceptibility icons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> n = icons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> ´n +iicons/Journals/Common/chi" ALT="chi" ALIGN="TOP"/> ´´n for n = 1, 3 and 5 of a thin disc immersed in an axial time-dependent external magnetic field Ba (t ) = Bdc +Bac cos(2icons/Journals/Common/pi" ALT="pi" ALIGN="TOP"/> icons/Journals/Common/nu" ALT="nu" ALIGN="TOP"/> t ). Our calculated results are compared with those of the critical state model (CSM) and found to prove the approximate validity of the CSM below the irreversibility field. The differences between our computed results and those of the CSM are also discussed.

Magnetic properties of high temperature superconductors. AC susceptibility and magnetostriction studies

Energy Technology Data Exchange (ETDEWEB)

Heill, L K

1995-05-01

The author of this thesis has measured the ac magnetic response function {mu} = {mu}`+i{mu}`` in melt-powder-melt-growth YBa{sub 2}Cu{sub 3}O{sub 7} (Y123) with insulating Y{sub 2}BaCuO{sub 5} (Y211) and in single crystal YBa{sub 2}Cu{sub 3}O{sub 7} (SC) in applied dc fields up to 8 T, oriented both parallel and perpendicular to the crystalline c-axis. Both samples are cubes with sides of about 1 mm. The response of the two samples was mapped out as a function of temperature, excitation field amplitude and frequency, dc field and field orientation. It is found that for both samples the loss peak line (LPL) and hence the irreversibility line (IL) exists at higher temperatures and fields for perpendicular field orientation than for parallel. Strong frequency but weak amplitude dependence is observed for parallel orientation, vice versa for perpendicular orientation. The measured response is strongly non-linear for perpendicular orientation, and intermediate between linear (ohmic) and extremely non-linear (Bean critical state) for parallel orientation. The situation at parallel orientation is close to but above the transition into a vortex solid state, and a power law temperature dependence with exponent 1.5 is obtained for the vortex glass transition line. For perpendicular orientation the response is consistent with that expected in a vortex solid. Pinning barriers are found by means of thermal activation analysis. Anomalous loss peaks {mu}``(T) are observed for the SC sample for intermediate fields in perpendicular orientation. Large magnetostriction is found in a flat single crystal Bi{sub 2}Sr{sub 2}CaCu{sub 2}O{sub 8} sample at low temperature and fields up to 6 T applied along the c-axis. 332 refs., 59 figs., 7 tabs.

Continuous Real-time Measurements of Vertical Distribution of Magnetic Susceptibility In Soils

Science.gov (United States)

Petrovsky, E.; Hulka, Z.; Kapicka, A.; Magprox Team

Measurements of top-soil magnetic susceptibility are used in approximative outlining polluted areas. However, one of the serious limitations of the method is discrimina- tion between top-soil layers enhanced by atmospherically deposited anthropogenic particles from those dominated by natural particles migrating from magnetically-rich basement rocks. For this purpose, measurements of vertical distribution of magnetic susceptibility along soil profiles is one of the most effective ways in estimating the effect of lithogenic contribution. Up to now, in most cases soil cores have to be mea- sured in laboratory. This method is quite time consuming and does not allow flexible decision about the suitability of the measured site for surface magnetic mapping. In our contribution we will present a new device enabling continuous real-time measure- ments of vertical distribution of magnetic susceptibility directly in field, performed in holes after soil coring. The method is fast, yielding smooth curves (6 data points per 1 mm dept), at least as sensitive as laboratory methods available until now, and at- tached notebook enables direct, on-line control of the lithogenic versus anthropogenic contributions.

Two-Gyro Pointing Stability of HST measured with ACS

Science.gov (United States)

Koekemoer, Anton M.; Kozhurina-Platais, Vera; Riess, Adam; Sirianni, Marco; Biretta, John; Pavlovsky

2005-06-01

We present the results of the pointing stability tests for HST, as measured with the ACS/ HRC during the Two-Gyro test program conducted in February 2005. We measure the shifts of 185 exposures of the globular clusters NGC6341 and Omega Centauri, obtained over a total of 13 orbits, and compare the measured pointings to those that were commanded in the observing program. We find in all cases that the measured shifts and rotations have the same level of accuracy as those that were commanded in three-gyro mode. Specifically, the pointing offsets during an orbit relative to the first exposure can be characterized with distributions having a dispersion of 2.3 milliarcseconds for shifts and 0.00097 degrees for rotations, thus less than 0.1 HRC pixels, and agree extremely well with similar values measured for comparable exposures obtained in three-gyro mode. In addition, we successfully processed these two-gyro test data through the MultiDrizzle software which is used in the HST pipeline to perform automated registration, cosmic ray rejection and image combination for multiple exposure sequences, and we find excellent agreement with similar exposures obtained in three-gyro mode. In summary, we find no significant difference between the quality of HST pointing as measured from these two-gyro test data, relative to the nominal behavior of HST in regular three-gyro operations.

Physical aspects of magnetic hyperthermia: Low-frequency ac field absorption in a magnetic colloid

International Nuclear Information System (INIS)

Raikher, Yu. L.; Stepanov, V.I.

2014-01-01

A uniaxially anisotropic superparamagnetic particle suspended in a viscous fluid and subjected to an ac field is considered. Consistently taking into account both internal (Néel) and external (Brownian) magnetic relaxations, a simple expression for the dynamic susceptibility is obtained. This result, with regard to the ac field energy absorption, is compared to the common heuristic approach. This is done for a model polydisperse colloid containing maghemite nanoparticles, which are assumed to posses either bulk or surface magnetic anisotropy. It is shown that viscous losses caused by the particle motion in a fluid matrix make important contribution to the full magnetic response of a ferrocolloid and, thus, its ability to absorb the ac field energy. The obtained exact expression, which takes in both dissipation mechanisms, paves the way to correct optimization of the nanoparticle-mediated heating effect. - Highlights: • A uniaxially anisotropic superparamagnetic particle suspended in a viscous fluid and subjected to an ac field is considered. • Consistently taking into account both internal (Néel) and external (Brownian) magnetic relaxations, a simple expression for the dynamic susceptibility is obtained. • This result, with regard to the ac field energy absorption, is compared to the common heuristic approach using as a benchmark a model polydisperse colloid containing maghemite nanoparticles, which are assumed to posses either bulk or surface magnetic anisotropy. • It is shown that viscous losses caused by the particle motion in a fluid matrix make important contribution to the full magnetic response of a ferrocolloid and, thus, its ability to absorb the ac field energy. • The obtained exact expression, which takes in both dissipation mechanisms, paves the way to correct optimization of the nanoparticle-mediated heating effect

Automatic magnetic susceptibility measurements between 4 K and 1200 K

International Nuclear Information System (INIS)

Raphael, G.

1969-01-01

We give a detailed description of a Faraday magnetic susceptibility balance which operates from 4 K to 1200 K. Some preliminary results on platinum and tantalum illustrate the precision and the sensitivity of the measurements. The apparatus has been designed for measurements on the plutonium compounds which present severe health hazards. (author) [fr

Complex Susceptibility Measurement Using Multi-frequency Slingram EMI Instrument

OpenAIRE

Simon , François Xavier; Tabbagh , Alain; Thiesson , Julien; Donati , J.C.; Sarris , A.

2014-01-01

International audience; Complex magnetic susceptibility is a well-known property both theoretically and experimentally. To achieve this measurement, different ways have been tested, like TDEM or multi-frequential measurement on soil sample. In this study we carry out the measurements by the use of a multi-frequential EMI Slingram instrument to collect data quickly and in-situ. The use of multi-frequency data is also a way to correct effects of the conductivity on the in-phase component and ef...

Proteomics-based identification of midgut proteins correlated with Cry1Ac resistance in Plutella xylostella (L.).

Science.gov (United States)

Xia, Jixing; Guo, Zhaojiang; Yang, Zezhong; Zhu, Xun; Kang, Shi; Yang, Xin; Yang, Fengshan; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Xu, Weijun; Zhang, Youjun

2016-09-01

The diamondback moth, Plutella xylostella (L.), is a worldwide pest of cruciferous crops and can rapidly develop resistance to many chemical insecticides. Although insecticidal crystal proteins (i.e., Cry and Cyt toxins) derived from Bacillus thuringiensis (Bt) have been useful alternatives to chemical insecticides for the control of P. xylostella, resistance to Bt in field populations of P. xylostella has already been reported. A better understanding of the resistance mechanisms to Bt should be valuable in delaying resistance development. In this study, the mechanisms underlying P. xylostella resistance to Bt Cry1Ac toxin were investigated using two-dimensional differential in-gel electrophoresis (2D-DIGE) and ligand blotting for the first time. Comparative analyses of the constitutive expression of midgut proteins in Cry1Ac-susceptible and -resistant P. xylostella larvae revealed 31 differentially expressed proteins, 21 of which were identified by mass spectrometry. Of these identified proteins, the following fell into diverse eukaryotic orthologous group (KOG) subcategories may be involved in Cry1Ac resistance in P. xylostella: ATP-binding cassette (ABC) transporter subfamily G member 4 (ABCG4), trypsin, heat shock protein 70 (HSP70), vacuolar H(+)-ATPase, actin, glycosylphosphatidylinositol anchor attachment 1 protein (GAA1) and solute carrier family 30 member 1 (SLC30A1). Additionally, ligand blotting identified the following midgut proteins as Cry1Ac-binding proteins in Cry1Ac-susceptible P. xylostella larvae: ABC transporter subfamily C member 1 (ABCC1), solute carrier family 36 member 1 (SLC36A1), NADH dehydrogenase iron-sulfur protein 3 (NDUFS3), prohibitin and Rap1 GTPase-activating protein 1. Collectively, these proteomic results increase our understanding of the molecular resistance mechanisms to Bt Cry1Ac toxin in P. xylostella and also demonstrate that resistance to Bt Cry1Ac toxin is complex and multifaceted. Copyright © 2016 Elsevier B.V. All

AC-Specific Heat and Heat Conductivity Derived from Thermal Effusivity Measurements

DEFF Research Database (Denmark)

Christensen, Tage Emil

It is shown how the 3-omega technique of AC-calorimetry applied to a plane heater with finite dimensions can be improved by including boundary effects.......It is shown how the 3-omega technique of AC-calorimetry applied to a plane heater with finite dimensions can be improved by including boundary effects....

Transport AC losses in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

2007-09-15

Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

Method for the measurement of susceptibility to decubitus ulcer formation.

Science.gov (United States)

Meijer, J H; Schut, G L; Ribbe, M W; Goovaerts, H G; Nieuwenhuys, R; Reulen, J P; Schneider, H

1989-09-01

A method for measuring the susceptibility of a patient to develop decubitus ulcers is described and initially evaluated. It is based on an indirect, noninvasive measurement of the transient regional blood flow response after a test pressure load which simulates the external stimulus for pressure-sore formation. This method was developed to determine the individual risk of a patient and to study the subfactors which contribute to the susceptibility. This would also offer the possibility of evaluating the effect of preventive treatment aimed at reducing the susceptibility. The method was found to discriminate between preselected elderly patients at risk on the one hand, and non-risk patients and healthy young adults on the other hand. No differences in blood flow responses were found between the non-risk elderly patients and the healthy young adults. This suggests that age per se is not a factor in the formation of pressure sores. In the risk group the recovery time after pressure relief was found to be three times as long as the duration of the pressure exercise. This indicates that the recovery time after pressure exercise may be as important as the period of pressure exercise in deducing the risk of developing decubitus ulcers.

Seven harmonic susceptibility in oxygen and hydrogen loading of sintered YBCO by μs pulsed electrolysis in an aqueous solution at room temperature

International Nuclear Information System (INIS)

Tripodi, P.; Di Gioacchino, D.; Celani, F.

1996-09-01

The complex AC susceptibility of high T c superconducting materials has been described in terms of the first seven harmonic component of Fourier series. Has been measured the χ' n and χ n (n=1,7) of sintered YBa 2 Cu 3 O 7-x (YBCO) bulk oxygen and hydrogen loaded samples versus amplitude and frequency of AC magnetic field at fixed temperature. The sample have been loaded by μs current pulses electrolysis in an aqueous solution (0.3N LiOH+H 2 O) at room temperature. In addition to the simplicity of the experimental setup, this procedure allows to obtain extremely high equivalent hydrogen/oxygen gas pressure on the surface of the electrodes. The YBCO electrode is polarized by short pulse width (0.5-10 μs) and high power (120 W) peaks with a variable repetition rate (0.1-10000 Hz). The pulses are obtained by an home.made pulse generator. The difference in the behavior of the susceptibilities harmonic component between the deficiency and oxygen or hydrogen loaded samples give us the possibility to connect the susceptibilities with variations of the flux pinning in respect to normal losses in the superconducting materials. The loading can be a good probe to have information on the mechanism of the processes that sustain the critical current density Jc in this situation these affects appear strongly dependent on the loading conditions. By comparison of this measurements has been observed drastic change in behavior of susceptibility

Suitability of magnetic single- and multi-core nanoparticles to detect protein binding with dynamic magnetic measurement techniques

International Nuclear Information System (INIS)

Remmer, Hilke; Dieckhoff, Jan; Schilling, Meinhard; Ludwig, Frank

2015-01-01

We investigated the binding of biotinylated proteins to various streptavidin functionalized magnetic nanoparticles with different dynamic magnetic measurement techniques to examine their potential for homogeneous bioassays. As particle systems, single-core nanoparticles with a nominal core diameter of 30 nm as well as multi-core nanoparticles with hydrodynamic sizes varying between nominally 60 nm and 100 nm were chosen. As experimental techniques, fluxgate magnetorelaxometry (MRX), complex ac susceptibility (ACS) and measurements of the phase lag between rotating field and sample magnetization are applied. MRX measurements are only suited for the detection of small analytes if the multivalency of functionalized nanoparticles and analytes causes cross-linking, thus forming larger aggregates. ACS measurements showed for all nanoparticle systems a shift of the imaginary part's maximum towards small frequencies. In rotating field measurements only the single-core nanoparticle systems with dominating Brownian mechanism exhibit an increase of the phase lag upon binding in the investigated frequency range. The coexistence of Brownian and Néel relaxation processes can cause a more complex phase lag change behavior, as demonstrated for multi-core nanoparticle systems. - Highlights: • Cealization of homogeneous magnetic bioassays using different magnetic techniques. • Comparison of single- and multi-core nanoparticle systems. • ac Susceptibility favorable for detection of small analytes. • Magnetorelaxometry favorable for detection of large analytes or cross-linking assays

Insulation measurement and supervision in live AC and DC unearthed systems

CERN Document Server

Olszowiec, Piotr

2014-01-01

Low voltage unearthed (IT) AC and DC systems are commonly applied for supply of power and control circuits in industry, transportation, medical objects etc. The main reasons for their use are high reliability and numerous advantages offered by isolating them against ground. Insulation level is a decisive factor for networks operational reliability and safety. Insufficient insulation-to-ground resistance can cause various disturbances. Though ground faults in IT systems do not make networks operation impossible, they may cause severe problems with their safe functioning. In this book the most important issues concerning normal operation and ground fault phenomena are described in concise form. Numerous methods of insulation resistance and capacitance measurement in live circuits are presented. Important other procedures of  these parameters determination based on measurement and calculation are explained and reviews of selected insulation resistance measurement devices as well as earth fault locating systems ...

Insulation measurement and supervision in live AC and DC unearthed systems

CERN Document Server

Olszowiec, Piotr

2013-01-01

Low voltage unearthed (IT) AC and DC systems are commonly applied for supply of power and control circuits in industry, transportation, medical objects etc. The main reasons for their use are high reliability and numerous advantages offered by isolating them against ground. Insulation level is a decisive factor for networks operational reliability and safety. Insufficient insulation-to-ground resistance can cause various disturbances. Though ground faults in IT systems do not make networks operation impossible, they may cause severe problems with their safe functioning. In this book the most important issues concerning normal operation and ground fault phenomena are described in concise form. Numerous methods of insulation resistance and capacitance measurement in live circuits are presented. Important other procedures of  these parameters determination based on measurement and calculation are explained and reviews of selected insulation resistance measurement devices as well as earth fault locating systems ...

Defects characterization of arsenic implanted silicon by AC Hall effect measurements

International Nuclear Information System (INIS)

Jaouen, H.; Ghibaudo, G.; Christofides, C.

1986-01-01

AC and DC Hall effects measurements as a function of temperature (77 - 300K) and frequency (1Hz - 100KHz) have been performed to characterize implanted Silicon films. This technique enables the determination of the annihilation processes of defects in such layers as a function of temperature of isochronal annealings (300/sup 0/C to 1100/sup 0/C during 1 hour). The experimental results are discussed with respect to proper transport models based on short and long range disorder considerations in order to find out the features of defects and inhomogeneities arising from implantation and their thermal annihilation after isochronal annealing

The Slab Method to Measure the Topological Susceptibility

CERN Document Server

Bietenholz, Wolfgang; de Forcrand, Philippe; Dromard, Arthur; Gerber, Urs

2016-10-11

In simulations of a model with topological sectors, algorithms which proceed in small update steps tend to get stuck in one sector, especially on fine lattices. This distorts the numerical results, in particular it is not straightforward to measure the topological susceptibility chi_t. We test a method to measure chi_t even if configurations from only one sector are available. It is based on the topological charges in sub-volumes, which we denote as "slabs". This enables the evaluation of chi_t, as we demonstrate with numerical results for non-linear sigma-models and for 2-flavour QCD.

Insecticide susceptibility status of human biting mosquitoes in ...

African Journals Online (AJOL)

Matowo Pc

91.5% (n=483) and An. funestus group was 8.5% (n=45). ..... Chitnis, N., Churcher, T., Donnelly, M.J., Ghani, A.C., Godfray, H.C.J., Gould, F., Hastings, ... Efficacy, persistence and vector susceptibility to pirimiphos-methyl (Actellic® 300CS) insecticide ... Macoris, M.L., Andrighetti, M.T.M., Wanderley, D.M.V. & Ribolla, P.E.M. ...

Measurement of Anisotropic Particle Interactions with Nonuniform ac Electric Fields.

Science.gov (United States)

Rupp, Bradley; Torres-Díaz, Isaac; Hua, Xiaoqing; Bevan, Michael A

2018-02-20

Optical microscopy measurements are reported for single anisotropic polymer particles interacting with nonuniform ac electric fields. The present study is limited to conditions where gravity confines particles with their long axis parallel to the substrate such that particles can be treated using quasi-2D analysis. Field parameters are investigated that result in particles residing at either electric field maxima or minima and with long axes oriented either parallel or perpendicular to the electric field direction. By nonintrusively observing thermally sampled positions and orientations at different field frequencies and amplitudes, a Boltzmann inversion of the time-averaged probability of states yields kT-scale energy landscapes (including dipole-field, particle-substrate, and gravitational potentials). The measured energy landscapes show agreement with theoretical potentials using particle conductivity as the sole adjustable material property. Understanding anisotropic particle-field energy landscapes vs field parameters enables quantitative control of local forces and torques on single anisotropic particles to manipulate their position and orientation within nonuniform fields.

Chilo suppressalis and Sesamia inferens display different susceptibility responses to Cry1A insecticidal proteins.

Science.gov (United States)

Li, Bo; Xu, Yangyang; Han, Cao; Han, Lanzhi; Hou, Maolin; Peng, Yufa

2015-10-01

Chilo suppressalis and Sesamia inferens are important lepidopteran rice pests that occur concurrently in rice-growing areas of China. The development of transgenic rice expressing Cry1A insecticidal proteins has provided a useful strategy for controlling these pests. This study evaluated the baseline susceptibilities of C. suppressalis and S. inferens to Cry1A, as well as their responses to selection with Cry1A. Wide geographic variation in susceptibility was observed across all field populations. Within a given population, the LC50 of both Cry1Ab and Cry1Ac against S. inferens was drastically higher than that of C. suppressalis. Large LC50 differences (74.6-fold) were detected between the two species for Cry1Ab in the Poyang population, while small differences (3.6-fold) were detected for Cry1Ac in the Changsha population. The Cry1Ac LC50 of C. suppressalis and S. inferens increased 8.4- and 4.4-fold after 21 and eight selection generations respectively. Additionally, the estimated realised heritabilities (h(2) ) of Cry1Ac tolerance were 0.11 in C. suppressalis and 0.292 in S. inferens. S. inferens exhibited a significantly lower susceptibility and more rapidly evolved resistance to Cry1A compared with C. suppressalis. Therefore, S. inferens is more likely to evolve increased resistance, which threatens the sustainability of rice expressing Cry1A protein. © 2014 Society of Chemical Industry.

Description of analytical method and clinical utility of measuring serum 7-alpha-hydroxy-4-cholesten-3-one (7aC4) by mass spectrometry.

Science.gov (United States)

Donato, Leslie J; Lueke, Alan; Kenyon, Stacy M; Meeusen, Jeffrey W; Camilleri, Michael

2018-02-01

Imbalance of bile acids (BA) homeostasis in the gastrointestinal tract can lead to chronic diarrhea or constipation when BA in the colon are in excess or low, respectively. Since both disturbances of bowel function can result from other etiologies, identifying BA imbalance is important to tailor treatment strategies. Serum concentrations of 7-alpha-hydroxy-4-cholesten-3-one (7aC4), a precursor in bile acid synthesis, reflect BA homeostasis. Here we describe a method to accurately measure serum 7aC4 and evaluate the clinical utility in patients with diarrhea or constipation phenotypes. Serum 7aC4 is measured after acetonitrile protein precipitation using C18 liquid chromatography, tandem mass spectrometry, and deuterium-labeled 7aC4 internal standard. Assay performance including linearity, precision, and accuracy was assessed using waste serum samples. The reference interval was established in healthy individuals without BA-altering conditions or medications. Clinical performance was assessed in patients with irritable bowel syndrome. The method precisely and accurately measured 7aC4 in human serum from 1.4-338ng/mL with no ion suppression or interference from related 7-keto-cholesterol. Central 95th percentile reference interval was 2.5-63.2ng/mL. Lower serum 7aC4 was found in patients with constipation with sensitivity/specificity of 79%/55% compared to healthy controls. Higher 7aC4 was found in patients with bile acid diarrhea (BAD) compared to those without BAD with sensitivity/specificity of 82%/53%. We have developed a sensitive and precise assay for measuring the concentration of 7aC4 in serum. The assay can be used to screen for diarrhea caused by bile acid malabsorption. Copyright © 2017 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

Nuclear structure of 231Ac

International Nuclear Information System (INIS)

Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

2008-01-01

The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

Susceptibility of CoFeB/AlOx/Co Magnetic Tunnel Junctions to Low-Frequency Alternating Current

Directory of Open Access Journals (Sweden)

Yuan-Tsung Chen

2013-10-01

Full Text Available This investigation studies CoFeB/AlOx/Co magnetic tunneling junction (MTJ in the magnetic field of a low-frequency alternating current, for various thicknesses of the barrier layer AlOx. The low-frequency alternate-current magnetic susceptibility (χac and phase angle (θ of the CoFeB/AlOx/Co MTJ are determined using an cac analyzer. The driving frequency ranges from 10 to 25,000 Hz. These multilayered MTJs are deposited on a silicon substrate using a DC and RF magnetron sputtering system. Barrier layer thicknesses are 22, 26, and 30 Å. The X-ray diffraction patterns (XRD include a main peak at 2θ = 44.7° from hexagonal close-packed (HCP Co with a highly (0002 textured structure, with AlOx and CoFeB as amorphous phases. The full width at half maximum (FWHM of the Co(0002 peak, decreases as the AlOx thickness increases; revealing that the Co layer becomes more crystalline with increasing thickness. χac result demonstrates that the optimal resonance frequency (fres that maximizes the χac value is 500 Hz. As the frequency increases to 1000 Hz, the susceptibility decreases rapidly. However, when the frequency increases over 1000 Hz, the susceptibility sharply declines, and almost closes to zero. The experimental results reveal that the mean optimal susceptibility is 1.87 at an AlOx barrier layer thickness of 30 Å because the Co(0002 texture induces magneto-anisotropy, which improves the indirect CoFeB and Co spin exchange-coupling strength and the χac value. The results concerning magnetism indicate that the magnetic characteristics are related to the crystallinity of Co.

Magneto-optical measurements on high-temperature superconductors influenced by AC-fields; Magnetooptische Untersuchungen an Hochtemperatursupraleitern unter Einfluss von Frequenzfeldern

Energy Technology Data Exchange (ETDEWEB)

Che' Rose, Simon

2007-01-15

In this work magneto-optical measurements on YBa{sub 2}Cu{sub 3}O{sub 7-x} and MgB{sub 2} thin films were done. For YBCO the influence of AC-pulses on the flux and current density of a thin film with transport current was investigated. For MgB{sub 2} the influence of AC-fields on the homogenous and dendritic flux penetration was researched. (orig.)

Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

International Nuclear Information System (INIS)

Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

1997-01-01

The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

Static Measurements on HTS Coils of Fully Superconducting AC Electric Machines for Aircraft Electric Propulsion System

Science.gov (United States)

Choi, Benjamin B.; Hunker, Keith R.; Hartwig, Jason; Brown, Gerald V.

2017-01-01

The NASA Glenn Research Center (GRC) has been developing the high efficiency and high-power density superconducting (SC) electric machines in full support of electrified aircraft propulsion (EAP) systems for a future electric aircraft. A SC coil test rig has been designed and built to perform static and AC measurements on BSCCO, (RE)BCO, and YBCO high temperature superconducting (HTS) wire and coils at liquid nitrogen (LN2) temperature. In this paper, DC measurements on five SC coil configurations of various geometry in zero external magnetic field are measured to develop good measurement technique and to determine the critical current (Ic) and the sharpness (n value) of the super-to-normal transition. Also, standard procedures for coil design, fabrication, coil mounting, micro-volt measurement, cryogenic testing, current control, and data acquisition technique were established. Experimentally measured critical currents are compared with theoretical predicted values based on an electric-field criterion (Ec). Data here are essential to quantify the SC electric machine operation limits where the SC begins to exhibit non-zero resistance. All test data will be utilized to assess the feasibility of using HTS coils for the fully superconducting AC electric machine development for an aircraft electric propulsion system.

Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

Energy Technology Data Exchange (ETDEWEB)

Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

2014-10-01

Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

AC Initiation System.

Science.gov (United States)

An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

Disk-cylinder method for using NMR to measure magnetic susceptibility

International Nuclear Information System (INIS)

Burnham, A.K.

1978-01-01

The sphere-cylinder method of using nuclear magnetic resonance (NMR) to measure the magnetic susceptibility of diamagnetic and paramagnetic materials has been generalized to the disk-cylinder method. A two-fold increase in sensitivity was obtained. Accuracies of 0.1% of the diamagnetism of water should be readily obtainable

Fast electric dipole transitions in Ra-Ac nuclei

International Nuclear Information System (INIS)

Ahmad, I.

1985-01-01

Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs

Seven harmonic susceptibility in oxygen and hydrogen loading of sintered YBCO by {mu}s pulsed electrolysis in an aqueous solution at room temperature

Energy Technology Data Exchange (ETDEWEB)

Tripodi, P.; Di Gioacchino, D.; Celani, F. [Istituto Nazionale di Fisica Nucleare, Frascati (Italy). Lab. Nazionale di Frascati

1996-09-01

The complex AC susceptibility of high T{sub c} superconducting materials has been described in terms of the first seven harmonic component of Fourier series. Has been measured the {chi}{sub n} (n=1,7) of sintered YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO) bulk oxygen and hydrogen loaded samples versus amplitude and frequency of AC magnetic field at fixed temperature. The sample have been loaded by {mu}s current pulses electrolysis in an aqueous solution (0.3N LiOH+H{sub 2}O) at room temperature. In addition to the simplicity of the experimental setup, this procedure allows to obtain extremely high equivalent hydrogen/oxygen gas pressure on the surface of the electrodes. The YBCO electrode is polarized by short pulse width (0.5-10 {mu}s) and high power (120 W) peaks with a variable repetition rate (0.1-10000 Hz). The pulses are obtained by an home.made pulse generator. The difference in the behavior of the susceptibilities harmonic component between the deficiency and oxygen or hydrogen loaded samples give us the possibility to connect the susceptibilities with variations of the flux pinning in respect to normal losses in the superconducting materials. The loading can be a good probe to have information on the mechanism of the processes that sustain the critical current density Jc in this situation these affects appear strongly dependent on the loading conditions. By comparison of this measurements has been observed drastic change in behavior of susceptibility.

Method of magnetic susceptibility mapping of drilled cores. Experimental measurements for geologic structures determination

International Nuclear Information System (INIS)

Delrive, C.

1993-01-01

The evaluation of the safety of a deep geologic repository for dangerous materials requires the knowledge of the interstitial system of the surrounding host rock. A method is proposed for the determination of geologic structures (in particular fractures) from the magnetic susceptibility mapping of drilled cores. The feasibility of the method has been demonstrated using a SQUID magneto-gradient meter. A measurement tool using a new magnetic susceptibility captor and a testing bench have been developed. This tool allows the measurement of rocks with a magnetic susceptibility greater than 10 -5 SI units and can generate magnetic susceptibility maps with 4 x 4 mm 2 pixels. A magnetic visibility criterion has been defined which allows to foresee if a structure is visible or not. According to the measurements done, it is shown that any centimeter-scale structure with a sufficient magnetic contrast (20%) with respect to the matrix is visible. Therefore, the dip and the orientation of such structure can be determined with a 3 degree and a 5 degree precision, respectively. The position of the structure along the core axis is known with a 4 mm precision. On the other hand, about half of the magnetic contrasts observed do not correspond to the visual analyses and can be explained by very small variations of the mineralogic composition. This last point offers some interesting ways for future research using magnetic susceptibility mapping. (J.S.). 31 refs., 90 figs., 18 tabs., 2 photos., 6 appends

In-flight particle measurement of glass raw materials in hybrid heating of twelve-phase AC arc with oxygen burner

International Nuclear Information System (INIS)

Liu, Y; Tanaka, M; Ikeba, T; Choi, S; Watanabe, T

2012-01-01

The high temperature provided by a 12-phase AC arc plasma is beneficial to finish vitrification reaction in milliseconds. Another heating method called “hybrid plasma” combines multi-phase AC arc and oxygen burner are expected to improve glass quality and increase productivity with minimum energy consumption. In this study, recent works on the development of in-flight particle measurement in hybrid plasma system are presented. Two-colour pyrometry offers considerable advantages for measuring particle temperatures in flight. A high-speed camera equipped with a band-pass filter system was applied to measure the in-flight temperatures of glass particles. The intensity recorded by the camera was calibrated using a tungsten halogen lamp. This technique also allows evaluating the fluctuation of the average particle temperature within millisecond in plasma region.

Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

Study on ac losses of HTS coil carrying ac transport current

International Nuclear Information System (INIS)

Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

2005-01-01

Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

Design of PCB search coils for AC magnetic flux density measurement

Science.gov (United States)

Ulvr, Michal

2018-04-01

This paper presents single-layer, double-layer and ten-layer planar square search coils designed for AC magnetic flux density amplitude measurement up to 1 T in the low frequency range in a 10 mm air gap. The printed-circuit-board (PCB) method was used for producing the search coils. Special attention is given to a full characterization of the PCB search coils including a comparison between the detailed analytical design method and the finite integration technique method (FIT) on the one hand, and experimental results on the other. The results show very good agreement in the resistance, inductance and search coil constant values (the area turns) and also in the frequency dependence of the search coil constant.

Multi-phase AC/AC step-down converter for distribution systems

Science.gov (United States)

Aeloiza, Eddy C.; Burgos, Rolando P.

2017-10-25

A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

Science.gov (United States)

Han, Xiaomin; Li, Guojing; Zhang, Shuqun

2017-01-01

Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

MAPK Signaling Pathway Alters Expression of Midgut ALP and ABCC Genes and Causes Resistance to Bacillus thuringiensis Cry1Ac Toxin in Diamondback Moth

Science.gov (United States)

Wu, Qingjun; Wang, Shaoli; Xie, Wen; Zhu, Xun; Baxter, Simon W.; Zhou, Xuguo; Jurat-Fuentes, Juan Luis; Zhang, Youjun

2015-01-01

Insecticidal crystal toxins derived from the soil bacterium Bacillus thuringiensis (Bt) are widely used as biopesticide sprays or expressed in transgenic crops to control insect pests. However, large-scale use of Bt has led to field-evolved resistance in several lepidopteran pests. Resistance to Bt Cry1Ac toxin in the diamondback moth, Plutella xylostella (L.), was previously mapped to a multigenic resistance locus (BtR-1). Here, we assembled the 3.15 Mb BtR-1 locus and found high-level resistance to Cry1Ac and Bt biopesticide in four independent P. xylostella strains were all associated with differential expression of a midgut membrane-bound alkaline phosphatase (ALP) outside this locus and a suite of ATP-binding cassette transporter subfamily C (ABCC) genes inside this locus. The interplay between these resistance genes is controlled by a previously uncharacterized trans-regulatory mechanism via the mitogen-activated protein kinase (MAPK) signaling pathway. Molecular, biochemical, and functional analyses have established ALP as a functional Cry1Ac receptor. Phenotypic association experiments revealed that the recessive Cry1Ac resistance was tightly linked to down-regulation of ALP, ABCC2 and ABCC3, whereas it was not linked to up-regulation of ABCC1. Silencing of ABCC2 and ABCC3 in susceptible larvae reduced their susceptibility to Cry1Ac but did not affect the expression of ALP, whereas suppression of MAP4K4, a constitutively transcriptionally-activated MAPK upstream gene within the BtR-1 locus, led to a transient recovery of gene expression thereby restoring the susceptibility in resistant larvae. These results highlight a crucial role for ALP and ABCC genes in field-evolved resistance to Cry1Ac and reveal a novel trans-regulatory signaling mechanism responsible for modulating the expression of these pivotal genes in P. xylostella. PMID:25875245

MAPK signaling pathway alters expression of midgut ALP and ABCC genes and causes resistance to Bacillus thuringiensis Cry1Ac toxin in diamondback moth.

Directory of Open Access Journals (Sweden)

Zhaojiang Guo

2015-04-01

Full Text Available Insecticidal crystal toxins derived from the soil bacterium Bacillus thuringiensis (Bt are widely used as biopesticide sprays or expressed in transgenic crops to control insect pests. However, large-scale use of Bt has led to field-evolved resistance in several lepidopteran pests. Resistance to Bt Cry1Ac toxin in the diamondback moth, Plutella xylostella (L., was previously mapped to a multigenic resistance locus (BtR-1. Here, we assembled the 3.15 Mb BtR-1 locus and found high-level resistance to Cry1Ac and Bt biopesticide in four independent P. xylostella strains were all associated with differential expression of a midgut membrane-bound alkaline phosphatase (ALP outside this locus and a suite of ATP-binding cassette transporter subfamily C (ABCC genes inside this locus. The interplay between these resistance genes is controlled by a previously uncharacterized trans-regulatory mechanism via the mitogen-activated protein kinase (MAPK signaling pathway. Molecular, biochemical, and functional analyses have established ALP as a functional Cry1Ac receptor. Phenotypic association experiments revealed that the recessive Cry1Ac resistance was tightly linked to down-regulation of ALP, ABCC2 and ABCC3, whereas it was not linked to up-regulation of ABCC1. Silencing of ABCC2 and ABCC3 in susceptible larvae reduced their susceptibility to Cry1Ac but did not affect the expression of ALP, whereas suppression of MAP4K4, a constitutively transcriptionally-activated MAPK upstream gene within the BtR-1 locus, led to a transient recovery of gene expression thereby restoring the susceptibility in resistant larvae. These results highlight a crucial role for ALP and ABCC genes in field-evolved resistance to Cry1Ac and reveal a novel trans-regulatory signaling mechanism responsible for modulating the expression of these pivotal genes in P. xylostella.

Low ac loss geometries in YBCO coated conductors

International Nuclear Information System (INIS)

Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

Low ac loss geometries in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

2007-10-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

A catechol oxidase AcPPO from cherimoya (Annona cherimola Mill.) is localized to the Golgi apparatus.

Science.gov (United States)

Olmedo, Patricio; Moreno, Adrián A; Sanhueza, Dayan; Balic, Iván; Silva-Sanzana, Christian; Zepeda, Baltasar; Verdonk, Julian C; Arriagada, César; Meneses, Claudio; Campos-Vargas, Reinaldo

2018-01-01

Cherimoya (Annona cherimola) is an exotic fruit with attractive organoleptic characteristics. However, it is highly perishable and susceptible to postharvest browning. In fresh fruit, browning is primarily caused by the polyphenol oxidase (PPO) enzyme catalyzing the oxidation of o-diphenols to quinones, which polymerize to form brown melanin pigment. There is no consensus in the literature regarding a specific role of PPO, and its subcellular localization in different plant species is mainly described within plastids. The present work determined the subcellular localization of a PPO protein from cherimoya (AcPPO). The obtained results revealed that the AcPPO- green fluorescent protein co-localized with a Golgi apparatus marker, and AcPPO activity was present in Golgi apparatus-enriched fractions. Likewise, transient expression assays revealed that AcPPO remained active in Golgi apparatus-enriched fractions obtained from tobacco leaves. These results suggest a putative function of AcPPO in the Golgi apparatus of cherimoya, providing new perspectives on PPO functionality in the secretory pathway, its effects on cherimoya physiology, and the evolution of this enzyme. Copyright © 2017. Published by Elsevier B.V.

Differential detection for measurements of Faraday rotation by means of ac magnetic fields

International Nuclear Information System (INIS)

Valev, V K; Wouters, J; Verbiest, T

2008-01-01

We demonstrate that by using a combination of a Wollaston prism and two photodiodes the accuracy in the measurements of Faraday rotation with ac magnetic fields can be greatly improved. Our experiments were performed on microscope cover glass plates with thicknesses between 0.13 and 0.16 mm. We show that our setup is capable of distinguishing between the Faraday rotation signals of glass plates having a difference in thickness of a few micrometers, corresponding to Faraday rotations of hundreds of microdegrees per Tesla only

Comparative Genomics of Two ST 195 Carbapenem-Resistant Acinetobacter baumannii with Different Susceptibility to Polymyxin Revealed Underlying Resistance Mechanism

Science.gov (United States)

Lean, Soo-Sum; Yeo, Chew Chieng; Suhaili, Zarizal; Thong, Kwai-Lin

2016-01-01

Acinetobacter baumannii is a Gram-negative nosocomial pathogen of importance due to its uncanny ability to acquire resistance to most antimicrobials. These include carbapenems, which are the drugs of choice for treating A. baumannii infections, and polymyxins, the drugs of last resort. Whole genome sequencing was performed on two clinical carbapenem-resistant A. baumannii AC29 and AC30 strains which had an indistinguishable ApaI pulsotype but different susceptibilities to polymyxin. Both genomes consisted of an approximately 3.8 Mbp circular chromosome each and several plasmids. AC29 (susceptible to polymyxin) and AC30 (resistant to polymyxin) belonged to the ST195 lineage and are phylogenetically clustered under the International Clone II (IC-II) group. An AbaR4-type resistance island (RI) interrupted the comM gene in the chromosomes of both strains and contained the blaOXA−23 carbapenemase gene and determinants for tetracycline and streptomycin resistance. AC29 harbored another copy of blaOXA−23 in a large (~74 kb) conjugative plasmid, pAC29b, but this gene was absent in a similar plasmid (pAC30c) found in AC30. A 7 kb Tn1548::armA RI which encodes determinants for aminoglycoside and macrolide resistance, is chromosomally-located in AC29 but found in a 16 kb plasmid in AC30, pAC30b. Analysis of known determinants for polymyxin resistance in AC30 showed mutations in the pmrA gene encoding the response regulator of the two-component pmrAB signal transduction system as well as in the lpxD, lpxC, and lpsB genes that encode enzymes involved in the biosynthesis of lipopolysaccharide (LPS). Experimental evidence indicated that impairment of LPS along with overexpression of pmrAB may have contributed to the development of polymyxin resistance in AC30. Cloning of a novel variant of the blaAmpC gene from AC29 and AC30, and its subsequent expression in E. coli also indicated its likely function as an extended-spectrum cephalosporinase. PMID:26779129

New perspectives to the enterotoxigenic E. coli F4 porcine infection model: Susceptibility genotypes in relation to performance, diarrhoea and bacterial shedding.

Science.gov (United States)

Roubos-van den Hil, Petra J; Litjens, Ralph; Oudshoorn, Anna-Katharina; Resink, Jan Willem; Smits, Coen H M

2017-04-01

Enterotoxigenic E. coli (ETEC), causing post-weaning diarrhoea, is a major problem in weaned piglets. Individual animal responses to ETEC infection show high variability in animal experiments. Two studies were designed to optimize the ETEC F4ac infection model in piglets by combining the genotype susceptibility with performance, diarrhoea incidence and bacterial shedding. The studies were performed with respectively 120 and 80 male piglets that were tested for susceptibility or resistance towards ETEC O149:F4ac by a DNA marker based test. Three different genotypes were observed; resistant (RR), susceptible heterozygote (RS) and susceptible homozygote (SS). Piglets, were orally infected with an inoculum suspension (containing 1.5E8 CFU/ml ETEC F4ac) at day 0, 1 and 2 of the study. Performance, diarrhoea incidence and bacterial shedding were followed for 21days. In the first week after challenge a difference in average daily gain was observed between resistant and susceptible piglets in both studies. For the complete study period no significant differences were observed. Diarrhoea incidence was significantly higher in susceptible pigs compared to the resistant pigs in the first week after challenge. Bacterial shedding was much higher in the susceptible pigs and ETEC excretion lasted longer. ETEC was hardly detected in the faecal material of the resistant pigs. In conclusion, susceptible pigs showed higher diarrhoea incidence and higher numbers of faecal ETEC shedding in the first week after challenge compared to resistant pigs. The DNA marker based test can be used to select pigs that are susceptible for ETEC for inclusion in ETEC infection model, resulting in less animals needed to perform infection studies. Copyright © 2016 Elsevier B.V. All rights reserved.

AC – AC Converters for UPS

Directory of Open Access Journals (Sweden)

Rusalin Lucian R. Păun

2008-05-01

Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

Performance of AC/graphite capacitors at high weight ratios of AC/graphite

Energy Technology Data Exchange (ETDEWEB)

Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

2008-03-01

The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

Increased frequency of pink bollworm resistance to Bt toxin Cry1Ac in China.

Directory of Open Access Journals (Sweden)

Peng Wan

Full Text Available Transgenic crops producing insecticidal proteins from Bacillus thuringiensis (Bt kill some key insect pests, but evolution of resistance by pests can reduce their efficacy. The main approach for delaying pest adaptation to Bt crops uses non-Bt host plants as "refuges" to increase survival of susceptible pests. To delay evolution of pest resistance to transgenic cotton producing Bt toxin Cry1Ac, the United States and some other countries have required refuges of non-Bt cotton, while farmers in China have relied on "natural" refuges of non-Bt host plants other than cotton. The "natural" refuge strategy focuses on cotton bollworm (Helicoverpa armigera, the primary target of Bt cotton in China that attacks many crops, but it does not apply to another major pest, pink bollworm (Pectinophora gossypiella, which feeds almost entirely on cotton in China. Here we report data showing field-evolved resistance to Cry1Ac by pink bollworm in the Yangtze River Valley of China. Laboratory bioassay data from 51 field-derived strains show that the susceptibility to Cry1Ac was significantly lower during 2008 to 2010 than 2005 to 2007. The percentage of field populations yielding one or more survivors at a diagnostic concentration of Cry1Ac increased from 0% in 2005-2007 to 56% in 2008-2010. However, the median survival at the diagnostic concentration was only 1.6% from 2008 to 2010 and failure of Bt cotton to control pink bollworm has not been reported in China. The early detection of resistance reported here may promote proactive countermeasures, such as a switch to transgenic cotton producing toxins distinct from Cry1A toxins, increased planting of non-Bt cotton, and integration of other management tactics together with Bt cotton.

Nuclear structure of {sup 231}Ac

Energy Technology Data Exchange (ETDEWEB)

Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

2008-10-15

The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

AC Calorimetric Design for Dynamic of Biological Materials

OpenAIRE

Shigeo Imaizumi

2006-01-01

We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...

Construction and characterisation of near-isogenic Plutella xylostella (Lepidoptera: Plutellidae) strains resistant to Cry1Ac toxin.

Science.gov (United States)

Zhu, Xun; Lei, Yanyuan; Yang, Yanjv; Baxter, Simon W; Li, Jianhong; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Guo, Zhaojiang; Fu, Wei; Zhang, Youjun

2015-02-01

Resistance to insecticidal Bacillus thuringiensis (Bt) toxins has arisen in multiple populations of the worldwide Brassica pest Plutella xylostella (L.). To help elucidate the mechanism of resistance to Bt Cry1Ac toxin in a population from Florida, two pairs of near-isogenic lines (NILs) were developed. NILs were generated using either backcross or recombinant inbred line methodologies and evaluated for near-isogenicity with inter-simple-sequence-repeat (ISSR) markers. Backcross line BC6F4 maintained a similar level of Cry1Ac resistance to parental strain DBM1Ac-R (>5000-fold) yet showed 98.24% genetic similarity to the susceptible parental strain DBM1Ac-S. Single-pair backcrosses between DBM1Ac-S and BC6F4 revealed that Cry1Ac resistance was controlled by one recessive autosomal locus. BC6F4 exhibited high levels of cross-resistance to Cry1Ab and Cry1Ah but not to Cry1Ca or Cry1Ie. Near-isogenic strains were constructed to provide a reliable biological system to investigate the mechanism of Cry1Ac resistance in P. xylostella. These data suggest that resistance to Cry1Ac, Cry1Ab and Cry1Ah is probably caused by the alteration of a common receptor not recognised by Cry1Ca or Cry1Ie. Understanding Bt toxin cross-resistance provides valuable information to consider when developing pest control strategies to delay resistance evolution. © 2014 Society of Chemical Industry. © 2014 Society of Chemical Industry.

Self-field AC losses in Bi-2223 superconducting tapes

International Nuclear Information System (INIS)

Mueller, K. H.; Leslie, K.E.

1996-01-01

Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed

Review of the system compatibility and ride-through options for AC and DC drives including multilevel inverters

Energy Technology Data Exchange (ETDEWEB)

Jouanne, A. von [Power Electronics Lab. - Elect. and Compt. Engineering Dept. - Oregon State Univ., Corvallis, OR (United States); Ben Banerjee, B. [Electric Power Research Inst. - Power Electronics, Energy Delivery, Palo Alto, CA (United States)

2000-07-01

Adjustable speed drive (ASD) compatibility and ride-through issues have caused increased concerns due to the susceptibility of AC and DC drives to power disturbances, and the costly results of process disruptions. These losses can be avoided for critical production processes by using ASDs with ride-through capabilities. This paper assesses industrial ride-through requirements and application issues for AC and DC drives, including medium voltage (2300/4160 V) multi-level inverter topologies. Ride-through alternatives are evaluated based on design, implementation and cost considerations in order to determine the most suitable solutions for various kVA ratings and time duration requirements. (orig.)

Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique

DEFF Research Database (Denmark)

Blaabjerg, Frede; Aquila, A. Dell’; Liserre, Marco

2004-01-01

of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....

Binding site concentration explains the differential susceptibility of Chilo suppressalis and Sesamia inferens to Cry1A-producing rice.

Science.gov (United States)

Han, Lanzhi; Han, Chao; Liu, Zewen; Chen, Fajun; Jurat-Fuentes, Juan Luis; Hou, Maolin; Peng, Yufa

2014-08-01

Chilo suppressalis and Sesamia inferens are two important lepidopteran rice pests that occur concurrently during outbreaks in paddy fields in the main rice-growing areas of China. Previous and current field tests demonstrate that the transgenic rice line Huahui 1 (HH1) producing a Cry1Ab-Cry1Ac hybrid toxin from the bacterium Bacillus thuringiensis reduces egg and larval densities of C. suppressalis but not of S. inferens. This differential susceptibility to HH1 rice correlates with the reduced susceptibility to Cry1Ab and Cry1Ac toxins in S. inferens larvae compared to C. suppressalis larvae. The goal of this study was to identify the mechanism responsible for this differential susceptibility. In saturation binding assays, both Cry1Ab and Cry1Ac toxins bound with high affinity and in a saturable manner to midgut brush border membrane vesicles (BBMV) from C. suppressalis and S. inferens larvae. While binding affinities were similar, a dramatically lower concentration of Cry1A toxin binding sites was detected for S. inferens BBMV than for C. suppressalis BBMV. In contrast, no significant differences between species were detected for Cry1Ca toxin binding to BBMV. Ligand blotting detected BBMV proteins binding Cry1Ac or Cry1Ca toxins, some of them unique to C. suppressalis or S. inferens. These data support that reduced Cry1A binding site concentration is associated with a lower susceptibility to Cry1A toxins and HH1 rice in S. inferens larvae than in C. suppressalis larvae. Moreover, our data support Cry1Ca as a candidate for pyramiding efforts with Cry1A-producing rice to extend the activity range and durability of this technology against rice stem borers. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

Moessbauer and magnetic susceptibility measurements on M-type hexagonal Ba - ferrite

International Nuclear Information System (INIS)

Lipka, J.; Gruskova, A.; Sitek, J.; Miglierini, M.; Groene, R.; Hucl, M.; Toth, I.; Orlicky, O.

1990-01-01

Samples of stoichiometric BaFe 12 O 19 and Co, Ti substituted barium ferrite were prepared by chemical wet method. Moessbauer spectroscopy, magnetic susceptibility measurements, X-ray diffraction, infrared spectroscopy were conducted to examine the mechanism of formation. The observed magnetic characteristics and electron scanning microscopy show that single domain coprecipitated powders were formed. (orig.)

Magnetism of a sigma-phase Fe{sub 60}V{sub 40} alloy: Magnetic susceptibilities and magnetocaloric effect studies

Energy Technology Data Exchange (ETDEWEB)

Bałanda, Maria [Institute of Nuclear Physics, Polish Academy of Science, PL-31-342 Kraków (Poland); Dubiel, Stanisław M., E-mail: Stanislaw.Dubiel@fis.agh.edu.pl [AGH University of Science and Technology, Faculty of Physics and Applied Computer Science, PL-30-059 Kraków (Poland); Pełka, Robert [Institute of Nuclear Physics, Polish Academy of Science, PL-31-342 Kraków (Poland)

2017-06-15

Highlights: • Sigma-phase Fe{sub 60}V{sub 40} alloy was studied by means of AC and DC magnetic susceptibilities. • Re-entrant character of the magnetism has been evidenced. • Curie temperature was found as ∼169 K and the spin-freezing temperature as ∼164 K. • Critical exponents β = 0.6, γ = 1.0 and Δ = 1.6 were determined. • Magnetocaloric effect was investigated. - Abstract: Magnetic properties of a sigma-phase Fe{sub 60}V{sub 40} intermetallic compound were studied by means of ac and dc magnetic susceptibility and magnetocaloric effect measurements. The compound is a soft magnet yet it was found to behave like a re-entrant spin-glass system. The magnetic ordering temperature was found to be T{sub C} ≈ 170 K, while the spin-freezing temperature was ∼164 K. Its relative shift per decade of ac frequency was 0.002, a value smaller than that typical of canonical spin-glasses. Magnetic entropy change, ΔS, in the vicinity of T{sub C} was determined for magnetic field, H, ranging between 5 and 50 kOe. Analysis of ΔS in terms of the power law yielded the critical exponent, n, vs. temperature with the minimum value of 0.75 at T{sub C}, while from the analysis of a relative shift of the maximum value of ΔS with the field a critical exponent Δ = 1.7 was obtained. Based on scaling laws relationships values of other two exponents viz. β = 0.6 and γ = 1 were determined.

A.C. losses in current-carrying superconductors

International Nuclear Information System (INIS)

Reuver, J.L. de.

1985-01-01

The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

Cooperative Frequency Control for Autonomous AC Microgrids

DEFF Research Database (Denmark)

Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

2015-01-01

Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

IDENTIFYING ANTHROPOGENIC METALLIC POLLUTANTS USING FREQUENCY DEPENDENT MAGNETIC SUSCEPTIBILITY MEASUREMENTS IN ABUJA METROPOLIS

Directory of Open Access Journals (Sweden)

Jatto S. Solomon

2017-07-01

Full Text Available Soil formed from lithological and weathering processes of parent rocks generally exhibit paramagnetic properties due to some minerals contained in the rocks and thus have significant value of magnetic susceptibility. This susceptibility arising from the influence of the parent rocks tend to mask anthropogenic grains pollutants released into the environment by human activities. Hence, it becomes difficult to identify the effect of the lithological and anthropogenic magnetic susceptibility in complex soil found in urban areas. The superparamagnetic effect of lithological soil, a single state domain and multi-domain state of anthropogenic grains can easily be investigated by frequency dependent measurements where readings between 0-2.0% indicates the absence of lithological influence, 2.0-8.0% indicates multi-domain grains or mixture of both single stage and multi-domian grains and 8.0-12% indicates the superparamagntic (SP grain from lithological origin. In this work frequency dependent measurements were carried out along 5 selected road networks within the 5 districts of Abuja phase 1. Measurements were also carried out in 379 random points at the surface and depth of 40.0cm to investigate the distribution of anthropogenic grains in Abuja metropolis using the Bartington susceptibility meter. Frequency dependent measurements along the selected road networks indicate0-3.0% immediately after the roads pavement to a distance of about 3.0m from the road, indicating that the magnetic susceptibility arise mostly form anthropogenic influence rather than lithological processes. At the distance of 3.0-8.0m, frequency dependent values of about 3.0-8.0% were recorded, indicating mixture of both superparamagnetic and multi-domain grains. Beyond the distance of 8.0m, the frequency dependent values are mostly above 8.0.0%, indicating virtually all SP grains. The spatial distribution frequency dependent surface map shows the presence of anthropogenic grains in

Probable alpha and 14C cluster emission from hyper Ac nuclei

International Nuclear Information System (INIS)

Santhosh, K.P.

2013-01-01

A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)

PWM CONTROLLER'S MODELS FOR INVESTIGATION ACS IN SPICEFAMILY ECAD PROGRAMS

Directory of Open Access Journals (Sweden)

O. V. VASYLENKO

2018-05-01

Full Text Available Purpose. To improve simulation and design of Automatic Control Systems in the SPICE-compatible programs and to obtain separate economic and universal macromodels of PWM controller. Development of an PWM controller economical macromodel for the study of automatic control systems (ACS in computer-aided design (ECAD  programs, which does not generate algorithmic failures in comparison with the existing models of PWM. Findings. Analysis of SPICE-family applications’ mathematical basis allowed to classifying existing models of PWM-controllers, defining their suitability for ACS simulation. The criteria for the synthesis of new models have been defined. For the SPICE 3G algorithms, the Switch and Averaged models based on behavioral elements has been developed. Universal and economical PWM controller macromodel based on the simple algorithm for determining the output signal with minimum numbers of input parameters has been designed. For the Automated Measuring magnetic susceptibility System, the macromodel of quasi-PWM signal generator have been designed, which is used in the compensation subsystem. This model is different from the existing ones: it synthesizes the staircase output signal instead the pulse one, thus, there is direct control of the amplitude of the output signal, which is taken averaged. The adequacy of the models is confirmed as comparison of the simulation results during investigations of the model already existing in the SPICE program, as well as the results of experiments with real ACS. The modeling of the PWM controller was carried out on the basis of behavioral elements from the ECAD library, simulation (solution of algebra-differential equations systems with programming elements is based on SPICE algorithms. The object of the study was the simulation process of ACS with the pulse-width principle of adjusting the output value. The subject of the research are the models of PWM controllers. Originality. The new macromodel of PWM

THE ACS NEARBY GALAXY SURVEY TREASURY

International Nuclear Information System (INIS)

Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.

2009-01-01

The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

Diagnostics of the Fermilab Tevatron using an AC dipole

Energy Technology Data Exchange (ETDEWEB)

Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

2008-08-01

The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.

Science.gov (United States)

Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong

2018-05-01

Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.

On-Site Measurements for Voltage Unbalance Studies Associated with the AC Railway Operation

DEFF Research Database (Denmark)

Stamatopoulos, Athanasios; Silva, Filipe Miguel Faria da; Bak, Claus Leth

2017-01-01

unbalance with regards to traction loads has been augmented since the decision to expand the electric railway. Towards this direction, and on the occasion of a newly built electrified line, voltage unbalance measurements were carried out and are presented in this paper. The information from the extracted......On-site measurements in Electrical Power Systems can provide valuable information about the performance of the network and also, can be of great assistance to the validation and assessment of simulation models developed for power system studies. Lately, the noticeable increase of non......-conventional types of loads, such as the AC railway, has raised concerns regarding the secure operation of power transmission networks. This renders the monitoring and reporting of various aspects of system’s power quality even more necessary. For the Danish transmission grid, in particular, the relevance of voltage...

Solid-liquid transition in Nb powder determined by third harmonic susceptibility

International Nuclear Information System (INIS)

Oliveira, A.A.M.; Lisboa-Filho, P.N.; Ortiz, W.A.

2008-01-01

Measurements of the third harmonic of the AC-susceptibility were employed to determine the boundaries of the linear regime of the magnetic response of Nb powder. Non-linear contributions to the magnetic response reveal the occurrence of a structured phase, disappearing as the vortex lattice melts to the liquid state. A systematic study of the third harmonic was conducted to determine how its onset temperature depends on experimental parameters, such as the frequency and amplitude of the excitation field. The melting line (ML) has been extracted from the onset temperature measured at low-frequencies and low-excitation fields in the presence of DC magnetic fields. The study indicates that the ML can be described by a 3D vortex-glass model, except at lower fields, where the system experiences a depinning crossover, and the best description of the experimental data is provided by a 3D Bose-glass model

Solid-liquid transition in Nb powder determined by third harmonic susceptibility

Energy Technology Data Exchange (ETDEWEB)

Oliveira, A.A.M. [Grupo de Supercondutividade e Magnetismo, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil)], E-mail: ana@df.ufscar.br; Lisboa-Filho, P.N. [Laboratorio de Materiais Supercondutores, Departamento de Fisica, Universidade Estadual Paulista, Bauru, SP (Brazil); Ortiz, W.A. [Grupo de Supercondutividade e Magnetismo, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil)

2008-07-15

Measurements of the third harmonic of the AC-susceptibility were employed to determine the boundaries of the linear regime of the magnetic response of Nb powder. Non-linear contributions to the magnetic response reveal the occurrence of a structured phase, disappearing as the vortex lattice melts to the liquid state. A systematic study of the third harmonic was conducted to determine how its onset temperature depends on experimental parameters, such as the frequency and amplitude of the excitation field. The melting line (ML) has been extracted from the onset temperature measured at low-frequencies and low-excitation fields in the presence of DC magnetic fields. The study indicates that the ML can be described by a 3D vortex-glass model, except at lower fields, where the system experiences a depinning crossover, and the best description of the experimental data is provided by a 3D Bose-glass model.

Digital model for harmonic interactions in AC/DC/AC systems

Energy Technology Data Exchange (ETDEWEB)

Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

1994-12-31

The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

A fast and remote magnetonanothermometry for a liquid environment

Science.gov (United States)

He, Le; Liu, Wenzhong; Xie, Qingguo; Pi, Shiqiang; Morais, P. C.

2016-02-01

This study reports on a new approach for remote nanothermometry with short response time (milliseconds) aiming to operate in liquid media using AC susceptibility components of a suspended magnetic nanoparticle subjected to the Brownian relaxation mechanism. A simple, low cost, and accurate system was designed to measure AC susceptibility using an AC magnetic field at small amplitude (6 Oe) and frequency range (5 kHz) superimposed on a weak DC magnetic field (up to 30 Oe). A model based on the AC susceptibility of magnetic nanoparticles (30 nm average diameter) was constructed to describe the temperature measurement sensitivity of the dominated Brownian relaxation time. A new approach for remote nanothermometry was achieved with measured AC susceptibility by the designed system and the proposed model. Our experimental results show that our magnetonanothermometer allows temperature errors lower than 0.3 K with standard deviations lower than 0.1 K in the temperature range from 310 to 320 K.

A fast and remote magnetonanothermometry for a liquid environment

International Nuclear Information System (INIS)

He, Le; Xie, Qingguo; Liu, Wenzhong; Pi, Shiqiang; Morais, P C

2016-01-01

This study reports on a new approach for remote nanothermometry with short response time (milliseconds) aiming to operate in liquid media using AC susceptibility components of a suspended magnetic nanoparticle subjected to the Brownian relaxation mechanism. A simple, low cost, and accurate system was designed to measure AC susceptibility using an AC magnetic field at small amplitude (6 Oe) and frequency range (5 kHz) superimposed on a weak DC magnetic field (up to 30 Oe). A model based on the AC susceptibility of magnetic nanoparticles (30 nm average diameter) was constructed to describe the temperature measurement sensitivity of the dominated Brownian relaxation time. A new approach for remote nanothermometry was achieved with measured AC susceptibility by the designed system and the proposed model. Our experimental results show that our magnetonanothermometer allows temperature errors lower than 0.3 K with standard deviations lower than 0.1 K in the temperature range from 310 to 320 K. (paper)

Use of static and ac field techniques for measuring mobility and charge lifetimes of radon progeny with a simple device

International Nuclear Information System (INIS)

Sapra, B.K.; Mayya, Y.S.

1998-01-01

A simple device, based on a modification of the scintillation cell, has been developed for the measurement of radon daughter mobility and charge lifetimes by employing AC and static electric fields. It has a central electrode coated with ZnS and the scintillations are recorded by a PMT unit. The coating is made on the wire, instead of on the inner walls, to improve the relative response of the device with respect to the zero field situation. Radon is drawn into the cell by evacuation techniques. Theoretical formulae, relating the observed count rates to the system parameters and progeny mobilities and charge lifetimes, have been derived under zero field, static and AC field situations. Measurements indicate that the device has very low leak rate (T 1/2 ∼38 days) and the initial environment if maintained for long time. Results of experiments carried out with static and AC fields in most air yielded 218 Po mobilities (1.89 cm 2 /V/s) and charge lifetimes (0.08s) are comparable to those reported in the literature. This demonstrates the feasibility of this technique for future studies with different trace gases. A major advantage of this device as opposed to the conventional spectrometric methods is its simplicity. (author)

Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

Science.gov (United States)

Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.

2008-02-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.

Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

International Nuclear Information System (INIS)

Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C

2008-01-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability

SOD1 Gene +35A/C (exon3/intron3 Polymorphism in Type 2 Diabetes Mellitus among South Indian Population

Directory of Open Access Journals (Sweden)

K. Nithya

2016-01-01

Full Text Available Superoxide dismutase is an antioxidant enzyme that is involved in defence mechanisms against oxidative stress. Cu/Zn SOD is a variant that is located in exon3/intron3 boundary. The aim of the present study was to investigate whether the Cu/Zn SOD (+35A/C gene polymorphism is associated with the susceptibility to type 2 diabetes mellitus among south Indian population. The study included patients with type 2 diabetes mellitus (n=100 and healthy controls (n=75. DNA was isolated from the blood and genotyping of Cu/Zn SOD gene polymorphism was done by polymerase chain reaction based restriction fragment length polymorphism method. Occurrence of different genotypes and normal (A and mutant (C allele frequencies were determined. The frequency of the three genotypes of the total subjects was as follows: homozygous wild-type A/A (95%, heterozygous genotype A/C (3%, and homozygous mutant C/C (2%. The mutant (C allele and the mutant genotypes (AC/CC were found to be completely absent among the patients with type 2 diabetes mellitus. Absence of mutant genotype (CC shows that the Cu/Zn SOD gene polymorphism may not be associated with the susceptibility to type 2 diabetes mellitus among south Indian population.

Critical behavior of AC antiferromagnetic and ferromagnetic susceptibilities of a spin-1/2 metamagnetic Ising system

International Nuclear Information System (INIS)

Gulpinar, Gul; Vatansever, Erol

2012-01-01

In this study, the temperature variations of the equilibrium and the non-equilibrium antiferromagnetic and ferromagnetic susceptibilities of a metamagnetic system are examined near the critical point. The kinetic equations describing the time dependencies of the total and staggered magnetizations are derived by utilizing linear response theory. In order to obtain dynamic magnetic relaxation behavior of the system, the stationary solutions of the kinetic equations in existence of sinusoidal staggered and physical external magnetic fields are performed. In addition, the static and dynamical mean field critical exponents are calculated in order to formulate the critical behavior of antiferromagnetic and ferromagnetic magnetic response of a metamagnetic system. Finally, a comparison of the findings of this study with previous theoretical and experimental studies is represented and it is shown that a good agreement is found with our results. - Highlights: ► Staggered dynamic susceptibility diverges as T→T N in the low frequency region. ► Dynamic total susceptibility exhibits a finite jump discontinuity as T→T N while wτ 2 ⪡1. ► The slope of the staggered magnetic dispersion curve chances in sign as T→T N .

Modified thermogravimetric apparatus to measure magnetic susceptibility on-line during annealing of metastable ferromagnetic materials

International Nuclear Information System (INIS)

Luciani, G.; Constantini, A.; Branda, F.; Ausanio, G.; Hison, C.; Iannotti, V.; Luponio, C.; Lanotte, L.

2004-01-01

The insertion of proper coils to generate a magnetic field, with controlled gradient, in a standard thermogravimetric apparatus is shown to be a valid solution to measure on-line, upon heat treatment, the magnetic susceptibility in ribbon shaped samples of a metastable ferromagnetic material. The method is very useful to individuate the annealing conditions that optimise soft or hard magnetic properties without using separate apparatuses for heat treatment, control of the structural phase transition and characterization of magnetic susceptibility

Low Offset AC Correlator.

Science.gov (United States)

This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

Down-regulation of a novel ABC transporter gene (Pxwhite) is associated with Cry1Ac resistance in the diamondback moth, Plutella xylostella (L.).

Science.gov (United States)

Guo, Zhaojiang; Kang, Shi; Zhu, Xun; Xia, Jixing; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Zhang, Youjun

2015-04-01

Biopesticides or transgenic crops based on Cry toxins from the soil bacterium Bacillus thuringiensis (Bt) effectively control agricultural insect pests. The sustainable use of Bt biopesticides and Bt crops is threatened, however, by the development of Cry resistance in the target pests. The diamondback moth, Plutella xylostella (L.), is the first pest that developed resistance to a Bt biopesticide in the field, and a recent study has shown that the resistance of P. xylostella to Cry1Ac is caused by a mutation in an ATP-binding cassette (ABC) transporter gene (ABCC2). In this study, we report that down-regulation of a novel ABC transporter gene from ABCG subfamily (Pxwhite) is associated with Cry1Ac resistance in P. xylostella. The full-length cDNA sequence of Pxwhite was cloned and analyzed. Spatial-temporal expression detection revealed that Pxwhite was expressed in all tissues and developmental stages, and highest expressed in Malpighian tubule tissue and in egg stage. Sequence variation analysis of Pxwhite indicated the absence of constant non-synonymous mutations between susceptible and resistant strains, whereas midgut transcript analysis showed that Pxwhite was remarkably reduced in all resistant strains and further reduced when larvae of the moderately resistant SZ-R strain were subjected to selection with Cry1Ac toxin. Furthermore, RNA interference (RNAi)-mediated suppression of Pxwhite gene expression significantly reduced larval susceptibility to Cry1Ac toxin, and genetic linkage analysis confirmed that down-regulation of Pxwhite gene is tightly linked to Cry1Ac resistance in P. xylostella. To our knowledge, this is the first report indicating that Pxwhite gene is involved in Cry1Ac resistance in P. xylostella. Copyright © 2015 Elsevier Ltd. All rights reserved.

AC power supply systems

International Nuclear Information System (INIS)

Law, H.

1987-01-01

An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

Field evolved resistance in Helicoverpa armigera (Lepidoptera: Noctuidae to Bacillus thuringiensis toxin Cry1Ac in Pakistan.

Directory of Open Access Journals (Sweden)

Anwaar H K Alvi

Full Text Available Helicoverpa armigera (Hübner is one of the most destructive pests of several field and vegetable crops, with indiscriminate use of insecticides contributing to multiple instances of resistance. In the present study we assessed whether H. armigera had developed resistance to Bt cotton and compared the results with several conventional insecticides. Furthermore, the genetics of resistance was also investigated to determine the inheritance to Cry1Ac resistance. To investigate the development of resistance to Bt cotton, and selected foliar insecticides, H. armigera populations were sampled in 2010 and 2011 in several cotton production regions in Pakistan. The resistance ratios (RR for Cry1Ac, chlorpyrifos, profenofos, cypermethrin, spinosad, indoxacarb, abamectin and deltamethrin were 580-fold, 320-, 1110-, 1950-, 200-, 380, 690, and 40-fold, respectively, compared with the laboratory susceptible (Lab-PK population. Selection of the field collected population with Cry1Ac in 2010 for five generations increased RR to 5440-fold. The selection also increased RR for deltamethrin, chlorpyrifos, profenofos, cypermethrin, spinosad, indoxacarb, abamectin to 125-folds, 650-, 2840-, 9830-, 370-, 3090-, 1330-fold. The estimated LC(50s for reciprocal crosses were 105 µg/ml (Cry1Ac-SEL female × Lab-PK male and 81 g µg/ml (Lab-PK female × Cry1Ac-SEL male suggesting that the resistance to Cry1Ac was autosomal; the degree of dominance (D(LC was 0.60 and 0.57 respectively. Mixing of enzyme inhibitors significantly decreased resistance to Cry1Ac suggesting that the resistance to Cry1Ac and other insecticides tested in the present study was primarily metabolic. Resistance to Cry1Ac was probably due to a single but unstable factor suggesting that crop rotation with non-Bt cotton or other crops could reduce the selection pressure for H. armigera and improve the sustainability of Bt cotton.

Statistical time lags in ac discharges

International Nuclear Information System (INIS)

Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F

2011-01-01

The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

Statistical time lags in ac discharges

Energy Technology Data Exchange (ETDEWEB)

Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)

2011-04-06

The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte

International Nuclear Information System (INIS)

García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.

2016-01-01

The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.

DC and AC biasing of a transition edge sensor microcalorimeter

International Nuclear Information System (INIS)

Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.

2002-01-01

We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

ACS Photometric Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2003-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

Susceptibility investigation of the nanoparticle coating-layer effect on the particle interaction in biocompatible magnetic fluids

International Nuclear Information System (INIS)

Morais, P.C.; Santos, J.G.; Silveira, L.B.; Gansau, C.; Buske, N.; Nunes, W.C.; Sinnecker, J.P.

2004-01-01

AC susceptibility was used to investigate the effect of the surface-coating layer in two biocompatible, magnetite-based, magnetic fluid samples. Dextran and dimercaptosuccinic acid (DMSA) were the surface coating species. The temperature and frequency dependence of the peak susceptibility was discussed using the Vogel-Fulcher relation, from which the typical energy barrier (temperature correction) values of 1340±20 K (70±3 K) and 1230±30 K (86±5 K) were obtained for the dextran- and DMSA-coated nanoparticles, respectively

Magnetic measurements under pressure

Czech Academy of Sciences Publication Activity Database

Zentková, M.; Arnold, Zdeněk; Mihalik, M.; Mihalik, M.; Zentko, A.; Kamarád, Jiří; Mitróová, Z.; Mat`aš, S.

2006-01-01

Roč. 57, 8/S (2006), s. 29-32 ISSN 1335-3632 Institutional research plan: CEZ:AV0Z10100521 Keywords : hydrostatic pressure * Prussian blue analogues * AC susceptibility * intermetallic compound * ferromagnetism * errimagnetism Subject RIV: BM - Solid Matter Physics ; Magnetism

Low frequency ac conduction and dielectric relaxation in poly(N ...

Indian Academy of Sciences (India)

The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

Magnetic susceptibility correlation of km-thick Eifelian–Frasnian sections (Ardennes and Moravia)

Czech Academy of Sciences Publication Activity Database

Boulvain, F.; da Silva, A.C.; Mabille, C.; Hladil, Jindřich; Geršl, M.; Koptíková, Leona; Schnabl, Petr

2010-01-01

Roč. 13, č. 4 (2010), s. 309-318 ISSN 1374-8505 R&D Projects: GA AV ČR IAA300130702; GA AV ČR IAAX00130702 Institutional research plan: CEZ:AV0Z30130516 Keywords : Devonian limestone * magnetic susceptibility * Moravian Karst * Ardennes Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.645, year: 2010 http://popups.ulg.ac.be/Geol/docannexe.php?id=3181

AC characterization of bulk organic solar cell in the dark and under illumination

International Nuclear Information System (INIS)

Váry, Michal; Perný, Milan; Šály, Vladimír; Packa, Juraj

2014-01-01

Highlights: • A study of organic bulk photovoltaic (PV) solar cell. • Current–voltage characteristics in the dark and under illumination. • AC measurements, both under illumination and in the dark conditions. • Equivalent AC circuit. • Effective lifetime assigned with electron–hole recombination and diffusion time of the electron was estimated. - Abstract: Impedance spectroscopy has been used widely to evaluate the transport processes in photovoltaic, mainly based on inorganic semiconductors, structures – solar cells. The aim of this research was to characterize improved organic bulk photovoltaic (PV) solar cells exploiting this method. Progress in technology of investigated organic solar cell involves the use of an active layer based on low band gap type of polymer. The organic PV cell with front transparent electrode and rear metal electrode and active layer produced by Konarka Technologies was analyzed by electrical DC and AC measurements. Current–voltage (I–V) characteristics in the dark and under illumination were measured and basic PV parameters were calculated. AC measurements, both under illumination and in the dark conditions, were processed in order to identify electronic behavior using equivalent AC circuit which was suggested by fitting of measured impedance data. Circuit with the best correlation to measured data is analyzed in details. Voltage and frequency dependences of fitted equivalent circuit components and calculated parameters are explained and presented in the paper

Susceptibility-Weighted Imaging and Quantitative Susceptibility Mapping in the Brain

Science.gov (United States)

Liu, Chunlei; Li, Wei; Tong, Karen A.; Yeom, Kristen W.; Kuzminski, Samuel

2015-01-01

Susceptibility-weighted imaging (SWI) is a magnetic resonance imaging (MRI) technique that enhances image contrast by using the susceptibility differences between tissues. It is created by combining both magnitude and phase in the gradient echo data. SWI is sensitive to both paramagnetic and diamagnetic substances which generate different phase shift in MRI data. SWI images can be displayed as a minimum intensity projection that provides high resolution delineation of the cerebral venous architecture, a feature that is not available in other MRI techniques. As such, SWI has been widely applied to diagnose various venous abnormalities. SWI is especially sensitive to deoxygenated blood and intracranial mineral deposition and, for that reason, has been applied to image various pathologies including intracranial hemorrhage, traumatic brain injury, stroke, neoplasm, and multiple sclerosis. SWI, however, does not provide quantitative measures of magnetic susceptibility. This limitation is currently being addressed with the development of quantitative susceptibility mapping (QSM) and susceptibility tensor imaging (STI). While QSM treats susceptibility as isotropic, STI treats susceptibility as generally anisotropic characterized by a tensor quantity. This article reviews the basic principles of SWI, its clinical and research applications, the mechanisms governing brain susceptibility properties, and its practical implementation, with a focus on brain imaging. PMID:25270052

Susceptibility-weighted imaging and quantitative susceptibility mapping in the brain.

Science.gov (United States)

Liu, Chunlei; Li, Wei; Tong, Karen A; Yeom, Kristen W; Kuzminski, Samuel

2015-07-01

Susceptibility-weighted imaging (SWI) is a magnetic resonance imaging (MRI) technique that enhances image contrast by using the susceptibility differences between tissues. It is created by combining both magnitude and phase in the gradient echo data. SWI is sensitive to both paramagnetic and diamagnetic substances which generate different phase shift in MRI data. SWI images can be displayed as a minimum intensity projection that provides high resolution delineation of the cerebral venous architecture, a feature that is not available in other MRI techniques. As such, SWI has been widely applied to diagnose various venous abnormalities. SWI is especially sensitive to deoxygenated blood and intracranial mineral deposition and, for that reason, has been applied to image various pathologies including intracranial hemorrhage, traumatic brain injury, stroke, neoplasm, and multiple sclerosis. SWI, however, does not provide quantitative measures of magnetic susceptibility. This limitation is currently being addressed with the development of quantitative susceptibility mapping (QSM) and susceptibility tensor imaging (STI). While QSM treats susceptibility as isotropic, STI treats susceptibility as generally anisotropic characterized by a tensor quantity. This article reviews the basic principles of SWI, its clinical and research applications, the mechanisms governing brain susceptibility properties, and its practical implementation, with a focus on brain imaging. © 2014 Wiley Periodicals, Inc.

AC-loss considerations of a pulse SMES for an accelerator

International Nuclear Information System (INIS)

Lyly, M; Hiltunen, I; Jaervelae, J; Korpela, A; Lehti, L; Stenvall, A; Mikkonen, R

2010-01-01

In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.

AcEST: DK959154 [AcEST

Lifescience Database Archive (English)

Full Text Available fadin OS=Rattus norvegicus GN=Mllt4 PE=1 SV=1 33 0.57 sp|Q80ZC9|PS1C2_MOUSE Psoriasis susceptibility 1 candi...APPPPPQRNASYLKTQVLSPDSLF 1731 >sp|Q80ZC9|PS1C2_MOUSE Psoriasis susceptibility 1 candidate gene 2 protein hom

FLUIDIC AC AMPLIFIERS.

Science.gov (United States)

Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

Experimentally measured susceptibility to peer influence and adolescent sexual behavior trajectories : A preliminary study

NARCIS (Netherlands)

Choukas-Bradley, S.; Giletta, M.; Widman, L.; Cohen, G.L.; Prinstein, M.J.

2014-01-01

A performance-based measure of peer influence susceptibility was examined as a moderator of the longitudinal association between peer norms and trajectories of adolescents' number of sexual intercourse partners. Seventy-one 9th grade adolescents (52% female) participated in an experimental "chat

78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

Science.gov (United States)

2013-08-13

...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

Magnetic susceptibility measurement of solid oxygen at pressures up to 3.3 GPa

Energy Technology Data Exchange (ETDEWEB)

Mito, M., E-mail: mitoh@tobata.isc.kyutech.ac.jp; Yamaguchi, S.; Tsuruda, H.; Deguchi, H. [Faculty of Engineering, Kyushu Institute of Technology, Kitakyushu 804-8550 (Japan); Ishizuka, M. [Renovation Center of Instruments for Science Education and Technology, Osaka University, Toyonaka 560-8531 (Japan)

2014-01-07

The magnetic susceptibility of solid oxygen had long been observed only in the restricted pressure region below 0.8 GPa. We succeeded in extending the pressure region up to 3.3 GPa by clamping condensed oxygen in the sample chamber of a miniature diamond anvil cell and measuring the dc magnetic susceptibility using a superconducting quantum interference device magnetometer. In this experiment, the well-known α–β and β–γ transitions are observed in the phase diagram, suggesting consistency with the previous results of X-ray and Raman studies. In addition, a new magnetic anomaly is observed in the β phase.

The correlation between superparamagnetic blocking temperatures and peak temperatures obtained from ac magnetization measurements

International Nuclear Information System (INIS)

Madsen, Daniel Esmarch; Moerup, Steen; Hansen, Mikkel Fougt

2008-01-01

We study the correlation between the superparamagnetic blocking temperature T B and the peak positions T p observed in ac magnetization measurements for nanoparticles of different classes of magnetic materials. In general, T p = α+βT B . The parameters α and β are different for the in-phase (χ') and out-of-phase (χ'') components and depend on the width σ V of the log-normal volume distribution and the class of magnetic material (ferromagnetic/antiferromagnetic). Consequently, knowledge of both α and β is required if the anisotropy energy barrier KV and the attempt time τ 0 are to be reliably obtained from an analysis based solely on the peak positions

Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

International Nuclear Information System (INIS)

Fang Minggang; Nie, Yingchao; Theilmann, David A.

2009-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

Development of a hardware-based AC microgrid for AC stability assessment

Science.gov (United States)

Swanson, Robert R.

As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

Experimentally Measured Susceptibility to Peer Influence and Adolescent Sexual Behavior Trajectories: A Preliminary Study

Science.gov (United States)

Choukas-Bradley, Sophia; Giletta, Matteo; Widman, Laura; Cohen, Geoffrey L.; Prinstein, Mitchell J.

2014-01-01

A performance-based measure of peer influence susceptibility was examined as a moderator of the longitudinal association between peer norms and trajectories of adolescents' number of sexual intercourse partners. Seventy-one 9th grade adolescents (52% female) participated in an experimental "chat room" paradigm involving…

Changes in stimulus and response AC/A ratio with vision therapy in Convergence Insufficiency.

Science.gov (United States)

Singh, Neeraj Kumar; Mani, Revathy; Hussaindeen, Jameel Rizwana

To evaluate the changes in the stimulus and response Accommodative Convergence to Accommodation (AC/A) ratio following vision therapy (VT) in Convergence Insufficiency (CI). Stimulus and response AC/A ratio were measured on twenty five CI participants, pre and post 10 sessions of VT. Stimulus AC/A ratio was measured using the gradient method and response AC/A ratio was calculated using modified Thorington technique with accommodative responses measured using WAM-5500 open-field autorefractor. The gradient stimulus and response AC/A cross-link ratios were compared with thirty age matched controls. Mean age of the CI and control participants were 23.3±5.2 years and 22.7±4.2 years, respectively. The mean stimulus and response AC/A ratio for CI pre therapy was 2.2±0.72 and 6.3±2.0 PD/D that changed to 4.2±0.9 and 8.28±3.31 PD/D respectively post vision therapy and these changes were statistically significant (paired t-test; paccommodation parameters in subjects with convergence insufficiency. This represents the plasticity of the AC/A crosslink ratios that could be achieved with vision therapy in CI. Copyright © 2016 Spanish General Council of Optometry. Published by Elsevier España, S.L.U. All rights reserved.

AC losses of single-core MgB{sub 2} wires with different metallic sheaths

Energy Technology Data Exchange (ETDEWEB)

Kováč, J., E-mail: elekjkov@savba.sk; Šouc, J.; Kováč, P.; Hušek, I.

2015-12-15

Highlights: • AC losses in single-core MgB{sub 2} wires with different metallic sheaths have been measured. • It has been shown that metallic sheath can affect the measured AC loss considerably. • GlidCop and Stainless Steel have negligible effect to the overall loss. • Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. • Due to Monel sheath AC loss of MgB{sub 2} core is not visible. - Abstract: AC losses of single-core MgB{sub 2} superconductors with different metallic sheaths (Cu, GlidCop, stainless steel and Monel) have been measured and analyzed. These wires were exposed to external magnetic field with frequencies 72 and 144 Hz and amplitudes up to 0.1 T at temperatures ranged from 18 to 40 K. The obtained results have shown that applied metallic sheath can affect the measured AC loss considerably. In the case of GlidCop and Stainless Steel a negligible small effect of metallic sheath was observed. Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. In the case of Monel sheath, the hysteresis loss of magnetic sheath is dominated and AC loss of MgB{sub 2} core is practically not visible.

Population dynamics of Sesamia inferens on transgenic rice expressing Cry1Ac and CpTI in southern China.

Science.gov (United States)

Han, Lanzhi; Liu, Peilei; Wu, Kongming; Peng, Yufa; Wang, Feng

2008-10-01

Genetically modified insect-resistant rice lines containing the cry1Ac gene from Bacillus thuringiensis (Bt) or the CpTI (cowpea trypsin inhibitor) gene developed for the management of lepidopterous pests are highly resistant to the major target pests, Chilo suppressalis (Walker), Cnaphalocrocis medinalis (Guenée), and Scirpophaga incertulas (Walker), in the main rice-growing areas of China. However, the effects of these transgenic lines on Sesamia inferens (Walker), an important lepidopterous rice pest, are currently unknown. Because different insect species have varying susceptibility to Bt insecticidal proteins that may affect population dynamics, research into the effects of these transgenic rice lines on the population dynamics of S. inferens was conducted in Fuzhou, southern China, in 2005 and 2006. The results of laboratory, field cage, and field plot experiments show that S. inferens has comparatively high susceptibility to the transgenic line during the early growing season, with significant differences observed in larval density and infestation levels between transgenic and control lines. Because of a decrease in Cry1Ac levels in the plant as it ages, the transgenic line provided only a low potential for population suppression late in the growing season. There is a correlation between the changing expression of Cry1Ac and the impact of transgenic rice on the population dynamics of S. inferens during the season. These results indicate that S. inferens may become a major pest in fields of prospective commercially released transgenic rice, and more attention should be paid to developing an effective alternative management strategy.

Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

Science.gov (United States)

Luczak, Susan E; Rosen, I Gary

2014-08-01

Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

International Nuclear Information System (INIS)

Guerra, A.S.; Laitano, R.F.; Petrocchi, A.

1997-01-01

An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

Energy Technology Data Exchange (ETDEWEB)

Guerra, A S; Laitano, R F; Petrocchi, A [Ist. Nazionale di Metrologia delle Radiazioni Ionizzanti, ENEA, Roma (Italy)

1997-09-01

An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

Cosmic shear analysis of archival HST/ACS data. I. Comparison of early ACS pure parallel data to the HST/GEMS survey

Science.gov (United States)

Schrabback, T.; Erben, T.; Simon, P.; Miralles, J.-M.; Schneider, P.; Heymans, C.; Eifler, T.; Fosbury, R. A. E.; Freudling, W.; Hetterscheidt, M.; Hildebrandt, H.; Pirzkal, N.

2007-06-01

Context: This is the first paper of a series describing our measurement of weak lensing by large-scale structure, also termed “cosmic shear”, using archival observations from the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope (HST). Aims: In this work we present results from a pilot study testing the capabilities of the ACS for cosmic shear measurements with early parallel observations and presenting a re-analysis of HST/ACS data from the GEMS survey and the GOODS observations of the Chandra Deep Field South (CDFS). Methods: We describe the data reduction and, in particular, a new correction scheme for the time-dependent ACS point-spread-function (PSF) based on observations of stellar fields. This is currently the only technique which takes the full time variation of the PSF between individual ACS exposures into account. We estimate that our PSF correction scheme reduces the systematic contribution to the shear correlation functions due to PSF distortions to MUSIC sample, we determine a local single field estimate for the mass power spectrum normalisation σ8, CDFS=0.52+0.11-0.15 (stat) ± 0.07(sys) (68% confidence assuming Gaussian cosmic variance) at a fixed matter density Ω_m=0.3 for a ΛCDM cosmology marginalising over the uncertainty of the Hubble parameter and the redshift distribution. We interpret this exceptionally low estimate to be due to a local under-density of the foreground structures in the CDFS. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archives at the Space Telescope European Coordinating Facility and the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.

Mg shallow doping effects on the ac magnetic self-heating characteristics of γ-Fe2O3 superparamagnetic nanoparticles for highly efficient hyperthermia

Science.gov (United States)

Jang, Jung-tak; Bae, Seongtae

2017-10-01

The effects of Mg doping on the magnetic and AC self-heating temperature rising characteristics of γ-Fe2O3 superparamagnetic nanoparticles (SPNPs) were investigated for hyperthermia applications in biomedicine. The doping concentration of nonmagnetic Mg2+ cation was systematically controlled from 0 to 0.15 at. % in Mgx-γFe2O3 SPNPs during chemically and thermally modified one-pot thermal decomposition synthesis under bubbling O2/Ar gas mixture. It was empirically observed that the saturation magnetization (Ms) and the out-of-phase magnetic susceptibility ( χm″)of Mgx-γFe2O3 SPNPs were increased by increasing the Mg2+ cation doping concentration from 0.05 to 0.13 at. %. Correspondingly, the AC magnetically induced self-heating temperature (Tac,max) in solid state and the intrinsic loss power in water were increased up to 184 °C and 14.2 nH m2 kg-1 (Mgx-γFe2O3, x = 0.13), respectively, at the biologically and physiologically safe range of AC magnetic field (Happl × fappl = 1.2 × 109 A m-1 s-1). All the chemically and physically analyzed results confirmed that the dramatically improved AC magnetic induction heating characteristics and the magnetic properties of Mgx-γFe2O3 SPNPs (x = 0.13) are primarily due to the significantly enhanced magnetic susceptibility (particularly, χm″) and the improved AC/DC magnetic softness (lower AC/DC magnetic anisotropy) resulting from the systematically controlled nonmagnetic Mg2+ cation concentrations and distributions (occupation ratio) in the Fe vacancy sites of γ-Fe2O3 (approximately 12% vacancy), instead of typically well-known Fe3O4 (no vacancy) SPNPs. The cell viability and biocompatibility with U87 MG cell lines demonstrated that Mgx-γFe2O3 SPNPs (x = 0.13) has promising bio-feasibility for hyperthermia agent applications.

AcEST: DK951349 [AcEST

Lifescience Database Archive (English)

Full Text Available Forkhead box protein J3 OS=Mus musculus GN... 33 1.5 sp|Q9UIG4|PS1C2_HUMAN Psoriasis...se kinase kin... 32 2.6 sp|Q7YR45|PS1C2_PANTR Psoriasis susceptibility 1 candidat...PQQHSQLQPPHSQHPPPHQH 424 >sp|Q9UIG4|PS1C2_HUMAN Psoriasis susceptibility 1 candidate gene 2 protein OS=Homo

The Use of AC-DC-AC Methods in Assessing Corrosion Resistance Performance of Coating Systems for Magnesium Alloys

Science.gov (United States)

McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante

The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.

Unusual polarity-dependent patterns in a bent-core nematic liquid crystal under low-frequency ac field.

Science.gov (United States)

Xiang, Ying; Zhou, Meng-jie; Xu, Ming-Ya; Salamon, Péter; Éber, Nándor; Buka, Ágnes

2015-04-01

Electric-field-induced patterns of diverse morphology have been observed over a wide frequency range in a recently synthesized bent-core nematic (BCN) liquid crystal. At low frequencies (up to ∼25 Hz), the BCN exhibited unusual polarity-dependent patterns. When the amplitude of the ac field was enhanced, these two time-asymmetrical patterns turned into time-symmetrical prewavylike stripes. At ac frequencies in the middle-frequency range (∼50-3000 Hz), zigzag patterns were detected whose obliqueness varied with the frequency. Finally, if the frequency was increased above 3 kHz, the zigzag pattern was replaced by another, prewavylike pattern, whose threshold voltage depended on the frequency; however, the wave vector did not. For a more complete characterization, material parameters such as elastic constants, dielectric permittivities, and the anisotropy of the diamagnetic susceptibility were also determined.

Introducing AC Inductive Reactance with a Power Tool

Science.gov (United States)

Bryant, Wesley; Baker, Blane

2016-01-01

The concept of reactance in AC electrical circuits is often non-intuitive and difficult for students to grasp. In order to address this lack of conceptual understanding, classroom exercises compare the predicted resistance of a power tool, based on electrical specifications, to measured resistance. Once students discover that measured resistance…

RHIC spin flipper AC dipole controller

Energy Technology Data Exchange (ETDEWEB)

Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

2011-03-28

The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

a.c. conductance study of polycrystal C60

International Nuclear Information System (INIS)

Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin

1995-01-01

The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))

Introduction to electronic relaxation in solids: mechanisms and measuring techniques

International Nuclear Information System (INIS)

Bonville, P.

1983-01-01

The fluctuations of electronic magnetic moments in solids may be investigated by several techniques, either electronic or nuclear. This paper is an introduction of the most frequently encountered paramagnetic relaxation mechanisms (phonons, conduction electrons, exchange or dipolar interactions) in condensed matter, and to the different techniques used for measuring relaxation frequencies: electronic paramagnetic resonance, nuclear magnetic resonance, Moessbauer spectroscopy, inelastic neutron scattering, measurement of longitudinal ac susceptibility and γ-γ perturbed angular correlations. We mainly focus our attention on individual ionic fluctuation spectra, the majority of the experimental work refered to concerning rare earth systems [fr

Computer soundcard as an AC signal generator and oscilloscope for the physics laboratory

Science.gov (United States)

Sinlapanuntakul, Jinda; Kijamnajsuk, Puchong; Jetjamnong, Chanthawut; Chotikaprakhan, Sutharat

2018-01-01

The purpose of this paper is to develop both an AC signal generator and a dual-channel oscilloscope based on standard personal computer equipped with sound card as parts of the laboratory of the fundamental physics and the introduction to electronics classes. The setup turns the computer into the two channel measured device which can provides sample rate, simultaneous sampling, frequency range, filters and others essential capabilities required to perform amplitude, phase and frequency measurements of AC signal. The AC signal also generate from the same computer sound card output simultaneously in any waveform such as sine, square, triangle, saw-toothed pulsed, swept sine and white noise etc. These can convert an inexpensive PC sound card into powerful device, which allows the students to measure physical phenomena with their own PCs either at home or at university attendance. A graphic user interface software was developed for control and analysis, including facilities for data recording, signal processing and real time measurement display. The result is expanded utility of self-learning for the students in the field of electronics both AC and DC circuits, including the sound and vibration experiments.

High-frequency, transient magnetic susceptibility of ferroelectrics

Science.gov (United States)

Grimes, Craig A.

1996-10-01

A significant high-frequency magnetic susceptibility was measured both in weakly polarized and nonpolarized samples of barium titanate, lead zirconate titanate, and carnauba wax. Magnetic susceptibility measurements were made from 10 to 500 MHz using a thin film permeameter at room temperature; initial susceptibilities ranged from 0.1 to 2.5. These values are larger than expected for paramagnets and smaller than expected for ferromagnets. It was found that the magnetic susceptibility decreases rapidly with exposure to the exciting field. The origin of the magnetic susceptibility is thought to originate with the applied time varying electric field associated with the susceptibility measurements. An electric field acts to rotate an electric dipole, creating a magnetic quadrupole if the two moments are balanced, and a net magnetic dipole moment if imbalanced. It is thought that local electrostatic fields created at ferroelectric domain discontinuities associated with grain boundaries create an imbalance in the anion rotation that results in a net, measurable, magnetic moment. The origin of the magnetic aftereffect may be due to the local heating of the material through the moving charges associated with the magnetic moment.

New measurement technique of ductility curve for ductility-dip cracking susceptibility in Alloy 690 welds

Energy Technology Data Exchange (ETDEWEB)

Kadoi, Kota, E-mail: kadoi@hiroshima-u.ac.jp [Graduate School of Engineering, Hiroshima University, 1-4-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8527 (Japan); Uegaki, Takanori; Shinozaki, Kenji; Yamamoto, Motomichi [Graduate School of Engineering, Hiroshima University, 1-4-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8527 (Japan)

2016-08-30

The coupling of a hot tensile test with a novel in situ observation technique using a high-speed camera was investigated as a high-accuracy quantitative evaluation method for ductility-dip cracking (DDC) susceptibility. Several types of Alloy 690 filler wire were tested in this study owing to its susceptibility to DDC. The developed test method was used to directly measure the critical strain for DDC and high temperature ductility curves with a gauge length of 0.5 mm. Minimum critical strains of 1.3%, 4.0%, and 3.9% were obtained for ERNiCrFe-7, ERNiCrFe-13, and ERNiCrFe-15, respectively. The DDC susceptibilities of ERNiCrFe-13 and ERNiCrFe-15 were nearly the same and quite low compared with that of ERNiCrFe-7. This was likely caused by the tortuosity of the grain boundaries arising from the niobium content of around 2.5% in the former samples. Besides, ERNiCrFe-13 and ERNiCrFe-15 indicated higher minimum critical strains even though these specimens include higher content of sulfur and phosphorus than ERNiCrFe-7. Thus, containing niobium must be more effective to improve the susceptibility compared to sulfur and phosphorous in the alloy system.

New measurement technique of ductility curve for ductility-dip cracking susceptibility in Alloy 690 welds

International Nuclear Information System (INIS)

Kadoi, Kota; Uegaki, Takanori; Shinozaki, Kenji; Yamamoto, Motomichi

2016-01-01

The coupling of a hot tensile test with a novel in situ observation technique using a high-speed camera was investigated as a high-accuracy quantitative evaluation method for ductility-dip cracking (DDC) susceptibility. Several types of Alloy 690 filler wire were tested in this study owing to its susceptibility to DDC. The developed test method was used to directly measure the critical strain for DDC and high temperature ductility curves with a gauge length of 0.5 mm. Minimum critical strains of 1.3%, 4.0%, and 3.9% were obtained for ERNiCrFe-7, ERNiCrFe-13, and ERNiCrFe-15, respectively. The DDC susceptibilities of ERNiCrFe-13 and ERNiCrFe-15 were nearly the same and quite low compared with that of ERNiCrFe-7. This was likely caused by the tortuosity of the grain boundaries arising from the niobium content of around 2.5% in the former samples. Besides, ERNiCrFe-13 and ERNiCrFe-15 indicated higher minimum critical strains even though these specimens include higher content of sulfur and phosphorus than ERNiCrFe-7. Thus, containing niobium must be more effective to improve the susceptibility compared to sulfur and phosphorous in the alloy system.

Monolithic blue LED series arrays for high-voltage AC operation

Energy Technology Data Exchange (ETDEWEB)

Ao, Jin-Ping [Satellite Venture Business Laboratory, University of Tokushima, Tokushima 770-8506 (Japan); Sato, Hisao; Mizobuchi, Takashi; Morioka, Kenji; Kawano, Shunsuke; Muramoto, Yoshihiko; Sato, Daisuke; Sakai, Shiro [Nitride Semiconductor Co. Ltd., Naruto, Tokushima 771-0360 (Japan); Lee, Young-Bae; Ohno, Yasuo [Department of Electrical and Electronic Engineering, University of Tokushima, Tokushima 770-8506 (Japan)

2002-12-16

Design and fabrication of monolithic blue LED series arrays that can be operated under high ac voltage are described. Several LEDs, such as 3, 7, and 20, are connected in series and in parallel to meet ac operation. The chip size of a single device is 150 {mu}m x 120 {mu}m and the total size is 1.1 mm x 1 mm for a 40(20+20) LED array. Deep dry etching was performed as device isolation. Two-layer interconnection and air bridge are utilized to connect the devices in an array. The monolithic series array exhibit the expected operation function under dc and ac bias. The output power and forward voltage are almost proportional to LED numbers connected in series. On-wafer measurement shows that the output power is 40 mW for 40(20+20) LED array under ac 72 V. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

Increased long-flight activity triggered in beet armyworm by larval feeding on diet containing Cry1Ac protoxin.

Directory of Open Access Journals (Sweden)

Xing Fu Jiang

Full Text Available Evaluating ecological safety and conducting pest risk analysis for transgenic crops are vitally important before their commercial planting. The beet armyworm, Spodoptera exigua, a long-distance migratory insect pest, is not a direct target of transgenic Cry1Ac-expressing cotton in China, but nevertheless it has recently become an important pest. Migrants leaving their natal field arrive in other appropriate habitat far away in a short time, often followed by larval outbreaks. S. exigua has low susceptibility to Cry1Ac. However, our results from laboratory experiments identified (i sublethal effects of Cry1Ac protoxin on larval development rate, larval and pupal weight, and adult lifetime fecundity, and (ii increased long-flight behavior triggered by Cry1Ac which may contribute to larval outbreaks elsewhere. No significant differences in larval mortality, pupation rate, adult emergence rate, longevity, pre-oviposition period, or oviposition period were observed between controls and larvae fed on artificial diet incorporating a low concentration of Cry1Ac protoxin. The negative sublethal effects on some developmental and reproductive traits and lack of effect on others suggest they do not contribute to the observed severity of S. exigua outbreaks after feeding on Cry1Ac cotton. Interestingly, the percentage of long fliers increased significantly when larvae were reared on diet containing either of two low-dose treatments of Cry1Ac, suggesting a possible increased propensity to disperse long distances triggered by Cry1Ac. We hypothesize that negative effects on development and reproduction caused by Cry1Ac in the diet are offset by increased flight propensity triggered by the poor food conditions, thereby improving the chances of escaping adverse local conditions before oviposition. Increased long-flight propensity in turn may amplify the area damaged by outbreak populations. This phenomenon might be common in other migratory insect pests receiving

Magnetic susceptibility measurement using 3D NMR

Czech Academy of Sciences Publication Activity Database

Marcon, P.; Bartušek, Karel; Kořínek, Radim

2011-01-01

Roč. 24, Suppl. 1 (2011), s. 381-382 ISSN 0968-5243. [ESMRMB 2011 Congress. 06.10.2011-08.10.2011, Leipzig] R&D Projects: GA ČR GAP102/11/0318 Institutional research plan: CEZ:AV0Z20650511 Keywords : MRI * artifact correction * magnetic susceptibility * gradient echo Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

The AC photovoltaic module is here!

Science.gov (United States)

Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

1997-02-01

This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

Single amino acid insertions in extracellular loop 2 of Bombyx mori ABCC2 disrupt its receptor function for Bacillus thuringiensis Cry1Ab and Cry1Ac but not Cry1Aa toxins.

Science.gov (United States)

Tanaka, Shiho; Miyamoto, Kazuhisa; Noda, Hiroaki; Endo, Haruka; Kikuta, Shingo; Sato, Ryoichi

2016-04-01

In a previous report, seven Cry1Ab-resistant strains were identified in the silkworm, Bombyx mori; these strains were shown to have a tyrosine insertion at position 234 in extracellular loop 2 of the ABC transporter C2 (BmABCC2). This insertion was confirmed to destroy the receptor function of BmABCC2 and confer the strains resistance against Cry1Ab and Cry1Ac. However, these strains were susceptible to Cry1Aa. In this report, we examined the mechanisms of the loss of receptor function of the transporter by expressing mutations in Sf9 cells. After replacement of one or two of the five amino acid residues in loop 2 of the susceptible BmABCC2 gene [BmABCC2_S] with alanine, cells still showed susceptibility, retaining the receptor function. Five mutants with single amino acid insertions at position 234 in BmABCC2 were also generated, resulting in loop 2 having six amino acids, which corresponds to replacing the tyrosine insertion in the resistant BmABCC2 gene [BmABCC2_R(+(234)Y)] with another amino acid. All five mutants exhibited loss of function against Cry1Ab and Cry1Ac. These results suggest that the amino acid sequence in loop 2 is less important than the loop size (five vs. six amino acids) or loop structure for Cry1Ab and Cry1Ac activity. Several domain-swapped mutant toxins were then generated among Cry1Aa, Cry1Ab, and Cry1Ac, which are composed of three domains. Swapped mutants containing domain II of Cry1Ab or Cry1Ac did not kill Sf9 cells expressing BmABCC2_R(+(234)Y), suggesting that domain II of the Cry toxin is related to the interaction with the receptor function of BmABCC2. This also suggests that different reactions against Bt-toxins in some B. mori strains, that is, Cry1Ab resistance or Cry1Aa susceptibility, are attributable to structural differences in domain II of Cry1A toxins. Copyright © 2016. Published by Elsevier Inc.

Measurement of complex RF susceptibility using a series Q-meter

International Nuclear Information System (INIS)

Kisselev, Yu.F.; Dulya, C.M.; Niinikoski, T.O.

1995-01-01

In this paper we have for the first time derived closed form expressions for the nuclear magnetic susceptibility in terms of the series Q-meter output voltage. We discuss the corrections involved in determining nuclear polarization from NMR signals by using the deuteron and proton spin systems as examples. Deuteron signals are shown to exhibit a false asymmetry, while proton signals have substantial shape distortions. Moreover, for the first time the importance of making a phase correction is demonstrated. We conclude that the series Q-meter with real part detection is not sufficient to produce an output voltage from which the nuclear susceptibility can be determined. An additional phase-sensitive detector is proposed for obtaining the imaginary part of the signal required for unambiguous extraction of the complex RF susceptibility. ((orig.))

Composite Cu/Fe/MgB{sub 2} superconducting wires and MgB{sub 2}/YSZ/Hastelloy coated conductors for ac and dc applications

Energy Technology Data Exchange (ETDEWEB)

Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Majoros, M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, Madingley Road, Cambridge (United Kingdom); Vickers, M [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Eisterer, M [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Toenies, S [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Weber, H W [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Fukutomi, M [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Komori, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Togano, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan)

2003-02-01

We discuss the results of a study of MgB{sub 2} multifilamentary conductors and coated conductors from the point of view of their future dc and ac applications. The correlation between the slope of the irreversibility line induced by neutron irradiation defects and in situ structural imperfections and the critical temperature and critical current density is discussed with respect to the conductor performance and applicability. We debate the possible origin of the observed anomalous decrease of ac susceptibility at 50 K in copper clad in situ powder-in-tube MgB{sub 2} wires. Different conductor preparation methods and conductor architectures, and attainable critical current densities are presented. Some numerical results on critical currents, thermal stability and ac losses of future MgB{sub 2} multifilamentary and coated conductors with magnetic cladding of their filaments are also discussed.

Determination of input/output characteristics of full-bridge AC/DC/DC converter for arc welding

OpenAIRE

Stefanov, Goce; Karadzinov, Ljupco; Sarac, Vasilija; Cingoski, Vlatko; Gelev, Saso

2016-01-01

This paper describes the design and practical implementation of AC/DC/DC converter in mode of arc welding. An analysis of the operation of AC/DC/DC converter and its input/output characteristics are determined with computer simulations. The practical part is consisted of AC/DC/DC converter prototype for arc welding with output power of 3 kW and switching frequency of 64 kHz. The operation of AC/DC/DC converter is validated with experimental measurements.

Levitação acústica

OpenAIRE

Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

2015-01-01

A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

Extension to AC Loss Minimisation in High Temperature Superconductors

National Research Council Canada - National Science Library

Campbell, Archie

2004-01-01

...: (a) Measure the AC losses of appropriate Yttrium Barium Copper Oxide (YBCO) samples with strong potential for minimizing losses at high frequencies and magnetic fields with the existing equipment. (b...

Development of low AC loss windings for superconducting traction transformer

International Nuclear Information System (INIS)

Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K

2010-01-01

We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

DEFF Research Database (Denmark)

Ljusev, Petar; Andersen, Michael Andreas E.

2004-01-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

Introduction to AC machine design

CERN Document Server

Lipo, Thomas A

2018-01-01

AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

Low ac loss geometries in YBCO coated conductors and impact on conductor stability

Energy Technology Data Exchange (ETDEWEB)

Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.

Transport ac loss studies of YBCO coated conductors with nickel alloy substrates

International Nuclear Information System (INIS)

Duckworth, R C; Thompson, J R; Gouge, M J; Lue, J W; Ijaduola, A O; Yu, D; Verebelyi, D T

2003-01-01

Transport alternating current (ac) loss measurements were performed on a series of rolling-assisted biaxially textured substrate (RABiTS) processed YBa 2 Cu 3 O x (YBCO) coated conductors at 77 K. While each sample possessed a 1 μm layer of YBCO and a 3 μm silver cap layer, two different nickel alloy substrates were used and their impact on the ac loss was examined. Both substrates possessed a 75 μm Ni-5 at%W base, but one substrate also had a 2 μm nickel overlayer as part of the buffer layer architecture. The ac losses, which were determined by thermal and electrical measurements, contained two dominant contributions: superconductive hysteresis in the YBCO and ferromagnetic hysteresis in the substrates. The superconductive component followed the Norris elliptic model for the substrate with the nickel overlayer and the Norris thin strip model for the substrate without the nickel overlayer. The substrates' ferromagnetic loss was determined separately through magnetization measurements, which showed that this loss contribution was independent of the presence of the nickel overlayer for effective ac currents less than 50 A. While the overall loss was lower for the thin-strip-like conductor with no nickel overlayer, further research is necessary to strengthen this connection

The effect of ac magnetic fields on the lifting power of levitating superconductors

International Nuclear Information System (INIS)

Smolyak, B M; Ermakov, G V; Chubraeva, L I

2007-01-01

This study deals with the decrease in the levitation force under the action of an ac field up to the frequency at which oscillations of the superconducting suspension are limited by inertia. The lifting force was measured as a function of the ac field amplitude and the exposure time. It was shown that the force quickly decreased at the moment the ac field was applied and then continued diminishing, but at a lower rate. A qualitative model was proposed, taking into account two effects of the ac field on the magnetization of the levitating superconductor: a complete destruction of the critical state in some section of the superconductor (to a depth λ ac ) and the initiation of a faster magnetic relaxation in the region where the induction gradient is preserved

Magnetic susceptibility and magnetic resonance measurements of the moisture content and hydration condition of a magnetic mixture material

International Nuclear Information System (INIS)

Tsukada, K.; Kusaka, T.; Saari, M. M.; Takagi, R.; Sakai, K.; Kiwa, T.; Bito, Y.

2014-01-01

We developed a magnetic measurement method to measure the moisture content and hydration condition of mortar as a magnetic mixture material. Mortar is a mixture of Portland cement, sand, and water, and these materials exhibit different magnetic properties. The magnetization–magnetic field curves of these components and of mortars with different moisture contents were measured, using a specially developed high-temperature-superconductor superconducting quantum interference device. Using the differences in magnetic characteristics, the moisture content of mortar was measured at the ferromagnetic saturation region over 250 mT. A correlation between magnetic susceptibility and moisture content was successfully established. After Portland cement and water are mixed, hydration begins. At the early stage of the hydration/gel, magnetization strength increased over time. To investigate the magnetization change, we measured the distribution between bound and free water in the mortar in the early stage by magnetic resonance imaging (MRI). The MRI results suggest that the amount of free water in mortar correlates with the change in magnetic susceptibility

The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology

Directory of Open Access Journals (Sweden)

Anja Pahor

2018-01-01

Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.

AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios

Energy Technology Data Exchange (ETDEWEB)

Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z

2004-10-01

AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger.

AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios

International Nuclear Information System (INIS)

Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z.

2004-01-01

AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger

AC power losses in Bi-2223/Ag HTS tapes

International Nuclear Information System (INIS)

Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.

1998-01-01

Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

Effect of AC electric fields on the stabilization of premixed bunsen flames

KAUST Repository

Kim, Minkuk

2011-01-01

The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

International Nuclear Information System (INIS)

Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

2001-11-01

Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

Power-law index and penetration depth of (Nd_xSm_xGd_1−2x)Ba2Cu₃O_7−δ films studied by AC susceptibility

DEFF Research Database (Denmark)

Li, Xiaofen; He, Dong; Grivel, Jean-Claude

2012-01-01

Superconducting (NdxSmxGd1−2x)Ba2Cu3O7−δ films with x=0, 0.1, 0.25, 0.33 were grown by PLD on STO single crystal substrates. The power-law index n and penetration depth λ are studied by AC susceptibility. During cooling, n in films with x ≠ 0 increases much slower compared with the films with x =....... The films with x ≠ 0 also tend to have a longer penetration depth. These properties might be related to the higher possibility for disorder in the mixed (Nd,Sm,Gd)BCO films....

AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

International Nuclear Information System (INIS)

McCarthy, Christina B.; Theilmann, David A.

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

The correction of linear lattice gradient errors using an AC dipole

Energy Technology Data Exchange (ETDEWEB)

Wang,G.; Bai, M.; Litvinenko, V.N.; Satogata, T.

2009-05-04

Precise measurement of optics from coherent betatron oscillations driven by ac dipoles have been demonstrated at RHIC and the Tevatron. For RHIC, the observed rms beta-beat is about 10%. Reduction of beta-beating is an essential component of performance optimization at high energy colliders. A scheme of optics correction was developed and tested in the RHIC 2008 run, using ac dipole optics for measurement and a few adjustable trim quadruples for correction. In this scheme, we first calculate the phase response matrix from the. measured phase advance, and then apply singular value decomposition (SVD) algorithm to the phase response matrix to find correction quadruple strengths. We present both simulation and some preliminary experimental results of this correction.

Susceptibility Testing by Polymerase Chain Reaction DNA Quantitation: A Method to Measure Drug Resistance of Human Immunodeficiency Virus Type 1 Isolates

Science.gov (United States)

Eron, Joseph J.; Gorczyca, Paul; Kaplan, Joan C.; D'Aquila, Richard T.

1992-04-01

Polymerase chain reaction (PCR) DNA quantitation (PDQ) susceptibility testing rapidly and directly measures nucleoside sensitivity of human immunodeficiency virus type 1 (HIV-1) isolates. PCR is used to quantitate the amount of HIV-1 DNA synthesized after in vitro infection of peripheral blood mononuclear cells. The relative amounts of HIV-1 DNA in cell lysates from cultures maintained at different drug concentrations reflect drug inhibition of virus replication. The results of PDQ susceptibility testing of 2- or 3-day cultures are supported by assays measuring HIV-1 p24 antigen production in supernatants of 7- or 10-day cultures. DNA sequence analyses to identify mutations in the reverse transcriptase gene that cause resistance to 3'-azido-3'-deoxythymidine also support the PDQ results. With the PDQ method, both infectivity titration and susceptibility testing can be performed on supernatants from primary cultures of peripheral blood mononuclear cells. PDQ susceptibility testing should facilitate epidemiologic studies of the clinical significance of drug-resistant HIV-1 isolates.

n value and Jc distribution dependence of AC transport current losses in HTS conductors

International Nuclear Information System (INIS)

Ogawa, Jun; Sawai, Yusuke; Nakayama, Haruki; Tsukamoto, Osami; Miyagi, Daisuke

2004-01-01

Compared with LTS materials, HTS materials have some peculiarities affecting AC loss characteristics of the conductors. We measured the AC transport current losses in YBCO thin film coated conductors and a Bi2223/Ag sheathed tape. Comparing the measured data with analytical calculations, the dependence of the AC transport current losses on the n value and critical current density distributions are studied. It is shown that, considering the n values and J c distributions, the peculiarities in the HTS materials can be taken into consideration and the transport current losses in HTS conductors can be calculated by the same analytical method used for LTS

High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

Science.gov (United States)

Abbas, Qamar; Béguin, François

2016-06-01

We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge

Science.gov (United States)

Williamson, James M.; Trump, Darryl D.; Bletzinger, Peter; Ganguly, Biswa N.

2006-10-01

A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s-1. The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of ~3 × 1015 cm-3 at 25 W. The maximum ozone production achieved by short-pulse excitation was ~8.5 × 1015 cm-3 at 20 W, which was four times greater than that achieved by ac excitation at the same power level.

Low-Cost Voltage Zero-Crossing Detector for AC-Grid Applications

Directory of Open Access Journals (Sweden)

Vorobyov Maxim

2014-10-01

Full Text Available Renewable energy sources and energy storage devices are becoming more popular. Some of them like small hydropower turbines, wind turbines and diesel generators produce AC voltage with different frequency and voltage than the main grid. For them power electronics converters are necessary. Power electronics converters presented in industry use two or three level energy conversion, although direct AC to AC converters exist, but one of the main problems is the switch commutation when current or voltage is crossing the zero point. Zero crossing sensors are used to solve this problem. They consist of current or voltage measurement unit and zero crossing detector. Different approaches are used for zero crossing: hardware or software. Hardware approach is simple but it has low precision. Software approach has high precision but it is complicated and expensive. In this paper a simple low cost high precision approach is presented. It takes all advantages from both approaches. While tested with two types of microcontrollers the precision of experimental measurement is 25 μs - 40 μs.

AcEST: DK954361 [AcEST

Lifescience Database Archive (English)

Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

21 CFR 886.4440 - AC-powered magnet.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

Russian contribution to ExoMars Trace Gas Orbiter: Atmospheric Chemistry Suite (ACS)

Science.gov (United States)

Shakun, Alexey; Korablev, Oleg; Trokhimovskiy, Alexander; Grigoriev, Alexey; Anufreychik, Konstantin; Fedorova, Anna; Ignatiev, Nikolay; Ivanov, Yuriy; Moshkin, Boris; Kalinnikov, Yuriy; Montmessin, Franck

2016-04-01

Atmospheric Chemistry Suite (ACS) is a part of science payload of Trace Gas Orbiter (TGO), ExoMars mission. This project developed by European Space Agency (ESA) in collaboration with Russian Space Agency (Roscosmos). Russian contribution to ExoMars TGO is the Proton rocket and two science instruments ACS (three infrared spectrometers) and FREND (neutron detector). ACS consists of three infrared spectrometers (ACS/NIR, ACS/MIR and ACS/TIRVIM) capable to take spectral measurements from near to thermal infrared range simultaneously or separately. Spectrometric channels of ACS share common mechanical, electrical, and thermal interfaces. Electronic box (ACS/BE) provides to spectrometric channels power and data transfer interfaces. SpaceWire link is used for science data transfer and MIL-1553 link - for commanding and housekeeping data transfer. The NIR channel is an echelle spectrometer with acousto-optic tunable filter (AOTF) for the selection of diffraction orders. ACS NIR is capable to perform nadir and occultation observations. NIR covers the spectral range of 0.7-1.7 μm with resolving power of ~25000. NIR will perform unique for TGO instruments nightglow science (searching for O2, OH, NO nightglow emissions on Mars). From the 1.38 μm band NIR will do water vapour mapping in nadir and H2O vertical profiling in solar occultations. High resolution NIR measurements of 1.27 μm O2(a1Δg) dayglow will supply indirect ozone observations on the dayside on nadir. In solar occultation mode, the O2 vertical profiles will be measured from the surface (in case of low dust activity) to the 40 km altitude based on 0.76 μm absorption band. Together with MIR channel in solar occultation NIR will support the measurements of CO2 density profiles (based on 1.43 μm band) and aerosols characterization from 0.7 to 4 μm. The wide spectral range will allow not just determine aerosol particle sizes and density at different altitudes, but also distinguish between dust and ice particles

Spin dynamics of Mn12-acetate in the thermally activated tunneling regime: ac susceptibility and magnetization relaxation

Science.gov (United States)

Pohjola, Teemu; Schoeller, Herbert

2000-12-01

In this work, we study the spin dynamics of Mn12-acetate molecules in the regime of thermally assisted tunneling. In particular, we describe the system in the presence of a strong transverse magnetic field. Similar to recent experiments, the relaxation time/rate is found to display a series of resonances; their Lorentzian shape is found to stem from the tunneling. The dynamic susceptibility χ(ω) is calculated starting from the microscopic Hamiltonian and the resonant structure manifests itself also in χ(ω). Similar to recent results reported on another molecular magnet, Fe8, we find oscillations of the relaxation rate as a function of the transverse magnetic field when the field is directed along a hard axis of the molecules. This phenomenon is attributed to the interference of the geometrical or Berry phase. We propose susceptibility experiments to be carried out for strong transverse magnetic fields to study these oscillations and for a better resolution of the sharp satellite peaks in the relaxation rates.

Characterization of fine particles using optomagnetic measurements

DEFF Research Database (Denmark)

Fock, Jeppe; Jonasson, Christian; Johansson, Christer

2017-01-01

The remanent magnetic moment and the hydrodynamic size are important parameters for the synthesis and applications of magnetic nanoparticles (MNPs). We present the theoretical basis for the determination of the remanent magnetic moment and the hydrodynamic size of MNPs with a narrow size...... distribution using optomagnetic measurements. In these, the 2nd harmonic variation of the intensity of light transmitted through an MNP suspension is measured as a function of an applied axial oscillating magnetic field. We first show how the measurements of the optomagnetic signal magnitude at a low frequency...... vs. magnetic field amplitude can be used to determine the MNP moment. Subsequently, we use linear response theory to describe the dynamic non-equilibrium response of the MNP suspension at low magnetic field amplitudes and derive a link between optomagnetic measurements and magnetic AC susceptibility...

Human cerebral blood volume measurements using dynamic contrast enhancement in comparison to dynamic susceptibility contrast MRI

Energy Technology Data Exchange (ETDEWEB)

Artzi, Moran [Tel Aviv Sourasky Medical Center, Functional Brain Center, The Wohl Institute for Advanced Imaging, Tel Aviv (Israel); Tel Aviv University, Sackler Faculty of Medicine, Tel Aviv (Israel); Liberman, Gilad; Vitinshtein, Faina; Aizenstein, Orna [Tel Aviv Sourasky Medical Center, Functional Brain Center, The Wohl Institute for Advanced Imaging, Tel Aviv (Israel); Nadav, Guy [Tel Aviv Sourasky Medical Center, Functional Brain Center, The Wohl Institute for Advanced Imaging, Tel Aviv (Israel); Tel Aviv University, Faculty of Engineering, Tel Aviv (Israel); Blumenthal, Deborah T.; Bokstein, Felix [Tel Aviv Sourasky Medical Center, Neuro-Oncology Service, Tel Aviv (Israel); Bashat, Dafna Ben [Tel Aviv Sourasky Medical Center, Functional Brain Center, The Wohl Institute for Advanced Imaging, Tel Aviv (Israel); Tel Aviv University, Sackler Faculty of Medicine and Sagol School of Neuroscience, Tel Aviv (Israel)

2015-07-15

Cerebral blood volume (CBV) is an important parameter for the assessment of brain tumors, usually obtained using dynamic susceptibility contrast (DSC) MRI. However, this method often suffers from low spatial resolution and high sensitivity to susceptibility artifacts and usually does not take into account the effect of tissue permeability. The plasma volume (v{sub p}) can also be extracted from dynamic contrast enhancement (DCE) MRI. The aim of this study was to investigate whether DCE can be used for the measurement of cerebral blood volume in place of DSC for the assessment of patients with brain tumors. Twenty-eight subjects (17 healthy subjects and 11 patients with glioblastoma) were scanned using DCE and DSC. v{sub p} and CBV values were measured and compared in different brain components in healthy subjects and in the tumor area in patients. Significant high correlations were detected between v{sub p} and CBV in healthy subjects in the different brain components; white matter, gray matter, and arteries, correlating with the known increased tissue vascularity, and within the tumor area in patients. This work proposes the use of DCE as an alternative method to DSC for the assessment of blood volume, given the advantages of its higher spatial resolution, its lower sensitivity to susceptibility artifacts, and its ability to provide additional information regarding tissue permeability. (orig.)

Measuring ac losses in superconducting cables using a resonant circuit:Resonant current experiment (RESCUE)

DEFF Research Database (Denmark)

Däumling, Manfred; Olsen, Søren Krüger; Rasmussen, Carsten

1998-01-01

be recorded using, for example, a digital oscilloscope. The amplitude decay of the periodic voltage or current accurately reflects the power loss in the system. It consists of two components-an ohmic purely exponential one (from leads, contacts, etc.), and a nonexponential component originating from......A simple way to obtain true ac losses with a resonant circuit containing a superconductor, using the decay of the circuit current, is described. For the measurement a capacitor is short circuited with a superconducting cable. Energy in the circuit is provided by either charging up the capacitors...... with a certain voltage, or letting a de flow in the superconductor. When the oscillations are started-either by opening a switch in case a de is flowing or by closing a switch to connect the charged capacitors with the superconductor-the current (via a Rogowski coil) or the voltage on the capacitor can...

Suitability aero-geophysical methods for generating conceptual soil maps and their use in the modeling of process-related susceptibility maps

Science.gov (United States)

Tilch, Nils; Römer, Alexander; Jochum, Birgit; Schattauer, Ingrid

2014-05-01

. Previous studies show that, especially with radiometric measurements, the two-dimensional spatial variability of the nature of the process-relevant soil, close to the surface can be determined. In addition, the electromagnetic measurements are more important to obtain three-dimensional information of the deeper geological conditions and to improve the area-specific geological knowledge and understanding. The validation of these measurements is done with terrestrial geoelectrical measurements. So both aspects, radiometric and electromagnetic measurements, are important and subsequently, interpretation of the geophysical results can be used as the parameter maps in the modeling of more realistic susceptibility maps with respect to various processes. Within this presentation, results of geophysical measurements, the outcome and the derived parameter maps, as well as first process-oriented susceptibility maps in terms of gravitational soil mass movements will be presented. As an example results which were obtained with a heuristic method in an area in Vorarlberg (Western Austria) will be shown. References: Schwarz, L. & Tilch, N. (2011): Why are good process data so important for the modelling of landslide susceptibility maps?- EGU-Postersession "Landslide hazard and risk assessment, and landslide management" (NH 3.6), Vienna. [http://www.geologie.ac.at/fileadmin/user_upload/dokumente/pdf/poster/poster_2011_egu_schwarz_tilch_1.pdf] Tilch, N. & Schwarz, L. (2011): Spatial and scale-dependent variability in data quality and their influence on susceptibility maps for gravitational mass movements in soil, modelled by heuristic method.- EGU-Postersession "Landslide hazard and risk assessment, and landslide management" (NH 3.6); Vienna. [http://www.geologie.ac.at/fileadmin/user_upload/dokumente/pdf/poster/poster_2011_egu_tilch_schwarz.pdf

AC Conductivity and Dielectric Properties of Borotellurite Glass

Science.gov (United States)

Taha, T. A.; Azab, A. A.

2016-10-01

Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.

First thin AC-coupled silicon strip sensors on 8-inch wafers

Energy Technology Data Exchange (ETDEWEB)

Bergauer, T., E-mail: thomas.bergauer@oeaw.ac.at [Institute of High Energy Physics of the Austrian Academy of Sciences, Nikolsdorfer Gasse 18, 1050 Wien (Vienna) (Austria); Dragicevic, M.; König, A. [Institute of High Energy Physics of the Austrian Academy of Sciences, Nikolsdorfer Gasse 18, 1050 Wien (Vienna) (Austria); Hacker, J.; Bartl, U. [Infineon Technologies Austria AG, Siemensstrasse 2, 9500 Villach (Austria)

2016-09-11

The Institute of High Energy Physics (HEPHY) in Vienna and the semiconductor manufacturer Infineon Technologies Austria AG developed a production process for planar AC-coupled silicon strip sensors manufactured on 200 μm thick 8-inch p-type wafers. In late 2015, the first wafers were delivered featuring the world's largest AC-coupled silicon strip sensors. Detailed electrical measurements were carried out at HEPHY, where single strip and global parameters were measured. Mechanical studies were conducted and the long-term behavior was investigated using a climate chamber. Furthermore, the electrical properties of various test structures were investigated to validate the quality of the manufacturing process.

Regulation of P450-mediated permethrin resistance in Culex quinquefasciatus by the GPCR/Gαs/AC/cAMP/PKA signaling cascade.

Science.gov (United States)

Li, Ting; Liu, Nannan

2017-12-01

This study explores the role of G-protein-coupled receptor-intracellular signaling in the development of P450-mediated insecticide resistance in mosquitoes, Culex quinquefasciatus , focusing on the essential function of the GPCRs and their downstream effectors of Gs alpha subunit protein (Gαs) and adenylyl cyclase (ACs) in P450-mediated insecticide resistance of Culex mosquitoes. Our RNAi-mediated functional study showed that knockdown of Gαs caused the decreased expression of the downstream effectors of ACs and PKAs in the GPCR signaling pathway and resistance P450 genes, whereas knockdown of ACs decreased the expression of PKAs and resistance P450 genes. Knockdown of either Gαs or ACs resulted in an increased susceptibility of mosquitoes to permethrin. These results add significantly to our understanding of the molecular basis of resistance P450 gene regulation through GPCR/Gαs/AC/cAMP-PKA signaling pathways in the insecticide resistance of mosquitoes. The temporal and spatial dynamic analyses of GPCRs, Gαs, ACs, PKAs, and P450s in two insecticide resistant mosquito strains revealed that all the GPCR signaling pathway components tested, namely GPCRs, Gαs, ACs and PKAs, were most highly expressed in the brain for both resistant strains, suggesting the role played by these genes in signaling transduction and regulation. The resistance P450 genes were mainly expressed in the brain, midgut and malpighian tubules (MTs), suggesting their critical function in the central nervous system and importance for detoxification. The temporal dynamics analysis for the gene expression showed a diverse expression profile during mosquito development, indicating their initially functional importance in response to exposure to insecticides during their life stages.

Simultaneous distribution of AC and DC power

Science.gov (United States)

Polese, Luigi Gentile

2015-09-15

A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

Directory of Open Access Journals (Sweden)

LISTYA UTAMI KARMAWAN

2009-03-01

Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

Application of a flow generated by IR laser and AC electric field in micropumping and micromixing

International Nuclear Information System (INIS)

Nakano, M; Mizuno, A

2008-01-01

In this paper, it is described that measurement of fluid flow generated by simultaneous operation of an infrared (IR) laser and AC electric field in a microfabricated channel. When an IR laser (1026 nm) was focused under an intense AC electric field, a circulating flow was generated around the laser focus. The IR laser and the electric field generate two flow patterns of the electrohydrodynamicss. When the laser focus is placed at the center of the gap between electrodes, the flow pattern is parallel to the AC electric field toward electrodes from the centre. On the other hand, when the laser focus is placed close to one of the electrodes, one directional flow is generated. First flow pattern can be used as a micromixer and the second one as a micropump. Flow velocity profiles of the two flow patterns were measured as a function of the laser power, intensity of the AC electric field and AC frequency.

Universality of ac conduction in disordered solids

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2000-01-01

The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge

Energy Technology Data Exchange (ETDEWEB)

Williamson, James M [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Trump, Darryl D [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Bletzinger, Peter [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Ganguly, Biswa N [Air Force Research Laboratory, Wright-Patterson Air Force Base, Ohio 45433-7919 (United States)

2006-10-21

A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s{sup -1}. The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of {approx}3 x 10{sup 15} cm{sup -3} at 25 W. The maximum ozone production achieved by short-pulse excitation was {approx}8.5 x 10{sup 15} cm{sup -3} at 20 W, which was four times greater than that achieved by ac excitation at the same power level.

Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge

International Nuclear Information System (INIS)

Williamson, James M; Trump, Darryl D; Bletzinger, Peter; Ganguly, Biswa N

2006-01-01

A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s -1 . The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of ∼3 x 10 15 cm -3 at 25 W. The maximum ozone production achieved by short-pulse excitation was ∼8.5 x 10 15 cm -3 at 20 W, which was four times greater than that achieved by ac excitation at the same power level

Soil and water pollution studies from a waste site deposit in Bantama, Kumasi, Ghana using magnetic susceptibility measurements

International Nuclear Information System (INIS)

Hadi, M.; Preko, K.; Ashia, T.

2012-01-01

The magnetic susceptibility of soil and water samples from around the Uadara barracks waste site deposit in Bantama, a suburb of Kumasi was measured with the aim of investigating the potential threat of pollution to the soil, streams, fish ponds and other water sources at the site around Armed Forces Senior High School campus which shares the same premises with the barracks. The studied soil samples were picked from the near surface (∼10 cm depth) along profiles taken from the waste site towards the stream and the ponds. Again, water samples were picked along the stream and from ten (10) ponds aligned along the stream. Laboratory measurements of the magnetic susceptibility were done using the Bartington MS2 metre and the MS2B dual frequency sensor for the soil samples, and the MS2G sensor for the water samples. The soil samples from the site registered an average magnetic susceptibility of 180. 04 x 10 -5 SI whereas the water samples recorded an average of -2.3 x 10 -6 SI showing a significant increment in comparison with the standard water magnetic susceptibility of -9.04 x 10 -6 SI. Thus, not withstand the lithology of the area studied, the presence of heavy metals and other chemical waste materials form the Uadara barracks garbage deposit site were found to greatly pollute the soil and particularly the water bodies around the Armed Forces Senior High School. (au)

Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

Science.gov (United States)

Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

2012-01-01

The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

AC conductivity and dielectric properties of bulk tungsten trioxide (WO3)

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.; Saadeldin, M.; Zaghllol, M.

2012-11-01

AC conductivity and dielectric properties of tungsten trioxide (WO3) in a pellet form were studied in the frequency range from 42 Hz to 5 MHz with a variation of temperature in the range from 303 K to 463 K. AC conductivity, σac(ω) was found to be a function of ωs where ω is the angular frequency and s is the frequency exponent. The values of s were found to be less than unity and decrease with increasing temperature, which supports the correlated barrier hopping mechanism (CBH) as the dominant mechanism for the conduction in WO3. The dielectric constant (ε‧) and dielectric loss (ε″) were measured. The Cole-Cole diagram determined complex impedance for different temperatures.

a.c. conductance study of polycrystal C{sub 60}

Energy Technology Data Exchange (ETDEWEB)

Yan Feng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Wang Yening [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Huang Yineng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Gu Min [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Zhang Qingming [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Shen Huimin [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure

1995-06-05

The a.c. (1a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law {sigma} similar {omega}{sup s} (s{approx}0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C{sub 60}. ((orig.)).

Fast-ion losses induced by ACs and TAEs in the ASDEX Upgrade tokamak

International Nuclear Information System (INIS)

GarcIa-Munoz, M.; Hicks, N.; Classen, I.G.J.; Bilato, R.; Bobkov, V.; Brambilla, M.; Bruedgam, M.; Fahrbach, H.-U.; Igochine, V.; Maraschek, M.; Sassenberg, K.; Van Voornveld, R.; Jaemsae, S.

2010-01-01

The phase-space of convective and diffusive fast-ion losses induced by shear Alfven eigenmodes has been characterized in the ASDEX Upgrade tokamak. Time-resolved energy and pitch-angle measurements of fast-ion losses correlated in frequency and phase with toroidal Alfven eigenmodes (TAEs) and Alfven cascades (ACs) have allowed to identify both loss mechanisms. While single ACs and TAEs eject resonant fast-ions in a convective process, the overlapping of AC and TAE spatial structures leads to a large fast-ion diffusion and loss. The threshold for diffusive fast-ion losses depends on the ion energy (gyroradius). Diffusive fast-ion losses with gyroradius ∼70 mm have been observed with a single TAE for local radial displacements of the magnetic field lines larger than ∼2 mm. Multiple frequency chirping ACs cause an enhancement of the diffusive losses. The ACs and TAEs radial structures have been reconstructed by means of cross-correlation techniques between the fast-ion loss detector and the electron cyclotron emission radiometer.

AcMNPV

African Journals Online (AJOL)

USER

2010-08-16

Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

Modeling and reliability analysis of three phase z-source AC-AC converter

Directory of Open Access Journals (Sweden)

Prasad Hanuman

2017-12-01

Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

Novel Associations between Common Breast Cancer Susceptibility Variants and Risk-Predicting Mammographic Density Measures

OpenAIRE

Stone, Jennifer; Thompson, Deborah J.; dos-Santos-Silva, Isabel; Scott, Christopher; Tamimi, Rulla M.; Lindstrom, Sara; Kraft, Peter; Hazra, Aditi; Li, Jingmei; Eriksson, Louise; Czene, Kamila; Hall, Per; Jensen, Matt; Cunningham, Julie; Olson, Janet E.

2015-01-01

Mammographic density measures adjusted for age and body mass index (BMI) are heritable predictors of breast cancer risk but few mammographic density-associated genetic variants have been identified. Using data for 10,727 women from two international consortia, we estimated associations between 77 common breast cancer susceptibility variants and absolute dense area, percent dense area and absolute non-dense area adjusted for study, age and BMI using mixed linear modeling. We found strong suppo...

The expression patterns of bromelain and AcCYS1 correlate with blackheart resistance in pineapple fruits submitted to postharvest chilling stress.

Science.gov (United States)

Raimbault, Astrid-Kim; Zuily-Fodil, Yasmine; Soler, Alain; Mora, Phillipe; Cruz de Carvalho, Maria H

2013-11-01

Blackheart is a physiological disorder induced by postharvest chilling storage during pineapple fruit export shipping. The aim of this study was to check the involvement of bromelain, the cysteine protease protein family abundantly present in pineapple fruits, and AcCYS1, an endogenous inhibitor of bromelain, in the development of blackheart. For this we checked the response to postharvest chilling treatment of two pineapple varieties (MD2 and Smooth Cayenne) differing in their resistance to blackheart. Quantitative RT-PCR analyses showed that postharvest chilling treatment induced a down-regulation of bromelain transcript accumulation in both varieties with the most dramatic drop in the resistant variety. Regarding AcCYS1 transcript accumulation, the varieties showed opposite trends with an up-regulation in the case of the resistant variety and a down-regulation in the susceptible one. Taken together our results suggest that the control of bromelain and AcCYS1 expression levels directly correlates to the resistance to blackheart development in pineapple fruits. Copyright © 2013 Elsevier GmbH. All rights reserved.

High-field susceptibility in ferromagnetic NpOs2

International Nuclear Information System (INIS)

Dunlap, B.D.; Aldred, A.T.; Lam, D.J.; Davidson, G.R.

1975-01-01

NpOs 2 is known to be a ferromagnet with a Curie temperature of 7.5 0 K. Previous bulk magnetization measurements indicated a field-induced magnetization even well below the transition temperature. By a measurement of the local high-field susceptibility, using the Moessbauer effect in 237 Np, a susceptibility of (1.2 +- 0.2) x 10 -2 emu/mole at 1.6 0 K is obtained, in general agreement with the bulk measurement. Such a large susceptibility is best understood by a model f itinerant magnetism, although other properties of the material indicate localized behavior

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

Proportional-Integral-Resonant AC Current Controller

Directory of Open Access Journals (Sweden)

STOJIC, D.

2017-02-01

Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

AC losses for the various voltage-leads in a semi-triple layer BSCCO conductor

International Nuclear Information System (INIS)

Li, Z.; Ryu, K.; Hwang, S.D.; Cha, G.; Song, H.J.

2011-01-01

Two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer. Voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The loss from the total-lead significantly differs from the sum of the wire losses. In order to investigate the AC loss of the multilayer conductor in a high temperature superconductor cable, a voltage-lead was generally attached to the outermost layer of the conductor. But the conductor's AC loss has not been completely cleared due to the various contact positions and arrangements of the voltage-lead. In this paper, we prepared a semi-triple layer conductor consisting of an inner layer and an outer layer with double layer structure. To measure the AC loss of the conductor, two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer and arranged along their surfaces, as well as another voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The results show that the AC losses for each layer measured from the inner-lead and the outer-lead, respectively, are identical to the sum of the wire losses. The AC losses in the semi-triple layer conductor measured from the total-lead and the outer-lead are identical for the uniform layer current density, and similar to the sum of the wire losses in both layers. However, the losses measured for the non-uniform layer current density from three voltage-leads are unequal to each other, and the loss from the total-lead significantly differs from the sum of the wire losses.

Low Field Magnetic and Thermal Hysteresis in Antiferromagnetic Dysprosium

Directory of Open Access Journals (Sweden)

Iuliia Liubimova

2017-06-01

Full Text Available Magnetic and thermal hysteresis (difference in magnetic properties on cooling and heating have been studied in polycrystalline Dy (dysprosium between 80 and 250 K using measurements of the reversible Villari effect and alternating current (AC susceptibility. We argue that measurement of the reversible Villari effect in the antiferromagnetic phase is a more sensitive method to detect magnetic hysteresis than the registration of conventional B(H loops. We found that the Villari point, recently reported in the antiferromagnetic phase of Dy at 166 K, controls the essential features of magnetic hysteresis and AC susceptibility on heating from the ferromagnetic state: (i thermal hysteresis in AC susceptibility and in the reversible Villari effect disappears abruptly at the temperature of the Villari point; (ii the imaginary part of AC susceptibility is strongly frequency dependent, but only up to the temperature of the Villari point; (iii the imaginary part of the susceptibility drops sharply also at the Villari point. We attribute these effects observed at the Villari point to the disappearance of the residual ferromagnetic phase. The strong influence of the Villari point on several magnetic properties allows this temperature to be ranked almost as important as the Curie and Néel temperatures in Dy and likely also for other rare earth elements and their alloys.

Analytical solution of the PNP equations at AC applied voltage

International Nuclear Information System (INIS)

Golovnev, Anatoly; Trimper, Steffen

2012-01-01

A symmetric binary polymer electrolyte subjected to an AC voltage is considered. The analytical solution of the Poisson–Nernst–Planck equations (PNP) is found and analyzed for small applied voltages. Three distinct time regimes offering different behavior can be discriminated. The experimentally realized stationary behavior is discussed in detail. An expression for the external current is derived. Based on the theoretical result a simple method is suggested of measuring the ion mobility and their concentration separately. -- Highlights: ► Analytical solution of Poisson–Nernst–Planck equations. ► Binary polymer electrolyte subjected to an external AC voltage. ► Three well separated time scales exhibiting different behavior. ► The experimentally realized stationary behavior is discussed in detail. ► A method is proposed measuring the mobility and the concentration separately.

Transverse susceptibility as the low-frequency limit of ferromagnetic resonance

International Nuclear Information System (INIS)

Spinu, L.; Dumitru, I.; Stancu, A.; Cimpoesu, D.

2006-01-01

A new theory of transverse susceptibility (TS) based on magnetization vector dynamics, as described by the Landau-Lifshitz equation of motion, is given. It is shown that the traditional TS experiment is, in fact, the zero-frequency limit of the ferromagnetic resonance (FMR). The importance of these results resides in the generality of the approach which allows one to find the TS for virtually any magnetic system if an expression for the magnetic free-energy density is known. Moreover, the effect of the frequency of excitatory AC field on the TS experiments and the effect of energy dissipation through the imaginary part of TS emerge coherently from the new TS model

Complex study of transport AC loss in various 2G HTS racetrack coils

Energy Technology Data Exchange (ETDEWEB)

Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)

2013-04-15

Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.

Spatial agreement of predicted patterns in landslide susceptibility maps

Czech Academy of Sciences Publication Activity Database

Sterlacchini, S.; Ballabio, C.; Blahůt, Jan; Masetti, J.; Sorichetta, A.

2011-01-01

Roč. 125, č. 1 (2011), s. 51-61 ISSN 0169-555X Institutional research plan: CEZ:AV0Z30460519 Keywords : landslide susceptibility * weights of evidence * success rate Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.520, year: 2011 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6V93-511TN6P-3&_user=1407143&_coverDate=01%2F01%2F2011&_rdoc=1&_fmt=high&_orig=search&_origin=search&_sort=d&_docanchor=&view=c&_acct=C000052620&_version=1&_urlVersion=0&_userid=1407143&md5=d4e3ac0e1295373f2203f99a1aa8e905&searchtype=a

Structural, ac conductivity and dielectric properties of 3-formyl chromone

Science.gov (United States)

Ali, H. A. M.

2017-07-01

The structure for the powder of 3-formyl chromone was examined by X-ray diffraction technique in the 2θ° range ( 4° - 60° . The configuration of Al/3-formyl chromone/Al samples was designed. The electrical and dielectric properties were studied as a function of frequency (42- 5 × 106 Hz) and temperature (298-408K). The ac conductivity data of bulk of 3-formyl chromone varies as a power law with the frequency at different temperatures. The predominant mechanism for ac conduction was deduced. The ac conductivity shows a thermally activated process at different frequencies. The dielectric constant and dielectric loss were determined using the capacitance and dissipation factor measurements at different temperatures. The dielectric loss shows a peak of relaxation time that shifted to higher frequency with an increase in the temperature. The activation energy of the relaxation process was estimated.

Temperature dependence of the minimum in AC power losses of (Nb/sub 0.99/Zr/sub 0.01/)3Sn in parallel AC and DC magnetic fields

International Nuclear Information System (INIS)

Kovachev, V.T.

1980-01-01

ac losses P/sub L/ of bronze-processed (Nb/sub 0.99/Zr/sub 0.01/) 3 Sn strips have been measured between 4.2 and 16.5 K in the presence of a dc magnetic field H 0 . The measurements were performed using an electronic wattmeter with both ac and dc fields parallel to the long flat surfaces of the sample. A minimum in the function P/sub L/(H 0 ) was observed for fixed ac amplitudes h 0 . This minimum was found to occur in the entire temperature range between 4.2 and 16.5 K. A similar minimum was recently reported in Nb 3 Ge [Thompson et al., J. Appl. Phys. 50, 3514 (1979)] at 4.2 K. The position of the minimum is explained here by the same physical model as in Thompson et al. [J. Appl. Phys. 50, 3514 (1979)]; and Clem (ibid. 3518), but extending the model to include the temperature dependence of the entry surface shielding fields ΔH/sub en/(B,T) for flux density in the sample B=0. It is also shown here that loss minimum measurements can be used for the determination of ΔH/sub en/(0,T) in the temperature range 4.2--16.5 K

AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts

Energy Technology Data Exchange (ETDEWEB)

Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

2011-01-01

While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.

Isolated PDM and PWM DC-AC SICAMs[Pulse Density Modulated; Pulse Width Modulated

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.

2004-03-15

In this report a class of isolated PDM and PWM DC-AC SICAMs is described, which introduce the audio reference only in the output stage. AC-DC power supply is implemented in its simplest form: diode rectifier followed by a medium-size charge-storage capacitor. Isolation from the AC mains is achieved using a high frequency (HF) transformer, receiving the HF voltage pulses from the input 'inverter' stage and transferring them to the output 'rectifier+inverter' stage, which can use either PDM or PWM. The latter stage is then interfaced to the load using an output low-pass filter. Each of the dedicated stages is discussed in detail. Measurements on the master/slave PWM DC-AC SICAM prototype are presented to help benchmarking the performance of this class of SICAMs and identify the advantages and drawbacks. (au)

Advanced reliability improvement of AC-modules (ARIA)

International Nuclear Information System (INIS)

Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.

2001-09-01

are fully or partially shaded. Alpha Real has conducted considerable testing of shading and temperature rises of up to 180C have been observed. Such a temperature rise will influence the lifetime and reliability of the module, and it is therefore common practice to protect modules from these conditions by using by-pass diodes. Having now an active element on the back of the module, such as a module integrated inverter, new possibilities are offered for new concepts for hot-spot prevention. The main conclusions of the ARIA project are: Both the AC module inverters, Sunmaster 130S and Edisun E230721G, withstood the electrical immunity tests successfully; The Sunmaster 130S passed the accelerated reliability tests with good results; The Edisun E230721G passed the temperature cycling test and a humidity-freezing test; The ANIT s.r.l. ARIA modules met all requirements of the CEI/IEC 61215 standard; The voltage comparison method is a most promising principle for hot spot detection. It is implemented into both the Solcolino E230721G and the Sunmaster 130S. The costs for a 200W module are about $1. to $2.5, where the costs for by-pass diodes are $4 to $15; Measurements at different locations in three countries have shown that the new Hot Spot Detector (HSD) by comparing the voltages operates. Computer simulations show that if the current through the shaded cell is less than or equal to the current generated by the shaded cell, the shaded cell will not become reverse biased. 10 refs

Identification of highly susceptible individuals in complex networks

Science.gov (United States)

Tang, Shaoting; Teng, Xian; Pei, Sen; Yan, Shu; Zheng, Zhiming

2015-08-01

Identifying highly susceptible individuals in spreading processes is of great significance in controlling outbreaks. In this paper, we explore the susceptibility of people in susceptible-infectious-recovered (SIR) and rumor spreading dynamics. We first study the impact of community structure on people's susceptibility. Although the community structure can reduce the number of infected people for same infection rate, it will not significantly affect nodes' susceptibility. We find the susceptibility of individuals is sensitive to the choice of spreading dynamics. For SIR spreading, since the susceptibility is highly correlated to nodes' influence, the topological indicator k-shell can better identify highly susceptible individuals, outperforming degree, betweenness centrality and PageRank. In contrast, in rumor spreading model, where nodes' susceptibility and influence have no clear correlation, degree performs the best among considered topological measures. Our finding highlights the significance of both topological features and spreading mechanisms in identifying highly susceptible population.

Evaluation of the electrode performance for PAFC by using acid absorption, acceleration and ac-impedance measurement

Energy Technology Data Exchange (ETDEWEB)

Kim, Chang-Soo; Song, Rak-Hyun; Choi, Byung-Woo [Korea Institute of Energy Research, Taejon (Korea, Republic of)] [and others

1996-12-31

In PAFC, the degradation on cathode electrode caused by carbon corrosion, platinum dissolution and growth is especially severe. An acceleration test is a good technique for evaluating the degradation of electrode performance, because it does not need long time. Coleman et al used thermal cycling and on-off cycling as an acceleration test. Song et al showed that hydrogen shortage decreased the electrode performance more rapidly than that of air shortage in gas shortage test. Honji et al reported that the rate of coarsening of Pt particle is rapid in open circuit potential and this is one of major causes on the performance degradation of electrode. The cathode performance has been studied by using acid absorption, acceleration and ac-impedance measurements as functions of the polytetrafluoroethylene (PTFE) contents and sintering temperatures of the electrode.

AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.

2012-06-01

AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

Characterization of tetraaza-AC8, a surfactant with cation complexing potential

International Nuclear Information System (INIS)

Arleth, Lise

1995-01-01

Being a surfactant with cation complexing potential, the Tetraaza-AC8 can, in the long term, possibly be applied for the selection and extraction of specific cations. This can be of interest for the handling of radioactive waste or in the chemical industries for extraction of rare earth molecules as for example Rhodium. A thorough characterization of the behavior and abilities of Tetraaza-AC8 is necessary before one can even think of taking it into a larger production with sight of a specific application. This project deals with the characterization of the behavior and abilities of Tetraaza- AC8. In order to make use of the surface active properties of Tetraaza-AC8 it is necessary to dissolve it in some kind of solvent. As water is an important solvent which is, in addition, both inexpensive and non-polluting it is the natural choice. The aim of the project can then precised as follows: To study the micelle formation of dilute aqueous solutions of Tetraaza- AC8 and to determine how the micelle formation is influenced by the addition of respectively CsF, CuF_2 and RhCl_3 to the solutions The primary method of analysis is small-angle scattering. As small-angle x-ray scattering (SAXS) and small-angle neutron scattering (SANS) emphasizes different parts of the micellar structure, the combination of the methods allows a good determination of the micellar shape. In order to support the interpretation of scattering data, density measurements, surface tension measurements and UV/visible light spectroscopy are also performed. The scattering data have been analyzed according to two fundamentally different methods of analysis namely the method of indirect Fourier transform and the method of fitting molecular based models of the micelles to the scattering spectra. The first chapter contains a short introduction to the field of surfactants and complexing macrocycles. The chemical structure of Tetraaza-AC8 will be explained and motivated. A short description of the synthesis

The infiltration of the AC joint performed by one specialist: Ultrasound versus palpation a prospective randomized pilot study

Energy Technology Data Exchange (ETDEWEB)

Sabeti-Aschraf, M., E-mail: manuel.sabeti-aschraf@meduniwien.ac.a [Vienna Medical School, Department for Orthopaedics and Orthopaedic Surgery, AKH-Wien, Waehringer Guertel18-20, 1090 Vienna (Austria); Ochsner, A. [Vienna Medical School, Department for Orthopaedics and Orthopaedic Surgery, AKH-Wien, Waehringer Guertel18-20, 1090 Vienna (Austria); Schueller-Weidekamm, C. [Vienna Medical School, Department for Radiology, AKH-Wien, Waehringer Guertel 18-20, 1090 Vienna (Austria); Schmidt, M. [Vienna Medical School, Department for Orthopaedics and Orthopaedic Surgery, AKH-Wien, Waehringer Guertel18-20, 1090 Vienna (Austria); Funovics, Ph.T. [Vienna Medical School, Department for Radiology, AKH-Wien, Waehringer Guertel 18-20, 1090 Vienna (Austria); Skrbensky, G. von [Vienna Medical School, Department for Orthopaedics and Orthopaedic Surgery, AKH-Wien, Waehringer Guertel18-20, 1090 Vienna (Austria); Goll, A. [Vienna Medical School, Core Unit for Medical Statistics and Wien, Waehringer Guertel18-20, 1090 Vienna (Austria); Schatz, K.D. [Vienna Medical School, Department for Orthopaedics and Orthopaedic Surgery, AKH-Wien, Waehringer Guertel18-20, 1090 Vienna (Austria)

2010-07-15

Introduction: The acromio-clavicular (AC) joint is very susceptible to degenerative processes that result in pain and functional impairment. One common modality of treatment has been local infiltration of the joint space. Although this procedure has produced notable positive results, needle misplacement occurs frequently. The aim of this investigation is to evaluate the effects of an intra articular infiltration by comparing precise needle placement into the joint space using high-resolution-ultrasound with the conventional palpation technique. Methods: This prospective and randomized pilot study analysed 20 patients who were assigned either to the 'ultrasound' or the 'palpation' group. Clinical examinations were performed before treatment and at 1 h, 1 week and 3 weeks after a single infiltration of local anaesthetic and corticoid carried out by one specialist. Results: In both groups significant improvement in pain and function was obtained up to one-week post injection. Function remained significantly improved until the last follow-up and did not differ between the two groups. The agent was administered in all patients into the joint space in the ultrasound group. Conclusion: Ultrasound guided infiltration of the AC joint is an easily achieved procedure without any complications. However, clinical follow-up did not differ between free-hand and ultrasound-guided AC joint space infiltration.

The infiltration of the AC joint performed by one specialist: Ultrasound versus palpation a prospective randomized pilot study

International Nuclear Information System (INIS)

Sabeti-Aschraf, M.; Ochsner, A.; Schueller-Weidekamm, C.; Schmidt, M.; Funovics, Ph.T.; Skrbensky, G. von; Goll, A.; Schatz, K.D.

2010-01-01

Introduction: The acromio-clavicular (AC) joint is very susceptible to degenerative processes that result in pain and functional impairment. One common modality of treatment has been local infiltration of the joint space. Although this procedure has produced notable positive results, needle misplacement occurs frequently. The aim of this investigation is to evaluate the effects of an intra articular infiltration by comparing precise needle placement into the joint space using high-resolution-ultrasound with the conventional palpation technique. Methods: This prospective and randomized pilot study analysed 20 patients who were assigned either to the 'ultrasound' or the 'palpation' group. Clinical examinations were performed before treatment and at 1 h, 1 week and 3 weeks after a single infiltration of local anaesthetic and corticoid carried out by one specialist. Results: In both groups significant improvement in pain and function was obtained up to one-week post injection. Function remained significantly improved until the last follow-up and did not differ between the two groups. The agent was administered in all patients into the joint space in the ultrasound group. Conclusion: Ultrasound guided infiltration of the AC joint is an easily achieved procedure without any complications. However, clinical follow-up did not differ between free-hand and ultrasound-guided AC joint space infiltration.

Evaluation of ac conductivity behaviour of graphite filled

Indian Academy of Sciences (India)

Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled ...

Electrical actuation of electrically conducting and insulating droplets using ac and dc voltages

International Nuclear Information System (INIS)

Kumari, N; Bahadur, V; Garimella, S V

2008-01-01

Electrical actuation of liquid droplets at the microscale offers promising applications in the fields of microfluidics and lab-on-chip devices. Much prior research has targeted the electrical actuation of electrically conducting liquid droplets using dc voltages (classical electrowetting). Electrical actuation of conducting droplets using ac voltages and the actuation of insulating droplets (using dc or ac voltages) has remained relatively unexplored. This paper utilizes an energy-minimization-based analytical framework to study the electrical actuation of a liquid droplet (electrically conducting or insulating) under ac actuation. It is shown that the electromechanical regimes of classical electrowetting, electrowetting under ac actuation and insulating droplet actuation can be extracted from the generic electromechanical actuation framework, depending on the electrical properties of the droplet, the underlying dielectric layer and the frequency of the actuation voltage. This paper also presents experiments which quantify the influence of the ac frequency and the electrical properties of the droplet on its velocity under electrical actuation. The velocities of droplets moving between two parallel plates under ac actuation are experimentally measured; these velocities are then related to the actuation force on the droplet which is predicted by the electromechanical model developed in this work. It is seen that the droplet velocities are strongly dependent on the frequency of the ac actuation voltage; the cut-off ac frequency, above which the droplet fails to actuate, is experimentally determined and related to the electrical conductivity of the liquid. This paper then analyzes and directly compares the various electromechanical regimes for the actuation of droplets in microfluidic applications

System and method for monitoring and controlling stator winding temperature in a de-energized AC motor

Science.gov (United States)

Lu, Bin [Kenosha, WI; Luebke, Charles John [Sussex, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Becker, Scott K [Oak Creek, WI

2011-12-27

A system and method for measuring and controlling stator winding temperature in an AC motor while idling is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of a multi-phase AC motor. The circuit further includes a plurality of switching devices to control current flow and terminal voltages in the multi-phase AC motor and a controller connected to the circuit. The controller is configured to activate the plurality of switching devices to create a DC signal in an output of the motor control device corresponding to an input to the multi-phase AC motor, determine or estimate a stator winding resistance of the multi-phase AC motor based on the DC signal, and estimate a stator temperature from the stator winding resistance. Temperature can then be controlled and regulated by DC injection into the stator windings.

[Antimicrobial susceptibility in Chile 2012].

Science.gov (United States)

Cifuentes-D, Marcela; Silva, Francisco; García, Patricia; Bello, Helia; Briceño, Isabel; Calvo-A, Mario; Labarca, Jaime

2014-04-01

Bacteria antimicrobial resistance is an uncontrolled public health problem that progressively increases its magnitude and complexity. The Grupo Colaborativo de Resistencia, formed by a join of experts that represent 39 Chilean health institutions has been concerned with bacteria antimicrobial susceptibility in our country since 2008. In this document we present in vitro bacterial susceptibility accumulated during year 2012 belonging to 28 national health institutions that represent about 36% of hospital discharges in Chile. We consider of major importance to report periodically bacteria susceptibility so to keep the medical community updated to achieve target the empirical antimicrobial therapies and the control measures and prevention of the dissemination of multiresistant strains.

RNA interference suppression of mucin 5AC (MUC5AC reduces the adhesive and invasive capacity of human pancreatic cancer cells

Directory of Open Access Journals (Sweden)

Yamada Nobuya

2010-05-01

Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.

Transmission Technologies and Operational Characteristic Analysis of Hybrid UHV AC/DC Power Grids in China

Science.gov (United States)

Tian, Zhang; Yanfeng, Gong

2017-05-01

In order to solve the contradiction between demand and distribution range of primary energy resource, Ultra High Voltage (UHV) power grids should be developed rapidly to meet development of energy bases and accessing of large-scale renewable energy. This paper reviewed the latest research processes of AC/DC transmission technologies, summarized the characteristics of AC/DC power grids, concluded that China’s power grids certainly enter a new period of large -scale hybrid UHV AC/DC power grids and characteristics of “strong DC and weak AC” becomes increasingly pro minent; possible problems in operation of AC/DC power grids was discussed, and interaction or effect between AC/DC power grids was made an intensive study of; according to above problems in operation of power grids, preliminary scheme is summarized as fo llows: strengthening backbone structures, enhancing AC/DC transmission technologies, promoting protection measures of clean energ y accessing grids, and taking actions to solve stability problems of voltage and frequency etc. It’s valuable for making hybrid UHV AC/DC power grids adapt to operating mode of large power grids, thus guaranteeing security and stability of power system.

Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.

Science.gov (United States)

Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo

2016-09-01

Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged

Hopping models and ac universality

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2002-01-01

Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

Adolescent Susceptibility to Peer Influence in Sexual Situations.

Science.gov (United States)

Widman, Laura; Choukas-Bradley, Sophia; Helms, Sarah W; Prinstein, Mitchell J

2016-03-01

One consistent predictor of adolescents' engagement in sexual risk behavior is their belief that peers are engaging in similar behavior; however, not all youth are equally susceptible to these peer influence effects. Understanding individual differences in susceptibility to peer influence is critical to identifying adolescents at risk for negative health outcomes. The purpose of this project was to identify predictors of susceptibility to peer influence using a novel performance-based measure of sexual risk taking. Participants were 300 early adolescents (Mage = 12.6 years; 53% female; 44% Caucasian) who completed (1) a pretest assessment of demographics, sexual attitudes, and hypothetical scenarios measuring the likelihood of engaging in sexual risk behavior and (2) a subsequent experimental procedure that simulated an Internet chat room in which youth believed that they were communicating with peers regarding these same hypothetical scenarios. In reality, these "peers" were computer-programmed e-confederates. Changes in responses to the sexual scenarios in the private pretest versus during the public chat room provided a performance-based measure of peer influence susceptibility. In total, 78% of youth provided more risky responses in the chat room than those in pretest. The most robust predictor of this change was gender, with boys significantly more susceptible to peer influence than girls. Significant interactions also were noted, with greater susceptibility among boys with later pubertal development and African-American boys. Results confirm that not all youth are equally susceptible to peer influence. Consistent with sexual script theory, boys evidence greater susceptibility to social pressure regarding sexual behavior than girls. Copyright © 2016 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.

Effects of AC Electric Field on Small Laminar Nonpremixed Flames

KAUST Repository

Xiong, Yuan

2015-04-01

baseline case, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. By varying applied AC in a wide range of frequency and voltage, several insta- bility modes were observed, including flicking flames, partial pinch-off of flames, and spinning flames. High speed imaging together with Mie scattering techniques were combined to reveal the flame dynamics as well as the flow structure inside the flames. Original steady toroidal vortices triggered by AC were noted to exhibit axisymmetric axial instability in the flicking and partial pinch-off modes and non-axisymmetric azimuthal instability in the spinning mode. Electrical measurements were also conducted simultaneously to identify the voltage, current, and electrical power responses. Integrated power was noted to be sensitive to indicate subtle variation of flames properties and to the occurrence of axial instability. Under low frequency AC forcing with electrical conditions not generating toroidal vortices, responses of flames were further investigated. Several nonlinear flame responses, including frequency doubling and tripling phenomena, were identified. Spectral analysis revealed that such nonlinear responses were attributed to the combined effects of triggering buoyancy-induced oscillation of the flame as well as the Lorenz force generated by applying AC. Phase delay behaviors between the applied voltage and the heat release rate (or flame size) were also studied to explore the potential of applying AC in controlling flame instability. It was found that the phase delay had large variations for AC frequency smaller than

Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

Directory of Open Access Journals (Sweden)

Pijar Riza Anugerah

2015-10-01

Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

Magnetization reversal of Co-based amorphous wires induced by longitudinal AC magnetic field

Energy Technology Data Exchange (ETDEWEB)

Perov, N.S.; Antonov, A.S.; Buznikov, N.A.; Granovsky, A.B. E-mail: granov@magn.ru; Iakubov, I.T.; Kartashov, M.A.; Rakhmanov, A.A

2004-05-01

The remagnetization process in CoFeSiB amorphous wires under influence of a high-amplitude AC longitudinal magnetic field is studied. The frequency spectra of the voltage at the wire ends are measured as a function of a longitudinal DC magnetic field and the AC field amplitude. A high sensitivity of the voltage harmonics to the DC magnetic field is demonstrated. The experimental results are interpreted within a simple rotational model.

Magnetization reversal of Co-based amorphous wires induced by longitudinal AC magnetic field

International Nuclear Information System (INIS)

Perov, N.S.; Antonov, A.S.; Buznikov, N.A.; Granovsky, A.B.; Iakubov, I.T.; Kartashov, M.A.; Rakhmanov, A.A.

2004-01-01

The remagnetization process in CoFeSiB amorphous wires under influence of a high-amplitude AC longitudinal magnetic field is studied. The frequency spectra of the voltage at the wire ends are measured as a function of a longitudinal DC magnetic field and the AC field amplitude. A high sensitivity of the voltage harmonics to the DC magnetic field is demonstrated. The experimental results are interpreted within a simple rotational model

Electrodeformation of multi-bilayer spherical concentric membranes by AC electric fields

Science.gov (United States)

Lira-Escobedo, J.; Arauz-Lara, J.; Aranda-Espinoza, H.; Adlerz, K.; Viveros-Mendez, P. X.; Aranda-Espinoza, S.

2017-09-01

It is now well established that external stresses alter the behaviour of cells, where such alterations can be as profound as changes in gene expression. A type of stresses of particular interest are those due to alternating-current (AC) electric fields. The effect of AC fields on cells is still not well understood, in particular it is not clear how these fields affect the cell nucleus and other organelles. Here, we propose that one possible mechanism is through the deformation of the membranes. In order to investigate the effect of AC fields on the morphological changes of the cell organelles, we modelled the cell as two concentric bilayer membranes. This model allows us to obtain the deformations induced by the AC field by balancing the elastic energy and the work done by the Maxwell stresses. Morphological phase diagrams are obtained as a function of the frequency and the electrical properties of the media and membranes. We demonstrate that the organelle shapes can be changed without modifying the shape of the external cell membrane and that the organelle deformation transitions can be used to measure, for example, the conductivity of the nucleus.

Study of the Effect of Transport Current and Combined Transverse and Longitudinal Fields on the AC Loss in NET Prototype Conductors

NARCIS (Netherlands)

Nijhuis, Arend; ten Kate, Herman H.J.

1994-01-01

AC losses in cables carrying DC as well as AC transport currents at different DC background fields up to 2T have been measured on three types of Nb3Sn subcables in a new test facility. In this facility it is possible to apply sinusoidal transverse AC fields up to dB/dt=5T/s and longitudinal AC

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

Magnetic susceptibility characterisation of superparamagnetic microspheres

Science.gov (United States)

Grob, David Tim; Wise, Naomi; Oduwole, Olayinka; Sheard, Steve

2018-04-01

The separation of magnetic materials in microsystems using magnetophoresis has increased in popularity. The wide variety and availability of magnetic beads has fuelled this drive. It is important to know the magnetic characteristics of the microspheres in order to accurately use them in separation processes integrated on a lab-on-a-chip device. To investigate the magnetic susceptibility of magnetic microspheres, the magnetic responsiveness of three types of Dynabeads microspheres were tested using two different approaches. The magnetophoretic mobility of individual microspheres is studied using a particle tracking system and the magnetization of each type of Dynabeads microsphere is measured using SQUID relaxometry. The magnetic beads' susceptibility is obtained at four different applied magnetic fields in the range of 38-70 mT for both the mobility and SQUID measurements. The susceptibility values in both approaches show a consistent magnetic field dependence.

THERMIONIC AC GENERATION

Science.gov (United States)

is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

Research on the Plasma Anemometer Based on AC Glow Discharge

Directory of Open Access Journals (Sweden)

Bing Yu

2017-01-01

Full Text Available A new plasma anemometer based on AC glow discharge is designed in this article. Firstly, theoretical analysis of plasma anemometer working principle is introduced to prove the feasibility of the experimental measurement method. Then the experiments are carried out to study the effects of different parameters on the static discharge characteristics of the plasma anemometer system, by which the system optimization methods are obtained. Finally, several groups of appropriate parameters are selected to build the plasma anemometer system based on resistance capacitance coupling negative feedback AC glow discharge, and different airflow speeds are applied to obtain the achievable velocity measurement range. The results show that there is a linear relationship between airflow velocity and discharge current in an allowable error range, which can be applied for airflow velocity measurement. Negative feedback coupling module, which is composed of the coupling resistance and the coupling capacitance, has good effects on improving the system stability. The measurement range of the airflow velocity is significantly increased when the electrode gap is 3 mm, coupling resistance is 470 Ω, and coupling capacitance is 220 pF.

21 CFR 880.6320 - AC-powered medical examination light.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors

International Nuclear Information System (INIS)

Iijima, Y.; Hosaka, M.; Sadakata, N.; Saitoh, T.; Kohno, O.; Takeda, K.

1997-01-01

Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high J c sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low J c sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics

Ac-dc converter firing error detection

International Nuclear Information System (INIS)

Gould, O.L.

1996-01-01

Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

Distribution of AC loss in a HTS magnet for SMES with different operating conditions

Energy Technology Data Exchange (ETDEWEB)

Xu, Y., E-mail: xuyinghust@163.com [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Tang, Y.; Ren, L.; Jiao, F. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Song, M.; Cao, K.; Wang, D. [Yunnan Electric Power Research Institute, Kunming City 650217 (China); Wang, L.; Dong, H. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China)

2013-11-15

Highlights: •We present a model to calculate the distribution of AC loss for a storage magnet. •Comparative analysis of AC loss with different operating conditions has done. •The nonuniform distribution factor “d” is proposed to estimate the inhomogeneity of a storage magnet. •The model predicts the loss distribution and crucial areas which are suffering from the high AC loss. This is significant for the conduction-cooled structure design. -- Abstract: The AC loss induced in superconducting tape may affect the performance of a superconducting device applied to power system, such as transformer, cable, motor and even Superconducting Magnetic Energy Storage (SMES). The operating condition of SMES is changeable due to the need of compensation to the active or reactive power according to the demand of a power grid. In this paper, it is investigated that the distribution of AC loss for a storage magnet on different operating conditions, which is based on finite element method (FEM) and measured properties of BSCCO/Ag tapes. This analytical method can be used to optimize the SMES magnet.

Effectiveness of simple control measures on methicillin-resistant Staphylococcus aureus infection status and characteristics with susceptibility patterns in a teaching hospital in Peshawar.

Science.gov (United States)

Rafiq, Muhammad Salman; Rafiq, Muhammad Imran; Khan, Taimur; Rafiq, Maria; Khan, Mah Muneer

2015-09-01

To determine the effectiveness of simple control measures on the infection status and characteristics of methicillin-resistant Staphylococcus aureus including susceptibility patterns among health professionals and patients in a teaching hospital. The cross-sectional study was conducted from September 2013 to January 2014, and comprised samples collected from healthcare personnel and patients in the various units of Khyber Teaching Hospital, Peshawar. The specimens were collected before and one month after the implementation of simple control measures for outbreak prevention of methicillin-resistant Staphylococcus aureus. These were tested for culture and antimicrobial susceptibility. Data about methicillin-sensitive and methicillin-resistant Staphylococcus aureus infection, wound characteristics and susceptibility patterns was collected and effectiveness of simple control measures was determined. SPSS 20 was used for statistical analysis. Of the total 390 isolates, 180(46.2%) were Staphylococcus aureus; 77(19.7%) from healthcare personnel and 103(26.4%) from patients. Of these, 164(42.1%) were methicillin-sensitive and 16(4.1%) were methicillin-resistant. Among the patients, 38(15.1%) methicillin-sensitive and 8(3.2%) methicillin-resistant isolates were recovered from wounds or skin and soft tissues. Pus with 33(13.1%) and 4(1.6%) cases respectively was the second most common source. Among methicillin-resistant isolates, resistance to Linezolid was 0%, all were resistant to Oxacillin, Cefoxitin, Amoxicillin, Cefotaxime and Cephradine, and resistance to both Co-Amoxiclav and Ciprofloxacin was 87.5%. After one month of implementation of simple control measures, the number of methicillin-resistant cases among healthcare professionals and patients dropped from 4(2.9%) and 7(10.8%) to 1(0.7%) and 5(2.7%), respectively. Methicillin-resistant and methicillin-sensitive Staphylococcus aureus differed in their anti-microbial susceptibility profiles. Selection of antibiotics

The Polymorphism of DNA Repair Gene ERCC2/XPD Arg156Arg and Susceptibility to Breast Cancer in a Chinese Population

DEFF Research Database (Denmark)

Yin, J. Y.; Liang, D. H.; Vogel, Ulla Birgitte

2009-01-01

Polymorphisms in DNA repair genes are good candidates for modifying cancer risk. ERCC2/XPD, a gene involved in nucleotide excision repair and basal transcription, may influence individual DNA repair capacity, particularly of bulky adducts. This is implicated in cancer susceptibility. To detect...... found between ERCC2/XPD Arg156Arg and risk of breast cancer (AA/AC versus CC: OR = 0.79, 95% CI = 0.49-1.28, P = 0.33; AA versus CC: OR = 0.89, 95% CI = 0.49-1.63, P = 0.72; AC versus CC: OR = 0.74, 95% CI = 0.44-1.24, P = 0.25). Breast cancer cases with the variant AA genotype were marginally younger...

Study of the electric Held in HTS tape caused by perpendicular AC magnetic field

International Nuclear Information System (INIS)

Roiberg, V; Kopansky, F.

2004-01-01

Full Text: In a previous work we studied the influence of AC magnetic fields on voltage-currents (V-I) characteristics of high temperature superconducting (HTS) multi filament BSCC0-2223 tapes. It was found that AC magnetic fields perpendicular to the ab plane (the wide surface of the tape) cause a linear decrease of the critical current (IC) with amplitude of the AC magnetic field. The degradation of IC in .AC field was explained by the geometrical model according to which the transport current floe: is confined to the central zone of the tape where .AC field does not penetrate. For deeper understanding of the observed phenomena we carried out a study of the time dependence of the electric field during the cycle of AC field. At the same time we expanded the frequency range to low frequencies down to 1 Hz. The main results of the work are as following. 1. The time modulation of the electric field E in the HTS tape carrying transport DC current has the double frequency relating to AC magnetic field. 2. In field amplitudes less than 70 G the electric field modulation decreases with increasing frequency in opposite to its well-pronounced increase in higher AC field amplitudes. Alcove 70 G, the electric field increases with increasing the frequency of the external magnetic field. The wave forms of the electric field are different in both amplitudes ranges. 3. E-I curves of the tape in low amplitudes are frequency independent and coincide with E-l curves in AC field with intensity equal to the AC field amplitude. 4. In high AC field amplitudes, a strong dependence of the E-I curves on frequency is observed in the frequency range of 1-40 Hz and no dependence is observed in higher frequencies. Our results suggest that a combination of the geometrical model with flux creep concepts is necessary for a better understanding of the electric field behavior in our measurement conditions

Fuzzy Secondary Controller for Autonomous Stand-alone and Grid-connected AC Microgrid

DEFF Research Database (Denmark)

Neves, Rodolpho V. A.; Machado, Ricardo Q.; Oliveira, Vilma A.

2016-01-01

The present paper adresses the AC microgrid control issue using the hierarchical control structure and droop controllers for load sharing. Once the droop controllers impose an operation with frequency and voltage deviations, depending on the load and droop parameters, a hierarchical control...... structure must be added to change the droop controller operating points. The hierarchical controllers operate with local measurements and shared signals from communication links among the distributed generation systems connected to the microgrid. Depending on the geographical size of the microgrid......, the communication links can be economically unviable. This paper thus proposes a fuzzy secondary controller for AC microgrids to reduce the link communication dependency by using only local measurements. The simulation results show that the deviations as happened with the conventional secondary controllers can...

Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

Directory of Open Access Journals (Sweden)

Amir V. Tavakoli

2017-09-01

Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

Downregulation and Mutation of a Cadherin Gene Associated with Cry1Ac Resistance in the Asian Corn Borer, Ostrinia furnacalis (Guenée

Directory of Open Access Journals (Sweden)

Tingting Jin

2014-09-01

Full Text Available Development of resistance in target pests is a major threat to long-term use of transgenic crops expressing Bacillus thuringiensis (Bt Cry toxins. To manage and/or delay the evolution of resistance in target insects through the implementation of effective strategies, it is essential to understand the basis of resistance. One of the most important mechanisms of insect resistance to Bt crops is the alteration of the interactions between Cry toxins and their receptors in the midgut. A Cry1Ac-selected strain of Asian corn borer (ACB, Ostrinia furnacalis, a key pest of maize in China, evolved three mutant alleles of a cadherin-like protein (OfCAD (MPR-r1, MPR-r2 and MPR-r3, which mapped within the toxin-binding region (TBR. Each of the three mutant alleles possessed two or three amino acid substitutions in this region, especially Thr1457→Ser. In highly resistant larvae (ACB-Ac200, MPR-r2 had a 26-amino acid residue deletion in the TBR, which resulted in reduced binding of Cry1Ac compared to the MPR from the susceptible strain, suggesting that the number of amino acid deletions influences the level of resistance. Furthermore, downregulation of OfCAD gene (ofcad transcription was observed in the Cry1Ac resistant strain, ACB-Ac24, suggesting that Cry1Ac resistance in ACB is associated with the downregulation of the transcript levels of the cadherin-like protein gene. The OfCAD identified from ACB exhibited a high degree of similarity to other members of the cadherin super-family in lepidopteran species.

AcEST: DK947950 [AcEST

Lifescience Database Archive (English)

Full Text Available 10071|GLI3_HUMAN Zinc finger protein GLI3 OS=Homo sapiens GN... 31 4.9 sp|Q8WXX7|AUTS2_HUMAN Autism suscepti...FSPPHPYINPYMDYIRSLHSSPSLSMI 216 >sp|Q8WXX7|AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Homo sapiens

ACS experiment for atmospheric studies on "ExoMars-2016" Orbiter

Science.gov (United States)

Korablev, O. I.; Montmessin, F.; Fedorova, A. A.; Ignatiev, N. I.; Shakun, A. V.; Trokhimovskiy, A. V.; Grigoriev, A. V.; Anufreichik, K. A.; Kozlova, T. O.

2015-12-01

ACS is a set of spectrometers for atmospheric studies (Atmospheric Chemistry Suite). It is one of the Russian instruments for the Trace Gas Orbiter (TGO) of the Russian-European "ExoMars" program. The purpose of the experiment is to study the Martian atmosphere by means of two observations regimes: sensitive trace gases measurements in solar occultations and by monitoring the atmospheric state during nadir observations. The experiment will allow us to approach global problems of Mars research such as current volcanism, and the modern climate status and its evolution. Also, the experiment is intended to solve the mystery of methane presence in the Martian atmosphere. Spectrometers of the ACS set cover the spectral range from the near IR-range (0.7 μm) to the thermal IR-range (17 μm) with spectral resolution λ/Δλ reaching 50000. The ACS instrument consists of three independent IR spectrometers and an electronics module, all integrated in a single unit with common mechanical, electrical and thermal interfaces. The article gives an overview of scientific tasks and presents the concept of the experiment.

Updating the HST/ACS G800L Grism Calibration

Science.gov (United States)

Hathi, Nimish P.; Pirzkal, Norbert; Grogin, Norman A.; Chiaberge, Marco; ACS Team

2018-06-01

We present results from our ongoing work on obtaining newly derived trace and wavelength calibrations of the HST/ACS G800L grism and comparing them to previous set of calibrations. Past calibration efforts were based on 2003 observations. New observations of an emission line Wolf-Rayet star (WR96) were recently taken in HST Cycle 25 (PID: 15401). These observations are used to analyze and measure various grism properties, including wavelength calibration, spectral trace/tilt, length/size of grism orders, and spacing between various grism orders. To account for the field dependence, we observe WR96 at 3 different observing positions over the HST/ACS field of view. The three locations are the center of chip 1, the center of chip 2, and the center of the WFC1A-2K subarray (center of WFC Amp A on chip 1). This new data will help us to evaluate any differences in the G800L grism properties compared to previous calibration data, and to apply improved data analysis techniques to update these old measurements.

Geometry dependence of magnetic and transport AC losses in Bi-2223/Ag tapes with different aspect ratios

Energy Technology Data Exchange (ETDEWEB)

Fang, J [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Luo, X M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Chen, D X [ICREA and Grup Electromagnetisme, Departament de Fisica, Universitat Autonoma Barcelona, 08193 Bellaterra (Spain); Alamgir, A K M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Collings, E W [MSE, Ohio State University, Columbus, OH 43210 (United States); Lee, E [MSE, Ohio State University, Columbus, OH 43210 (United States); Sumption, M D [MSE, Ohio State University, Columbus, OH 43210 (United States); Fang, J G [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Yi, H P [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Song, X H [Innova Superconductor Technology Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Guo, S Q [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Liu, M L [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Xin, Y [Innopower Superconductor Cable Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Han, Z [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)

2004-10-01

On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field.

Geometry dependence of magnetic and transport AC losses in Bi-2223/Ag tapes with different aspect ratios

International Nuclear Information System (INIS)

Fang, J; Luo, X M; Chen, D X; Alamgir, A K M; Collings, E W; Lee, E; Sumption, M D; Fang, J G; Yi, H P; Song, X H; Guo, S Q; Liu, M L; Xin, Y; Han, Z

2004-01-01

On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field

Flame spread over inclined electrical wires with AC electric fields

KAUST Repository

Lim, Seung J.

2017-07-21

Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.

MD 349: Impedance Localization with AC-dipole

CERN Document Server

Biancacci, Nicolo; Metral, Elias; Salvant, Benoit; Papotti, Giulia; Persson, Tobias Hakan Bjorn; Tomas Garcia, Rogelio; CERN. Geneva. ATS Department

2016-01-01

The purpose of this MD is to measure the distribution of the transverse impedance of the LHC by observing the phase advance variation with intensity between the machine BPMs. Four injected bunches with different intensities are excited with an AC dipole and the turn by turn data is acquired from the BPM system. Through post-processing analysis the phase variation along the machine is depicted and, from this information, first conclusions of the impedance distribution can be drawn.

Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

DEFF Research Database (Denmark)

Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

2009-01-01

This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

Review of magnetic susceptibility logging and its application to uranium exploration

International Nuclear Information System (INIS)

George, D.C.; Scott, J.H.

1982-01-01

Borehole measurement of magnetic susceptibility can show anomalies associated with mineralization or alteration. The detection of small anomalies is necessary, so efforts have been made in recent years to improve the sensitivity and the stability of magnetic susceptibility logging tools. Typical tools contain a single coil constructed as a solenoid wound on ferrite rods about 30cm long. The coil is heated to a constant temperature to reduce drift, and careful design is necessary to optimize temperature control and to maximize sensitivity. Measurements of coil resistance and inductance, which indicate conductivity and susceptibility, are made using a Maxwell bridge circuit. Circuit analysis shows that conductivity measurements are difficult and that stringent requirements are placed on phase stability of measurement circuitry. Corrections to the observed log are necessary to account for borehole size. The response of the tool to a thin zones of anomalous susceptibility is double peaked and a set of curves has been developed for interpretation. Calibrations of the tools are made by measuring the tool's response in models of known susceptibility

Characterisation of AC1: a naturally decaffeinated coffee

Directory of Open Access Journals (Sweden)

Luciana Benjamim Benatti

2012-01-01

Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

A multi-channel AC power supply controller

International Nuclear Information System (INIS)

Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

2003-01-01

A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

Susceptibility for thin ideal media and eating styles

NARCIS (Netherlands)

Anschutz, Doeschka J; Engels, Rutger C M E; van Strien, Tatjana

This study examined the relations between susceptibility for thin ideal media and restrained, emotional and external eating, directly and indirectly through body dissatisfaction. Thin ideal media susceptibility, body dissatisfaction and eating styles were measured in a sample of 163 female students.

Bioinformatics and Astrophysics Cluster (BinAc)

Science.gov (United States)

Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

2017-09-01

BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

AC susceptometry on the single-molecule magnet Ni{sub 2}Dy

Energy Technology Data Exchange (ETDEWEB)

Wendler, Pascal; Sundt, Alexander; Waldmann, Oliver [Physikalisches Institut, Universitaet Freiburg (Germany); Khan, Amin; Lan, Yanhua; Powell, Annie K. [Institute of Inorganic Chemistry, Karlsruhe Institute of Technology (Germany)

2013-07-01

Molecular nanomagnets are molecules which show novel and fascinating magnetic properties. The best known phenomenon is the observation of magnetic hysteresis on the molecular scale in the single-molecule magnets (SMMs), such as Mn{sub 12}ac. In addition, quantum mechanical effects, such as the tunneling of the magnetization, can be observed in bulk samples of SMMs. A key goal for understanding the underlying physics is the measurement of the magnetization dynamics, which can be accomplished using ac susceptometry. However, the magnetic moments of samples of SMMs are weak since the volume density of the magnetic ions is very small as compared to e.g. inorganic compounds. In this talk we will describe the construction of an ac susceptometer suitable for investigating molecular nanomagnets. A particular goal was to reach frequencies of the ac field of 100 kHz, extending the frequency range of commercial devices typically used in this research area by two decades. The device can be operated in the temperature range of 1.5 to 300 K and was characterized by comparing data recorded on Mn{sub 19} with available literature results. Lastly, we will present our experimental results on the novel SMM Ni{sub 2}Dy and discuss the different magnetic relaxation regimes observed in it.

Spodoptera frugiperda (J.E. Smith) with field-evolved resistance to Bt maize are susceptible to Bt pesticides.

Science.gov (United States)

Jakka, S R K; Knight, V R; Jurat-Fuentes, J L

2014-10-01

Field-evolved resistance to maize event TC1507 expressing the Cry1Fa toxin from Bacillus thuringiensis (Bt) was detected in populations of Spodoptera frugiperda from Puerto Rico. We tested for cross-resistance to purified Cry1A toxins and commercial Bt pesticides in susceptible (Benzon) and TC1507-resistant (456) strains of S. frugiperda. Larvae from the 456 strain exhibited cross-resistance to Cry1Ab and Cry1Ac toxins, while no differences in susceptibility to XenTari WG and DiPel ES pesticides were detected. These data support cross-resistance to toxins that share binding sites with Cry1Fa and no cross-resistance to Bt pesticides in S. frugiperda with field-evolved resistance to Bt maize. Copyright © 2014 Elsevier Inc. All rights reserved.

A high sensitivity SQUID-method for the measurement of magnetic susceptibility of small samples in the temperature range 1.5 K-40 K and application on small palladium particles

International Nuclear Information System (INIS)

Tu Nguyen Quang.

1979-01-01

In this paper a method is developed for magnetic susceptibility measurements which is superior to the common methods. The method is based on the SQUID-principle (Superconducting Quantum Interference Device) using the tunnel effect of a superconducting point contact and magnetic flux quantization for measuring electric and magnetic quantities. Due to this refined method susceptibility changes of very small palladium particles could be detected in the temperature range 1.5 K-40 K with respect to the bulk. In addition susceptibility differences of particle distributions with different means diameters (81 Angstroem and 65 Angstroem) have been measured for the first time. A quantitative comparison of the measurements with theoretical results shows satisfactory agreement. (orig./WBU) [de

Magnetic susceptibility measurement using 2D magnetic resonance imaging

Czech Academy of Sciences Publication Activity Database

Marcon, P.; Bartušek, Karel; Burdkova, M.; Dokoupil, Zdeněk

2011-01-01

Roč. 22, č. 10 (2011), 105702:1-8 ISSN 0957-0233 R&D Projects: GA ČR GAP102/11/0318; GA MŠk ED0017/01/01 Institutional research plan: CEZ:AV0Z20650511 Keywords : magnetic flux density * magnetic susceptibility * MRI * MR signal * reaction field Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.494, year: 2011

Finite-size effects on the dynamic susceptibility of CoPhOMe single-chain molecular magnets in presence of a static magnetic field

Science.gov (United States)

Pini, M. G.; Rettori, A.; Bogani, L.; Lascialfari, A.; Mariani, M.; Caneschi, A.; Sessoli, R.

2011-09-01

The static and dynamic properties of the single-chain molecular magnet Co(hfac)2NITPhOMe (CoPhOMe) (hfac = hexafluoroacetylacetonate, NITPhOMe = 4'-methoxy-phenyl-4,4,5,5-tetramethylimidazoline-1-oxyl-3-oxide) are investigated in the framework of the Ising model with Glauber dynamics, in order to take into account both the effect of an applied magnetic field and a finite size of the chains. For static fields of moderate intensity and short chain lengths, the approximation of a monoexponential decay of the magnetization fluctuations is found to be valid at low temperatures; for strong fields and long chains, a multiexponential decay should rather be assumed. The effect of an oscillating magnetic field, with intensity much smaller than that of the static one, is included in the theory in order to obtain the dynamic susceptibility χ(ω). We find that, for an open chain with N spins, χ(ω) can be written as a weighted sum of N frequency contributions, with a sum rule relating the frequency weights to the static susceptibility of the chain. Very good agreement is found between the theoretical dynamic susceptibility and the ac susceptibility measured in moderate static fields (Hdc≤2 kOe), where the approximation of a single dominating frequency for each segment length turns out to be valid. For static fields in this range, data for the relaxation time, τ versus Hdc, of the magnetization of CoPhOMe at low temperature are also qualitatively reproduced by theory, provided that finite-size effects are included.

Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

Directory of Open Access Journals (Sweden)

Evi Ploumpidou

2017-12-01

Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

Magnetic susceptibility of free charge carriers in bismuth tellurides (Bi2Te3)

International Nuclear Information System (INIS)

Guha Thakurta, S.R.; Dutta, A.K.

1977-01-01

Principal magnetic susceptibilities of both p- and n-type Bi 2 Te 3 crystals have been measured over the range of temperature 90 deg K to 650 deg K. The observed susceptibilities are diamagnetic and temperature dependent. This temperature dependence has been attributed to the contribution of the free charge carriers to the susceptibilities. From the observed susceptibilities the carrier-susceptibilities have been separately obtained which are found to be paramagnetic. From the total carrier-susceptibilities, the susceptibilities of the carriers which are thermally liberated in the intrinsic region have been separated. From an analysis of the carrier-susceptibilities the band gap and its temperature coefficient have been found out and these compare favourably with those obtained from electrical measurements. (author)

Measurement of susceptibility artifacts with histogram-based reference value on magnetic resonance images according to standard ASTM F2119.

Science.gov (United States)

Heinrich, Andreas; Teichgräber, Ulf K; Güttler, Felix V

2015-12-01

The standard ASTM F2119 describes a test method for measuring the size of a susceptibility artifact based on the example of a passive implant. A pixel in an image is considered to be a part of an image artifact if the intensity is changed by at least 30% in the presence of a test object, compared to a reference image in which the test object is absent (reference value). The aim of this paper is to simplify and accelerate the test method using a histogram-based reference value. Four test objects were scanned parallel and perpendicular to the main magnetic field, and the largest susceptibility artifacts were measured using two methods of reference value determination (reference image-based and histogram-based reference value). The results between both methods were compared using the Mann-Whitney U-test. The difference between both reference values was 42.35 ± 23.66. The difference of artifact size was 0.64 ± 0.69 mm. The artifact sizes of both methods did not show significant differences; the p-value of the Mann-Whitney U-test was between 0.710 and 0.521. A standard-conform method for a rapid, objective, and reproducible evaluation of susceptibility artifacts could be implemented. The result of the histogram-based method does not significantly differ from the ASTM-conform method.

Calculation of the magnetic susceptibilities of transition metal monocarbides, mononitrides and monoxides

International Nuclear Information System (INIS)

Eibler, R.; Neckel, A.

1975-01-01

Results of Augmented Plane Wave (APW) band structure calculations are used to determine the magnetic susceptibilities of some transition metal monocarbides, mononitrides and monoxides (TiC, TiN, TiO, VC, VN, VO, NbC, NbN) assuming stoichiometric composition. Contributions to the susceptibility arising from the orbital para- and diamagnetism and the spin paramagnetism are determined separately. The orbital susceptibility terms are calculated by means of the model of Kubo and Obata. The calculated susceptibilities are compared with measured values. The approximations in the calculation of the orbital susceptibility terms are discussed especially with regard to the agreement between calculated and measured susceptibilities for the individual compounds. Similar calculations are performed for the susceptibilities of non-stoichiometric VCsub(x)-phase, for which APR-Virtual Crystal Approximation (VCA) band structure calculations are available. (author)

ACS and STEMI treatment: gender-related issues.

Science.gov (United States)

Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude

2012-08-01

Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.

A study of the ac Stark effect in doped photonic crystals

Energy Technology Data Exchange (ETDEWEB)

Haque, I; Singh, Mahi R [Department of Physics and Astronomy, University of Western Ontario, London, ON, N6A 3K7 (Canada)

2007-04-16

In this paper we present calculations of level populations and susceptibility for an ensemble of five-level atoms doped in a photonic crystal, using the master equation method. The atoms in the ensemble interact with the crystal which acts as a reservoir and are coupled with two strong pump fields and a weak probe field. It is found that, by manipulating the resonance energy associated with one of the decay channels of the atom, the system can be switched between an inverted and a non-inverted state. We have also observed the ac Stark effect in these atoms and have shown that due to the role played by the band structure of the photonic crystal, it is possible to switch between an absorption state and a non-absorption state of the atomic system. This is a very important finding as techniques of rendering material systems transparent to resonant laser radiation are very desirable in the fabrication of novel optical and photonic devices.

Soil magnetic susceptibility as indicator of radioactive contamination

International Nuclear Information System (INIS)

Curda, S.

2006-01-01

Measurement of magnetic susceptibility is a method, which is used in many areas of research. The locality Ak-Tjuz is typical example of old ecological load. One of the negative effects represents radioactive contamination. This situation is caused by environmental disaster in 1964. For useful reparation it is really necessary to determinate the surface range of contamination. And measurement of the magnetic susceptibility could be the suitable method for that kind of monitoring. (author)

Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

Science.gov (United States)

Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

AcEST: DK961757 [AcEST

Lifescience Database Archive (English)

Full Text Available otein FLJ22184 ... 37 0.095 sp|Q01205|ODO2_RAT Dihydrolipoyllysine-residue succinyltransfera... 33 1.4 sp|Q8WXX7|AUTS2_HUMAN Autism...202 >sp|Q8WXX7|AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Homo sapiens GN=AUTS2 PE=2 SV=1 Length =

Should fee-for-service be for all guideline-advocated acute coronary syndrome (ACS) care? Observations from the Snapshot ACS study.

Science.gov (United States)

Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P

2015-09-01

The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, G [Jefferson Lab (United States)

2014-07-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, Gianluigi [JLAB

2015-02-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

Magnetic anomaly in superconducting TmRh4B4

International Nuclear Information System (INIS)

Smith, J.L.; Huang, C.Y.; Tsou, J.J.; Ho, J.C.

1978-01-01

The magnetic and superconducting properties of TmRh 4 B 4 (which becomes superconducting at 9.6 K) by means of ac and dc magnetic susceptibility and specific heat measurements are investigated. At 10.7 K, an ac susceptibility peak similar to those found in spin glasses has been observed. In addition, a pronounced specific heat peak has been observed at 11.4 K. The susceptibility peak is essentially unaffected by substitution of 1% Lu or Er for the Tm, but it diminishes when much larger amounts of Er are substituted. The physical origin of this anomalous peak will be discussed

Effect of feeding broilers diets differing in susceptible phytate content

Directory of Open Access Journals (Sweden)

Natalie K. Morgan

2016-03-01

Full Text Available Measurements of total phytate phosphorus content of diets may be deceptive as they do not indicate substrate availability for phytase; it may be that measurements of phytate susceptible to phytase effects are a more accurate measure of phosphorus (P availability to the bird. To verify this hypothesis, an experiment was conducted to compare diets formulated to contain either high or low susceptible phytate, supplemented with either 0 or 500 FTU/kg phytase. Susceptible phytate was determined by exposing the feed samples to conditions that mimicked the average pH of the proximal gastrointestinal tract (pH 4.5 and the optimum temperature for phytase activity (37 °C and then measuring phytate dissolved. Ross 308 birds (n = 240 were fed one of 4 dietary treatments in a 2 × 2 factorial design; 2 diets with high (8.54 g/kg, 57.90% of total phytate or low (5.77 g/kg, 46.33% of total phytate susceptible phytate, containing 0 or 500 FTU/kg phytase. Diets were fed to broilers (12 replicate pens of 5 birds per pen from d 0 to 28 post hatch. Birds fed diets high in susceptible phytate had greater phytate hydrolysis in the gizzard (P < 0.001, jejunum (P < 0.001 and ileum (P < 0.001 and resulting greater body weight gain (BWG (P = 0.015 and lower FCR (P = 0.003 than birds fed the low susceptible phytate diets, irrespective of phytase presence. Birds fed the high susceptible diets also had greater P solubility in the gizzard and Ca and P solubility in the jejunum and ileum (P < 0.05 and resulting greater tibia and femur Ca and P (P < 0.05 content than those fed the low susceptible diets. All the susceptible phytate was fully degraded in the tract in the absence of added phytase, suggesting the assay used in this study was able to successfully estimate the amount of total dietary phytate that was susceptible to the effects of phytase when used at standard levels. No interactions were observed between susceptible phytate and phytase on

The NOD2 Single Nucleotide Polymorphism rs72796353 (IVS4+10 A>C) Is a Predictor for Perianal Fistulas in Patients with Crohn's Disease in the Absence of Other NOD2 Mutations.

Science.gov (United States)

Schnitzler, Fabian; Friedrich, Matthias; Wolf, Christiane; Stallhofer, Johannes; Angelberger, Marianne; Diegelmann, Julia; Olszak, Torsten; Tillack, Cornelia; Beigel, Florian; Göke, Burkhard; Glas, Jürgen; Lohse, Peter; Brand, Stephan

2015-01-01

A previous study suggested an association of the single nucleotide polymorphism (SNP) rs72796353 (IVS4+10 A>C) in the NOD2 gene with susceptibility to Crohn's disease (CD). However, this finding has not been confirmed. Given that NOD2 variants still represent the most important predictors for CD susceptibility and phenotype, we evaluated the association of rs72796353 with inflammatory bowel disease (IBD) susceptibility and the IBD phenotype. Genomic DNA from 2256 Caucasians, including 1073 CD patients, 464 patients with ulcerative colitis (UC), and 719 healthy controls, was genotyped for the NOD2 SNP rs72796353 and the three main CD-associated NOD2 mutations rs2066844, rs2066845, and rs2066847. Subsequently, IBD association and genotype-phenotype analyses were conducted. In contrast to the strong associations of the NOD2 SNPs rs2066844 (p=3.51 x 10(-3)), rs2066845 (p=1.54 x 10(-2)), and rs2066847 (p=1.61 x 10(-20)) with CD susceptibility, no significant association of rs72796353 with CD or UC susceptibility was found. However, in CD patients without the three main CD-associated NOD2 mutations, rs72796353 was significantly associated with the development of perianal fistulas (p=2.78 x 10(-7), OR 5.27, [95% CI 2.75-10.12] vs. NOD2 wild-type carriers). Currently, this study represents the largest genotype-phenotype analysis of the impact of the NOD2 variant rs72796353 on the disease phenotype in IBD. Our data demonstrate that in CD patients the IVS4+10 A>C variant is strongly associated with the development of perianal fistulas. This association is particularly pronounced in patients who are not carriers of the three main CD-associated NOD2 mutations, suggesting rs72796353 as additional genetic marker for the CD disease behaviour.

Quantitative Susceptibility Mapping in Parkinson's Disease.

Science.gov (United States)

Langkammer, Christian; Pirpamer, Lukas; Seiler, Stephan; Deistung, Andreas; Schweser, Ferdinand; Franthal, Sebastian; Homayoon, Nina; Katschnig-Winter, Petra; Koegl-Wallner, Mariella; Pendl, Tamara; Stoegerer, Eva Maria; Wenzel, Karoline; Fazekas, Franz; Ropele, Stefan; Reichenbach, Jürgen Rainer; Schmidt, Reinhold; Schwingenschuh, Petra

2016-01-01

Quantitative susceptibility mapping (QSM) and R2* relaxation rate mapping have demonstrated increased iron deposition in the substantia nigra of patients with idiopathic Parkinson's disease (PD). However, the findings in other subcortical deep gray matter nuclei are converse and the sensitivity of QSM and R2* for morphological changes and their relation to clinical measures of disease severity has so far been investigated only sparsely. The local ethics committee approved this study and all subjects gave written informed consent. 66 patients with idiopathic Parkinson's disease and 58 control subjects underwent quantitative MRI at 3T. Susceptibility and R2* maps were reconstructed from a spoiled multi-echo 3D gradient echo sequence. Mean susceptibilities and R2* rates were measured in subcortical deep gray matter nuclei and compared between patients with PD and controls as well as related to clinical variables. Compared to control subjects, patients with PD had increased R2* values in the substantia nigra. QSM also showed higher susceptibilities in patients with PD in substantia nigra, in the nucleus ruber, thalamus, and globus pallidus. Magnetic susceptibility of several of these structures was correlated with the levodopa-equivalent daily dose (LEDD) and clinical markers of motor and non-motor disease severity (total MDS-UPDRS, MDS-UPDRS-I and II). Disease severity as assessed by the Hoehn & Yahr scale was correlated with magnetic susceptibility in the substantia nigra. The established finding of higher R2* rates in the substantia nigra was extended by QSM showing superior sensitivity for PD-related tissue changes in nigrostriatal dopaminergic pathways. QSM additionally reflected the levodopa-dosage and disease severity. These results suggest a more widespread pathologic involvement and QSM as a novel means for its investigation, more sensitive than current MRI techniques.

AcEST: DK948707 [AcEST

Lifescience Database Archive (English)

Full Text Available GN=Syn1 PE=1 SV=2 31 5.2 sp|Q8WXX7|AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Ho... 31 6.7 sp|Q9UZW...ASQAGPGPRTGPPTT-QQPRPSGPGPAGRPAKPQLAQKPSQDVPPPIT 650 Query: 533 SLWG 544 + G Sbjct: 651 AAAG 654 >sp|Q8WXX7|AUTS2_HUMAN Autism

ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching

Science.gov (United States)

Taylor, Terri

2009-05-01

In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.

Cell cycle- and chaperone-mediated regulation of H3K56ac incorporation in yeast.

Science.gov (United States)

Kaplan, Tommy; Liu, Chih Long; Erkmann, Judith A; Holik, John; Grunstein, Michael; Kaufman, Paul D; Friedman, Nir; Rando, Oliver J

2008-11-01

Acetylation of histone H3 lysine 56 is a covalent modification best known as a mark of newly replicated chromatin, but it has also been linked to replication-independent histone replacement. Here, we measured H3K56ac levels at single-nucleosome resolution in asynchronously growing yeast cultures, as well as in yeast proceeding synchronously through the cell cycle. We developed a quantitative model of H3K56ac kinetics, which shows that H3K56ac is largely explained by the genomic replication timing and the turnover rate of each nucleosome, suggesting that cell cycle profiles of H3K56ac should reveal most first-time nucleosome incorporation events. However, since the deacetylases Hst3/4 prevent use of H3K56ac as a marker for histone deposition during M phase, we also directly measured M phase histone replacement rates. We report a global decrease in turnover rates during M phase and a further specific decrease in turnover at several early origins of replication, which switch from rapidly replaced in G1 phase to stably bound during M phase. Finally, by measuring H3 replacement in yeast deleted for the H3K56 acetyltransferase Rtt109 and its two co-chaperones Asf1 and Vps75, we find evidence that Rtt109 and Asf1 preferentially enhance histone replacement at rapidly replaced nucleosomes, whereas Vps75 appears to inhibit histone turnover at those loci. These results provide a broad perspective on histone replacement/incorporation throughout the cell cycle and suggest that H3K56 acetylation provides a positive-feedback loop by which replacement of a nucleosome enhances subsequent replacement at the same location.

Cell cycle- and chaperone-mediated regulation of H3K56ac incorporation in yeast.

Directory of Open Access Journals (Sweden)

Tommy Kaplan

2008-11-01

Full Text Available Acetylation of histone H3 lysine 56 is a covalent modification best known as a mark of newly replicated chromatin, but it has also been linked to replication-independent histone replacement. Here, we measured H3K56ac levels at single-nucleosome resolution in asynchronously growing yeast cultures, as well as in yeast proceeding synchronously through the cell cycle. We developed a quantitative model of H3K56ac kinetics, which shows that H3K56ac is largely explained by the genomic replication timing and the turnover rate of each nucleosome, suggesting that cell cycle profiles of H3K56ac should reveal most first-time nucleosome incorporation events. However, since the deacetylases Hst3/4 prevent use of H3K56ac as a marker for histone deposition during M phase, we also directly measured M phase histone replacement rates. We report a global decrease in turnover rates during M phase and a further specific decrease in turnover at several early origins of replication, which switch from rapidly replaced in G1 phase to stably bound during M phase. Finally, by measuring H3 replacement in yeast deleted for the H3K56 acetyltransferase Rtt109 and its two co-chaperones Asf1 and Vps75, we find evidence that Rtt109 and Asf1 preferentially enhance histone replacement at rapidly replaced nucleosomes, whereas Vps75 appears to inhibit histone turnover at those loci. These results provide a broad perspective on histone replacement/incorporation throughout the cell cycle and suggest that H3K56 acetylation provides a positive-feedback loop by which replacement of a nucleosome enhances subsequent replacement at the same location.

Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

Directory of Open Access Journals (Sweden)

Eriko Kage-Nakadai

Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

Ferromagnetic resonance and transverse susceptibility measurements on particulate recording media (abstract)

Science.gov (United States)

Orth, Th.; Pelzl, J.; Chantrell, R. W.; Veitch, R.; Jakusch, H.

1993-05-01

The FMR absorption of different particulate recording tapes was investigated at microwave frequencies in the X band and Q band using temperatures from 70 to 400 K. The FMR spectra as a function of the external magnetic field were recorded for four different orientations of the static and high frequency magnetic fields with respect to the tape. Particular interest of the experimental and theoretical study was devoted to the interaction fields between the particles, texture effects within the tape sample and the effective anisotropy fields. Tape samples with different particle materials, varying packing densities and orientation ratios were prepared. The shape and line position of the FMR spectra obtained are strongly dependent on the pigment material and the tape parameters mentioned above. The experimental data are compared with theoretical calculations, based on a phenomenological model and a computer simulation. This comparison gives information on the orientational distribution of the particles, which is the most important source for inhomogeneous line broadening, the mean interaction, and anisotropy fields which govern the line position, the effective magnetization of the tape, and the relaxation time. The influence of the crystalline anisotropy can be investigated via temperature dependent measurements. The results are proved by additional transverse susceptibility measurements.

Magnetic susceptibility of 244Cm metal and 249Cf metal

International Nuclear Information System (INIS)

Fujita, D.K.; Parsons, T.C.; Edelstein, N.; Noe, M.; Peterson, J.R.

1975-07-01

The first magnetic susceptibility measurements made on the expanded fcc phase of 249 Cf metal are reported. Further measurements are needed on other Cf metal phases. Another measurement of the magnetic susceptibility of 244 Cm metal in a limited temperature range has been reported. The result does not agree with previously reported values. Further work is continuing on the synthesis of 244 Cm metal and 248 Cm metal and magnetic measurements on these samples. (auth)

Nature of the magnetic susceptibility of dysprosium. Paramagnetic susceptibility of dysprosium - yttrium alloys

International Nuclear Information System (INIS)

Demidov, V.G.; Levitin, R.Z.; Chistyakov, O.D.

1976-01-01

The paramagnetic susceptibility of single crystals of dysprosium-yttirum alloys is measured in the basal plane and along the hexagonal axis. It is shown that the susceptibility of the alloys obeys the Curie-Weiss law, the effective magnetic moments allong the different directions being the same and the paramagnetic Curie temperatures being different. The difference between the paramagnetic Curie temperatures in the basal plane and along the hexagonal axis is independent of the dysprosium concentration in the alloy. As a comparison with the theoretical models of magnetic anisotropy shows, this is an indication that the magnetic anisotropy of dysprosium - yttrium alloys is of a single-ion nature

Temperature dependence of the distribution of the thermally activated energy barriers in Tl2Ba2CaCu2O8 film

International Nuclear Information System (INIS)

Ren, C.; Lin, F.Y.; Ding, S.Y.; Li, Z.M.; Aruna, S.A.; Qiu, L.; Yao, X.X.; Yan, S.L.; Si, M.S.

1999-01-01

The effects of frequency and ac amplitude on ac susceptibility have been measured for a thin Tl 2 Ba 2 CaCu 2 O 8 film in the range 100 Hz-100 kHz in magnetic field 0.52 T. A phenomenological equation with an asymmetrical distribution of thermally activated energy barriers has been used to analyse these frequency and amplitude dependences of the ac susceptibility χ(ω,h ac ) in the vicinity of the peak temperature of χ''. We obtain the effective energy barrier U against amplitude h ac (current density j): U h ac -0.38 . This U(j) relationship shows that the flux lines are in the 3D collective creep regime. Therefore, we conclude that the effective energy barrier is in fact an average of the barrier's distribution, and the distribution function is a distinguished asymmetrical one in this 3D collective creep regime. (author)

Control of hybrid AC/DC microgrid under islanding operational conditions

DEFF Research Database (Denmark)

Ding, G.; Gao, F.; Zhang, S.

2014-01-01

This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....

SQUIDs De-fluxing Using a Decaying AC Magnetic Field

Energy Technology Data Exchange (ETDEWEB)

Matlashov, Andrei Nikolaevich [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Semenov, Vasili Kirilovich [State Univ. of New York (SUNY), Plattsburgh, NY (United States); Anderson, Bill [Senior Scientific, LLC, Albuquerque, NM (United States)

2016-06-08

Flux trapping is the Achilles’ heel of all superconductor electronics. The most direct way to avoid flux trapping is a prevention of superconductor circuits from exposure to magnetic fields. Unfortunately this is not feasible if the circuits must be exposed to a strong DC magnetic field even for a short period of time. For example, such unavoidable exposures take place in superparamagnetic relaxation measurements (SPMR) and ultra-low field magnetic resonance imaging (ULF MRI) using unshielded thin-film SQUID-based gradiometers. Unshielded SQUIDs stop working after being exposed to DC magnetic fields of only a few Gauss in strength. In this paper we present experimental results with de-fluxing of planar thin-film LTS SQUID-based gradiometers using a strong decaying AC magnetic field. We used four commercial G136 gradiometers for SPMR measurements with up to a 10 mT magnetizing field. Strong 12.9 kHz decaying magnetic field pulses reliably return SQUIDs to normal operation 50 ms after zeroing the DC magnetizing field. This new AC de-fluxing method was also successfully tested with seven other different types of LTS SQUID sensors and has been shown to dissipate extremely low energy.

Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

Science.gov (United States)

Reitan, D. K.

1973-01-01

Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing

International Nuclear Information System (INIS)

Gottardi, L.; Kuur, J. van der; Korte, P. A. J. de; Den Hartog, R.; Dirks, B.; Popescu, M.; Hoevers, H. F. C.; Bruijn, M.; Borderias, M. Parra; Takei, Y.

2009-01-01

We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDM configuration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10 MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370 kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/R N <0.5). The measured energy resolution at 5.89 keV is 2.7 eV for DC bias and 3.7 eV for AC bias, while the baseline resolution is 2.8 eV and 3.3 eV, respectively.

An evaluation of the Panasonic model UD513AC-1 Thermoluminescence Dosimetry system

International Nuclear Information System (INIS)

Durrer, R.E. Jr.

1991-12-01

An evaluation of the Panasonic UD513AC-1 Thermoluminescence Dosimetry system was performed to determine the system's capabilities as a general purpose thermoluminescence dosimeter measuring device. The tests that were performed included a critique of the user's manual, delimitation of the operating parameters, the quality of construction, and an evaluation of the features that were unique to this system. The UD513AC-1 was found to be an adequate measuring device for most dosimetric applications. It was not well suited for experimental work with thermoluminescence materials due to a low sensitivity displayed by the photomultiplier tube to commonly used materials. The system was well constructed and did not suffer hardware failure during this research. Major attributes of the UD513AC-1 were automatic data storage, highly reproducible heating ramps, an excellent infrared light filter and a unique feature to a single phosphor unit, a dose determination function. Negative aspects of the system included a limited data manipulation capability within the controlling program, a poorly written user's manual, inadequate sensitivity on the part of the photomultiplier tube, and insufficient capability to adjust the hot N 2 gas flow to desired levels

A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

Science.gov (United States)

Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

2017-05-01

Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

AC impedance behaviour and state-of-charge dependence of Zr0 ...

Indian Academy of Sciences (India)

Unknown

measurement encompasses a wide range of AC signal frequencies, various characteristic parameters of the electrochemical cell and kinetics of the associated reactions can be evaluated. Metal-hydride (MH) electrodes form the anode or the negative plate of a nickel-metal- hydride battery. However, the development of MH ...

AcEST: DK955250 [AcEST

Lifescience Database Archive (English)

Full Text Available S=Myxococcus xan... 31 5.1 sp|Q5QXV0|RL17_IDILO 50S ribosomal protein L17 OS=Idiomarina loi... 31 5.1 sp|Q8WXX7|AUTS2_HUMAN Autism...APMAYIELVGRP 119 >sp|Q8WXX7|AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Homo sapiens GN=AUTS2 PE=2 S

AcEST: DK945557 [AcEST

Lifescience Database Archive (English)

Full Text Available S=Mus mus... 32 0.77 sp|Q7YR45|PS1C2_PANTR Psoriasis susceptibility 1 candidate g...ene ... 32 0.77 sp|Q9Y6Y8|S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens ... 32 1.3 sp|Q9UIG4|PS1C2_HUMAN Psoriasis

21 CFR 880.5100 - AC-powered adjustable hospital bed.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...

AC BREAKDOWN IN GASES

Science.gov (United States)

electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.

Magnetic Susceptibilities as they appeared to me - An Amperian approach

Energy Technology Data Exchange (ETDEWEB)

Van den Bosch, A.

2008-08-15

Starting from scratch, the book narrates a systematic story of the basic ideas you need for understanding quasi static magnetic susceptibilities. The story leans on the authors 25 year experience measuring susceptibilities following the Faraday technique (related with solid state physics, radiation effects, materials and magneto chemistry). The base of magnetism, the current-current interaction, is the linkage between the topics treated. The number of mathematical equations are reduced to a minimum and can be skipped without losing the thread of the story. The story is positive towards the sound bases of magnetism. However, room is left for the interpretation of measuring data. As the word susceptibility covers different meanings, the story answers for different situations the question: what is susceptible to what for creating what?

Magnetic Susceptibilities as they appeared to me - An Amperian approach

International Nuclear Information System (INIS)

Van den Bosch, A.

2008-01-01

Starting from scratch, the book narrates a systematic story of the basic ideas you need for understanding quasi static magnetic susceptibilities. The story leans on the authors 25 year experience measuring susceptibilities following the Faraday technique (related with solid state physics, radiation effects, materials and magneto chemistry). The base of magnetism, the current-current interaction, is the linkage between the topics treated. The number of mathematical equations are reduced to a minimum and can be skipped without losing the thread of the story. The story is positive towards the sound bases of magnetism. However, room is left for the interpretation of measuring data. As the word susceptibility covers different meanings, the story answers for different situations the question: what is susceptible to what for creating what?

Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

Science.gov (United States)

Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

2016-01-01

Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

AC electric motors control advanced design techniques and applications

CERN Document Server

Giri, Fouad

2013-01-01

The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

Techniques For Measuring Absorption Coefficients In Crystalline Materials

Science.gov (United States)

Klein, Philipp H.

1981-10-01

Absorption coefficients smaller than 0.001 cm-1 can, with more or less difficulty, be measured by several techniques. With diligence, all methods can be refined to permit measurement of absorption coefficients as small as 0.00001 cm-1. Spectral data are most readily obtained by transmission (spectrophotometric) methods, using multiple internal reflection to increase effective sample length. Emissivity measurements, requiring extreme care in the elimination of detector noise and stray light, nevertheless afford the most accessible spectral data in the 0.0001 to 0.00001 cm-1 range. Single-wavelength informa-tion is most readily obtained with modifications of laser calorimetry. Thermo-couple detection of energy absorbed from a laser beam is convenient, but involves dc amplification techniques and is susceptible to stray-light problems. Photoacoustic detection, using ac methods, tends to diminish errors of these types, but at some expense in experimental complexity. Laser calorimetry has been used for measurements of absorption coefficients as small as 0.000003 cm-1. Both transmission and calorimetric data, taken as functions of intensity, have been used for measurement of nonlinear absorption coefficients.

Emergence of Griffiths phase and glassy mixed phase in Sm0.5Ca0.5MnO3 nanomanganites

International Nuclear Information System (INIS)

Giri, S.K.; Yusuf, S.M.; Mukadam, M.D.; Nath, T.K.

2014-01-01

Graphical abstract: A detailed investigation on the effect of grain size on formation of Griffiths phase, and glassy mixed phase in CE-type antiferromagnetic Sm 0.5 Ca 0.5 MnO 3 manganite are carried out. A rigorous measurement of linear and non-linear ac magnetic susceptibilities, time dependent relaxation and aging phenomena in Sm 0.5 Ca 0.5 MnO 3 nanomanganite confirm the existence of a glassy mixed phase in the low temperature regime. The signature of Griffiths phase in nanosized manganite has been confirmed from the detailed ac and dc magnetization studies. The existence of Griffiths phase is verified through the anomalous behavior of the low field temperature dependent an inverse ac and dc magnetic susceptibility. Based on experimental results, the glassy phase of nanomanganites has been attributed to the phase separation effect and interaction between the ferromagnetic clusters. A phenomenological core/shell model has also been proposed based on the surface disorder to explain the observed Griffiths phase in these nanosized manganites. Fig. 1: (Left) The plot of inverse of ac susceptibility χ ac -1 measured at f = 1 Hz and H ac = 2 Oe as a function of temperature for S750 sample. Inset shows the same for S550 sample. (Right) A schematic of the proposed model to describe the magnetic state of the Sm 0.5 Ca 0.5 MnO 3 system at different average sizes. Highlights: • Effect of grain size on Griffiths phase and glassy mixed phase is discussed. • GP is confirmed by dc, linear and non-linear ac magnetization in nanomanganites. • Glassy mixed phase is discussed by time dependent relaxation and aging phenomena. • The existence of GP is verified through an inverse ac and dc magnetic susceptibility. • A phenomenological core/shell model has been proposed based on surface disorder. -- Abstract: A detailed investigation on the effect of grain size on formation of Griffiths phase (GP), and glassy mixed phase in CE-type antiferromagnetic Sm 0.5 Ca 0.5 MnO 3

Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

Directory of Open Access Journals (Sweden)

Rudy Ariyanto

2017-11-01

Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets

International Nuclear Information System (INIS)

Moore, Martina; Roth, Stefan; Gebert, Annett; Schultz, Ludwig; Gutfleisch, Oliver

2015-01-01

Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated

The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets

Energy Technology Data Exchange (ETDEWEB)

Moore, Martina, E-mail: m.moore@ifw-dresden.de [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Roth, Stefan; Gebert, Annett [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Schultz, Ludwig [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); TU Dresden, Institute for Materials Science, 01062 Dresden (Germany); Gutfleisch, Oliver [TU Darmstadt, Department of Materials Science, Alarich-Weiß-Str. 16, 64287 Darmstadt (Germany); Fraunhofer Project Group for Materials Recycling and Resource Strategies IWKS, 63457 Hanau (Germany)

2015-02-01

Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated.

Successful enrichment of the ubiquitous freshwater acI Actinobacteria.

Science.gov (United States)

Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk

2014-02-01

Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

Dynamic characteristics of corona discharge generated under rainfall condition on AC charged conductors

Science.gov (United States)

Xu, Pengfei; Zhang, Bo; Wang, Zezhong; Chen, Shuiming; He, Jinliang

2017-12-01

By synchronous measurement of corona current and the water droplet deformation process on a conductor surface, different types of corona discharge are visualized when AC voltage is applied on a line-ground electrode system. The corona characteristics are closely related to the applied voltage and water supply rate. With the increase of AC voltage, the positive Taylor cone discharge firstly appears and then disappears, replaced by the dripping and crashing discharge. Furthermore, the number of pulses in each pulse train increases with the increase of applied voltage. The mechanism of the transfer from the positive Taylor cone discharge to the dripping and crashing discharge is found to be related to the oscillation process of the water droplet. The water supply rate also has a great influence on the characteristics of corona currents. The number of positive pulse trains increases linearly when the water supply rate gets larger, leading to a higher audible noise and radio interference level from the AC corona, which is quite different from that of the DC corona. The difference between the AC and DC coronas under rainfall conditions is analyzed finally.

Cosmic Shear With ACS Pure Parallels

Science.gov (United States)

Rhodes, Jason

2002-07-01

Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan textiti {F775W} we will measure for the first time: beginlistosetlength sep0cm setlengthemsep0cm setlengthopsep0cm em the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

Internal Heating of an IGBT module in a System With a Regenerative AC Drive

OpenAIRE

Mabano, Michel

2016-01-01

The purpose of this thesis was to understand the internal heating of an IGBT module inside an AC drive in a system with a regenerative unit to it. During the implementation of the lab, various approaches were taken in an effort to collect measurements appropriate to the topic of investigation. The IGBT junction temperature was recorded over a sustained period of time at various speed of the induction motor. The braking torque applied through a second AC drive was varied in order to study...

AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

Design and synthesis of 225Ac radioimmunopharmaceuticals

International Nuclear Information System (INIS)

McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.

2002-01-01

The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans

Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly

International Nuclear Information System (INIS)

Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production

Marketingová komunikace AC Sparta Praha

OpenAIRE

Fanta, Jan

2016-01-01

Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...

Clinical significance of determination of serum hypersensitive C reactive protein (HS-CRP) levels in patients with acute coronary syndrome (ACS)

International Nuclear Information System (INIS)

Zhai Chunxi; Zhang Fengju; Wang Kejun

2005-01-01

Objective: To study the relationship between changes in serum HS-CRP levels and the status of atherosclerotic plaques in patients with ACS. Methods: Serum HS-CRP levels were measured in 35 patients with ACS at admission, 1 week and 1 month later as well as in 30 controls without recent infection. Results: HS-CRP levels in patients with ACS were significantly higher than those in the controls (P<0.01). The levels were highest at admission and fell gradually. Conclusion: HS-CRP could be a marker reflecting the status of atherosclerotic plaques in patients with ACS. (authors)

Susceptibility to Peer Influence: Using a Performance-Based Measure to Identify Adolescent Males at Heightened Risk for Deviant Peer Socialization

Science.gov (United States)

Prinstein, Mitchell J.; Brechwald, Whitney A.; Cohen, Geoffrey L.

2011-01-01

A substantial amount of research has suggested that adolescents' attitudes and behaviors are influenced by peers; however, little is known regarding adolescents' individual variability, or susceptibility, to peer influence. In this study, a performance-based index from an experimental paradigm was used to directly measure adolescents'…

Brain Potentials and Personality: A New Look at Stress Susceptibility.

Science.gov (United States)

1987-09-01

disinhibition (Dis) measures a hedonistic , extraverted lifestyle including drinking, parties, sex, and gambling; boredom susceptibility (BS) indicates an...adventure seeking; ES = Experience seeking; Dis = Disinhibition; BS = Boredom susceptibility. 1 14 I N i*5’ Table 4 Correlation of Auditory Evoked...20. aTAS = Thrill and adventure seeking; ES = Experience seeking; Dis = Disinhibition; BS = Boredom susceptibility. < .05. 15 I The present study

Property and microstructural nonuniformity in the yttrium-barium-copper-oxide superconductor determined from electrical, magnetic, and ultrasonic measurements

International Nuclear Information System (INIS)

Roth, D.J.

1991-01-01

This dissertation is presented in two major chapters. In the first chapter, the use of ultrasonic velocity for estimating pore fraction in YBCO and other polycrystalline materials is reviewed, modeled, and statistically analyzed. This chapter provides the basis for using ultrasonic velocity to interrogate microstructure. In the second chapter, (1) the effect of pore fraction (0.10-0.25) on superconductor properties of YBCO samples is characterized, (2) spatial (within-sample) variations in microstructure and superconductor properties are investigated and (3) the effect of oxygen content on elastic behavior is examined. Experimental methods used included a.c. susceptibility, electrical, and ultrasonic-velocity measurements. Superconductor properties measured included transition temperature, magnetic transition width, transport and magnetic critical current density, magnetic shielding, a.c. loss, and sharpness of the voltage-current characteristic. Superconductor properties including within-sample uniformity were generally poorest for samples containing the lowest (0.10) pore fraction. Ultrasonic velocity was linearly related to pore fraction thereby allowing sample classification. Changes in superconducting behavior were observed consistent with changes in oxygen content

AC electrical conductivity in amorphous indium selenide thin films

International Nuclear Information System (INIS)

Di Giulio, H.; Rella, R.; Tepore, A.

1987-01-01

In order to obtain additional information about the nature of the conduction mechanism in amorphous InSe films results of an experimental study concerning the frequency and temperature dependence of the ac conductivity are reported. The measurements were performed on specimens of different thickness and different electrode contact areas. The results can be explained assuming that conduction occurs by phonon-assisted hopping between localized states near the Fermi level

Advanced DC/AC inverters applications in renewable energy

CERN Document Server

Luo, Fang Lin

2013-01-01

DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

Ao38, a new cell line from eggs of the black witch moth, Ascalapha odorata (Lepidoptera: Noctuidae, is permissive for AcMNPV infection and produces high levels of recombinant proteins

Directory of Open Access Journals (Sweden)

Zhang Sheng

2010-07-01

Full Text Available Abstract Background The insect cell line is a critical component in the production of recombinant proteins in the baculovirus expression system and new cell lines hold the promise of increasing both quantity and quality of protein production. Results Seventy cell lines were established by single-cell cloning from a primary culture of cells derived from eggs of the black witch moth (Ascalapha odorata; Lepidoptera, Noctuidae. Among 8 rapidly growing lines, cell line 38 (Ao38 was selected for further analysis, based on susceptibility to AcMNPV infection and production of secreted alkaline phosphatase (SEAP from a baculovirus expression vector. In comparisons with low-passage High Five (BTI-Tn-5B1-4 cells, infected Ao38 cells produced β-galactosidase and SEAP at levels higher (153% and 150%, respectively than those measured from High Five cells. Analysis of N-glycans of SEAP produced in Ao38 cells revealed two N-glycosylation sites and glycosylation patterns similar to those reported for High Five and Sf9 cells. Glycopeptide isoforms consisted of pauci- or oligomannose, with and without fucose on N-acetylglucosamine(s linked to asparagine residues. Estimates of Ao38 cell volume suggest that Ao38 cells are approximately 2.5× larger than Sf9 cells but only approximately 74% of the size of High Five cells. Ao38 cells were highly susceptible to AcMNPV infection, similar to infectivity of Sf9 cells. Production of infectious AcMNPV budded virions from Ao38 cells peaked at approximately 4.5 × 107 IU/ml, exceeding that from High Five cells while lower than that from Sf9 cells. Ao38 cells grew rapidly in stationary culture with a population doubling time of 20.2 hr, and Ao38 cells were readily adapted to serum-free medium (Sf-900III and to a suspension culture system. Analysis of Ao38 and a parental Ascalapha odorata cell line indicated that these lines were free of the alphanodavirus that was recently identified as an adventitious agent in High Five cell

AC and DC electrical behavior of MWCNT/epoxy nanocomposite near percolation threshold: Equivalent circuits and percolation limits

Science.gov (United States)

Alizadeh Sahraei, Abolfazl; Ayati, Moosa; Baniassadi, Majid; Rodrigue, Denis; Baghani, Mostafa; Abdi, Yaser

2018-03-01

This study attempts to comprehensively investigate the effects of multi-walled carbon nanotubes (MWCNTs) on the AC and DC electrical conductivity of epoxy nanocomposites. The samples (0.2, 0.3, and 0.5 wt. % MWCNT) were produced using a combination of ultrason and shear mixing methods. DC measurements were performed by continuous measurement of the current-voltage response and the results were analyzed via a numerical percolation approach, while for the AC behavior, the frequency response was studied by analyzing phase difference and impedance in the 10 Hz to 0.2 MHz frequency range. The results showed that the dielectric parameters, including relative permittivity, impedance phase, and magnitude, present completely different behaviors for the frequency range and MWCNT weight fractions studied. To better understand the nanocomposites electrical behavior, equivalent electric circuits were also built for both DC and AC modes. The DC equivalent networks were developed based on the current-voltage curves, while the AC equivalent circuits were proposed by using an optimization problem according to the impedance magnitude and phase at different frequencies. The obtained equivalent electrical circuits were found to be highly useful tools to understand the physical mechanisms involved in MWCNT filled polymer nanocomposites.

Binding Site Concentration Explains the Differential Susceptibility of Chilo suppressalis and Sesamia inferens to Cry1A-Producing Rice

OpenAIRE

Han, Lanzhi; Han, Chao; Liu, Zewen; Chen, Fajun; Jurat-Fuentes, Juan Luis; Hou, Maolin; Peng, Yufa

2014-01-01

Chilo suppressalis and Sesamia inferens are two important lepidopteran rice pests that occur concurrently during outbreaks in paddy fields in the main rice-growing areas of China. Previous and current field tests demonstrate that the transgenic rice line Huahui 1 (HH1) producing a Cry1Ab-Cry1Ac hybrid toxin from the bacterium Bacillus thuringiensis reduces egg and larval densities of C. suppressalis but not of S. inferens. This differential susceptibility to HH1 rice correlates with the reduc...

A single-phase embedded Z-source DC-AC inverter.

Science.gov (United States)

Kim, Se-Jin; Lim, Young-Cheol

2014-01-01

In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.

Liquid helium boil-off measurements of heat leakage from sinter-forged BSCCO current leads under DC and AC conditions

International Nuclear Information System (INIS)

Cha, Y.S.; Niemann, R.C.; Hull, J.R.; Youngdahl, C.A.; Lanagan, M.T.; Nakade, M.; Hara, T.

1995-06-01

Liquid helium boil-off experiments are conducted to determine the heat leakage rate of a pair of BSCCO 2223 high-temperature superconductor current leads made by sinter forging. The experiments are carried out in both DC and AC conditions and with and without an intermediate heat intercept. Current ranges are from 0-500 A for DC tests and 0-1,000 A rms for AC tests. The leads are self-cooled. Results show that magnetic hysteresis (AC) losses for both the BSCCO leads and the low-temperature superconductor current jumper are small for the current range. It is shown that significant reduction in heat leakage rate (liquid helium boil-off rate) is realized by using the BSCCO superconductor leads. At 100 A, the heat leakage rate of the BSCCO/copper binary lead is approximately 29% of that of the conventional copper lead. Further reduction in liquid helium boil-off rate can be achieved by using an intermediate heat intercept. For example, at 500 K, the heat leakage rate of the BSCCO/copper binary lead is only 7% of that of the conventional copper lead when an intermediate heat intercept is used

Adapting AC Lines to DC Grids for Large-Scale Renewable Power Transmission

Directory of Open Access Journals (Sweden)

D. Marene Larruskain

2014-10-01

Full Text Available All over the world, governments of different countries are nowadays promoting the use of clean energies in order to achieve sustainable energy systems. In this scenario, since the installed capacity is continuously increasing, renewable sources can play an important role. Notwithstanding that, some important problems may appear when connecting these sources to the grid, being the overload of distribution lines one of the most relevant. In fact, renewable generation is usually connected to the nearest AC grid, although this HV system may not have been designed considering distributed generation. In the particular case of large wind farms, the electrical grid has to transmit all the power generated by wind energy and, as a consequence, the AC system may get overloaded. It is therefore necessary to determine the impact of wind power transmission so that appropriate measures can be taken. Not only are these measures influenced by the amount of power transmitted, but also by the quality of the transmitted power, due to the output voltage fluctuation caused by the highly variable nature of wind. When designing a power grid, although AC systems are usually the most economical solution because of its highly proven technology, HVDC may arise in some cases (e.g. offshore wind farms as an interesting alternative, offering some added values such as lower losses and better controllability. This way, HVDC technology can solve most of the aforementioned problems and has a good potential for future use. Additionally, the fast development of power electronics based on new and powerful semiconductor devices allow the spread of innovative technologies, such as VSC-HVDC, which can be applied to create DC grids. This paper focuses on the main aspects involved in adapting the existing overhead AC lines to DC grids, with the objective of improving the transmission of distributed renewable energy to the centers of consumption.

AC losses in a type II superconductor strip with inhomogeneous critical current distribution

International Nuclear Information System (INIS)

Tsukamoto, Osami

2005-01-01

Analytical formulae derived by Brandt and Indenbom (1993 Phys. Rev. B 48 12893-906) and Norris (1970 J. Phys. D: Appl. Phys. 3 489-507) are often used to calculate the magnetization and AC transport current losses in HTS strip conductors, respectively. In these formulae, homogeneous distribution of critical sheet current density σ c in the strip is assumed. However, it is considered that σ c distributions are inhomogeneous in actual HTS strips and that the inhomogeneous σ c distributions cause deviations of the measured AC loss data of actual HTS strips from those formulae. A semi-analytical method to calculate AC transport current and magnetization losses is derived for a type II superconductor strip with inhomogeneous distribution of σ c in the direction of the strip width. The method is derived modifying the analysis of Brandt et al. The validity of the semi-analytical method is shown by comparing the results calculated by this method with those calculated by the Norris and Brandt formulae and by a different method of our previous work and also with experimental data. Moreover, it is shown that the deviation of the measured data from the Norris and Brandt models can be estimated by assuming proper σ c distributions

Effect of alkali content on AC conductivity of borate glasses containing two transition metals

International Nuclear Information System (INIS)

Kashif, I.; Rahman, Samy A.; Soliman, A.A.; Ibrahim, E.M.; Abdel-Khalek, E.K.; Mostafa, A.G.; Sanad, A.M.

2009-01-01

Sodium borate glasses containing iron and molybdenum ions with the total concentration of transition ions constant and gradual substitution of sodium oxide (network modifier) by borate oxide (network former) was prepared. Densities, molar volume, DC and AC conductivities are measured. The trends of these properties are attributed to changes in the glass network structure. Their DC and AC conductivity increased with increasing NaO concentration. The increase of AC conductivity of sodium borate glasses is attributed to the chemical composition and the hopping mechanism of conduction. Measurements of the dielectric constant (ε) and dielectric loss (tan δ) as a function of frequency (50 Hz-100 kHz) and temperature (RT-600 K) indicate that the increase in dielectric constant and loss (ε and tan δ) values with increasing sodium ion content could be attributed to the assumption that Fe and Mo ions tend to assume network-forming position in the glass compositions studied. The variation of the value of frequency exponent s for all glass samples as the function of temperature at a definite frequency indicates that the value of s decreases with increasing the temperature which agrees with the correlated barrier-hopping (CBH) model.

dc Arc Fault Effect on Hybrid ac/dc Microgrid

Science.gov (United States)

Fatima, Zahra

The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

MAPC transplantation confers a more durable benefit than AC133+ cell transplantation in severe hind limb ischemia.

Science.gov (United States)

Aranguren, Xabier L; Pelacho, Beatriz; Peñuelas, Ivan; Abizanda, Gloria; Uriz, Maialen; Ecay, Margarita; Collantaes, María; Araña, Miriam; Beerens, Manu; Coppiello, Giulia; Prieto, Inés; Perez-Ilzarbe, Maitane; Andreu, Enrique J; Luttun, Aernout; Prósper, Felipe

2011-01-01

There is a need for comparative studies to determine which cell types are better candidates to remedy ischemia. Here, we compared human AC133(+) cells and multipotent adult progenitor cells (hMAPC) in a mouse model reminiscent of critical limb ischemia. hMAPC or hAC133(+) cell transplantation induced a significant improvement in tissue perfusion (measured by microPET) 15 days posttransplantation compared to controls. This improvement persisted for 30 days in hMAPC-treated but not in hAC133(+)-injected animals. While transplantation of hAC133(+) cells promoted capillary growth, hMAPC transplantation also induced collateral expansion, decreased muscle necrosis/fibrosis, and improved muscle regeneration. Incorporation of differentiated hAC133(+) or hMAPC progeny into new vessels was limited; however, a paracrine angio/arteriogenic effect was demonstrated in animals treated with hMAPC. Accordingly, hMAPC-conditioned, but not hAC133(+)-conditioned, media stimulated vascular cell proliferation and prevented myoblast, endothelial, and smooth muscle cell apoptosis in vitro. Our study suggests that although hAC133(+) cell and hMAPC transplantation both contribute to vascular regeneration in ischemic limbs, hMAPC exert a more robust effect through trophic mechanisms, which translated into collateral and muscle fiber regeneration. This, in turn, conferred tissue protection and regeneration with longer term functional improvement. © 2011 Cognizant Comm. Corp.

Tobacco Marketing, E-cigarette Susceptibility, and Perceptions among Adults.

Science.gov (United States)

Nicksic, Nicole E; Snell, L Morgan; Rudy, Alyssa K; Cobb, Caroline O; Barnes, Andrew J

2017-09-01

Understanding the impact of tobacco marketing on e-cigarette (EC) susceptibility and perceptions is essential to inform efforts to mitigate tobacco product burden on public health. Data were collected online in 2016 from 634 conventional cigarette (CC) smokers and 393 non-smokers using a convenience sample from Amazon Mechanical Turk. Logistic regression models, stratified by smoking status and adjusted for socio-demographics, examined the relationship among tobacco advertisements and coupons, EC and CC susceptibility, and EC perceptions. Among non-smokers, increased exposure to tobacco advertising and receiving tobacco coupons was significantly related to measures of EC and CC susceptibility (p marketing reduce EC use by decreasing susceptibility.

Magnetic susceptibility of YbN

International Nuclear Information System (INIS)

Zhou, Y.; Bowen, S.P.; Koelling, D.D.; Monnier, R.

1991-01-01

Applying the Zwicknagl, Zevin, and Fulde (ZZF) approximation for the spectral densities of the occupied and empty f states resulting from a degenerate-Anderson-impurity model, which incorporates crystal fields, we compute the low-temperature magnetic susceptibility of YbN. The model, in which each crystal-field level couples to the band states with its own hybridization function, has previously been successfully applied without the ZZF approximation to explain the specific-heat structure at low temperatures. The ZZF approximation removes the spurious zero-temperature behavior of the parent noncrossing approximation for the susceptibility. Surprisingly, even at the low crystal-field degeneracy (N=2) of YbN, the Shiba relation is very nearly satisfied. The appropriate experimental impurity susceptibility for comparison is extracted from the measurement by removing an empirical exchange interaction. The resultant Kondo temperature (T 0 =8.49 K) is consistent with previous specific-heat estimates (10--11 K), and the agreement with experiment is good

AcEST: DK963038 [AcEST

Lifescience Database Archive (English)

Full Text Available tr_hit_id A5WW09 Definition tr|A5WW09|A5WW09_DANRE Novel protein similar to autism susceptibility candidate ... Novel protein similar to autism susceptib... 42 0.028 tr|A9H6U3|A9H6U3_GLUDA Put...Putative uncharacterized protein OS=Planc... 33 9.9 >tr|A5WW09|A5WW09_DANRE Novel protein similar to autism

Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.

Science.gov (United States)

Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide

2015-10-01

Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Data for spatial characterization of AC signal propagation over primary neuron dendrites

Directory of Open Access Journals (Sweden)

Hojeong Kim

2016-03-01

Full Text Available Action potentials generated near the soma propagate not only into the axonal nerve connecting to the adjacent neurons but also into the dendrites interacting with a diversity of synaptic inputs as well as voltage gated ion channels. Measuring voltage attenuation factors between the soma and all single points of the dendrites in the anatomically reconstructed primary neurons with the same cable properties, we report the signal propagation data showing how the alternating current (AC signal such as action potentials back-propagates over the dendrites among different types of primary neurons. Fitting equations and their parameter values for the data are also presented to quantitatively capture the spatial profile of AC signal propagation from the soma to the dendrites in primary neurons. Our data is supplemental to our original study for the dependency of dendritic signal propagation and excitability, and their relationship on the cell type-specific structure in primary neurons (DOI: 10.1016/j.neulet.2015.10.017 [1]. Keywords: Primary neurons, Dendritic signal processing, AC signal propagation, Voltage attenuation analysis

Effect of structural transition on magnetic susceptibility of tantalum carbide

International Nuclear Information System (INIS)

Lipatnikov, V.N.; Gusev, A.I.; Rempel', A.A.; Shvejkin, G.P.

1987-01-01

Ordering of carbon atoms and vacancies in nonmetal sublattice of TaC y is investigated for the first time by methods of magnetic susceptibility and structural neutron diffraction analysis. Measurements of magnetic susceptibility were conducted on high-sensitive magnetic scales in temperature interval of 300 - 1300 K with holding at each temperature up to the establishment of constant, nonchanging in the course of time value of susceptibility x. When investigating x-hardened tantalum carbide within the interval of TaC 0.82 - TaC 0.85 compositions under the conditions of slow heating, it was observed nonrecorded earlier irreversible decrease of susceptibility at temperature of 960 - 1000 K. With further temperature increase T>T tr it was observed at first even and than uneven increase of x value at a temperature of T tr equal to 1090, 1130 and 1150 K for TaC 0.82 , TaC 0.83 and TaC 0.85 respectively. The measuring of magnetic susceptibility of the same samples at temperature decrease reveals the presence of susceptibility temperature hysteresis in the interval of 1070 - 1090, 1100 - 1130 and 1120 - 1150 for TaC 0.82 , TaC 0.83 and TaC 0.85 . Reversible susceptibility jump corresponding to the temperature hysteresis range at dependences of x(T), is connected with equilibrium structural phase transition of order-disorder

AC loss in superconducting wires operating in a wind turbine like generator

DEFF Research Database (Denmark)

Seiler, Eugen; Zirngibl, Thomas; Mijatovic, Nenad

2010-01-01

We have manufactured a small circular superconducting coil impregnated with epoxy fibreglass. The coil was wound from a Bi-2223/Ag superconducting wire and it was tested in liquid nitrogen at 77 K. Current-voltage characteristic and the AC losses of the coil were measured and compared...

Loss optimizing low power 50 Hz transformers intended for AC/DC standby power supplies

DEFF Research Database (Denmark)

Nielsen, Nils

2004-01-01

This paper presents the measured efficiency on selected low power conventional 50 Hz/230 V-AC transformers. The small transformers are intended for use in 1 W@5 V-DC series- or buck-regulated power supplies for standby purposes. The measured efficiency is compared for cheap off-the-self transformer...

Superconducting three element synchronous ac machine