WorldWideScience

Sample records for ac stark shifts

  1. External versus self-induced ac Stark shift

    Science.gov (United States)

    Gil, L.; Lippi, G. L.

    2015-07-01

    An oscillating electromagnetic (e.m.) field driving a dipole transition induces a well-known energy level shift, commonly described in a dressed state representation [1]. Experimentally, the effect arises when irradiating a sample (atomic, molecular, etc.) with an e.m. field which is resonant (or quasi-resonant) with a transition between energy levels. The source of the e.m. field is, in such a case, unaffected by the interaction and the field's amplitude (or intensity) is used by the experimenter as a control parameter to vary the level shift. Even in those situations where one (or multiple) pump field(s) and one (or multiple) probe field(s) are employed, the picture remains the same, regardless of the more complex mathematical description of the levels involved: the e.m. field amplitude remains an independent control parameter. This is by far the most common situation encountered in spectroscopy when studying an energy level shift.

  2. ac Stark shift and dephasing of a superconducting qubit strongly coupled to a cavity field.

    Science.gov (United States)

    Schuster, D I; Wallraff, A; Blais, A; Frunzio, L; Huang, R-S; Majer, J; Girvin, S M; Schoelkopf, R J

    2005-04-01

    We have performed spectroscopy of a superconducting charge qubit coupled nonresonantly to a single mode of an on-chip resonator. The strong coupling induces a large ac Stark shift in the energy levels of both the qubit and the resonator. The dispersive shift of the resonator frequency is used to nondestructively determine the qubit state. Photon shot noise in the measurement field induces qubit level fluctuations leading to dephasing which is characteristic for the measurement backaction. A crossover in line shape with measurement power is observed and theoretically explained. For weak measurement a long intrinsic dephasing time of T2>200 ns of the qubit is found.

  3. The ac stark shift and space-borne rubidium atomic clocks

    Science.gov (United States)

    Formichella, V.; Camparo, J.; Sesia, I.; Signorile, G.; Galleani, L.; Huang, M.; Tavella, P.

    2016-11-01

    Due to its small size, low weight, and low power consumption, the Rb atomic frequency standard (RAFS) is routinely the first choice for atomic timekeeping in space. Consequently, though the device has very good frequency stability (rivaling passive hydrogen masers), there is interest in uncovering the fundamental processes limiting its long-term performance, with the goal of improving the device for future space systems and missions. The ac Stark shift (i.e., light shift) is one of the more likely processes limiting the RAFS' long-term timekeeping ability, yet its manifestation in the RAFS remains poorly understood. In part, this comes from the fact that light-shift induced frequency fluctuations must be quantified in terms of the RAFS' light-shift coefficient and the output variations in the RAFS' rf-discharge lamp, which is a nonlinear inductively-couple plasma (ICP). Here, we analyze the light-shift effect for a family of 10 on-orbit Block-IIR GPS RAFS, examining decade-long records of their on-orbit frequency and rf-discharge lamp fluctuations. We find that the ICP's light intensity variations can take several forms: deterministic aging, jumps, ramps, and non-stationary noise, each of which affects the RAFS' frequency via the light shift. Correlating these light intensity changes with RAFS frequency changes, we estimate the light-shift coefficient, κLS, for the family of RAFS: κLS = -(1.9 ± 0.3) × 10-12/%. The 16% family-wide variation in κLS indicates that while each RAFS may have its own individual κLS, the variance of κLS among similarly designed RAFS can be relatively small. Combining κLS with our estimate of the ICP light intensity's non-stationary noise, we find evidence that random-walk frequency noise in high-quality space-borne RAFS is strongly influenced by the RAFS' rf-discharge lamp via the light shift effect.

  4. Wave-function analysis of dynamic cancellation of ac Stark shifts in optical lattice clocks by use of pulsed Raman and electromagnetically-induced-transparency techniques

    International Nuclear Information System (INIS)

    Yoon, Tai Hyun

    2007-01-01

    We study analytically the dynamic cancellation of ac Stark shift in the recently proposed pulsed electromagnetically-induced-transparency (EIT-)Raman optical lattice clock based on the wave-function formalism. An explicit expression for the time evolution operator corresponding to the effective two-level interaction Hamiltonian has been obtained in order to explain the atomic phase shift cancellation due to the ac Stark shift induced by the time-separated laser pulses. We present how to determine an optimum value of the common detuning of the driving fields at which the atomic phase shift cancels completely with the parameters for the practical realization of the EIT-Raman optical lattice clock with alkaline-earth-metal atoms

  5. A controlled ac Stark echo for quantum memories.

    Science.gov (United States)

    Ham, Byoung S

    2017-08-09

    A quantum memory protocol of controlled ac Stark echoes (CASE) based on a double rephasing photon echo scheme via controlled Rabi flopping is proposed. The double rephasing scheme of photon echoes inherently satisfies the no-population inversion requirement for quantum memories, but the resultant absorptive echo remains a fundamental problem. Herein, it is reported that the first echo in the double rephasing scheme can be dynamically controlled so that it does not affect the second echo, which is accomplished by using unbalanced ac Stark shifts. Then, the second echo is coherently controlled to be emissive via controlled coherence conversion. Finally a near perfect ultralong CASE is presented using a backward echo scheme. Compared with other methods such as dc Stark echoes, the present protocol is all-optical with advantages of wavelength-selective dynamic control of quantum processing for erasing, buffering, and channel multiplexing.

  6. A controlled ac Stark echo for quantum memories

    OpenAIRE

    Ham, Byoung S.

    2017-01-01

    A quantum memory protocol of controlled ac Stark echoes (CASE) based on a double rephasing photon echo scheme via controlled Rabi flopping is proposed. The double rephasing scheme of photon echoes inherently satisfies the no-population inversion requirement for quantum memories, but the resultant absorptive echo remains a fundamental problem. Herein, it is reported that the first echo in the double rephasing scheme can be dynamically controlled so that it does not affect the second echo, whic...

  7. Stark shifting two-electron quantum dot

    International Nuclear Information System (INIS)

    Dineykhan, M.; Zhaugasheva, S.A.; Duysebaeva, K.S.

    2003-01-01

    Advances in modern technology make it possible to create semiconducting nano-structures (quantum dot) in which a finite number of electrons are 'captured' in a bounded volume. A quantum dot is associated with a quantum well formed at the interface, between two finite-size semiconductors owing to different positions of the forbidden gaps on the energy scale in these semiconductors. The possibility of monitoring and controlling the properties of quantum dots attracts considerable attention to these objects, as a new elemental basis for future generations of computers. The quantum-mechanical effects and image potential play a significant role in the description of the formation mechanism quantum dot, and determined the confinement potential in a two-electron quantum dot only for the spherical symmetric case. In the present talk, we considered the formation dynamics of two-electron quantum dot with violation of spherical symmetry. So, we have standard Stark potential. The energy spectrum two-electron quantum dot were calculated. Usually Stark interactions determined the tunneling phenomena between quantum dots

  8. Measurement of Stark Shift of Potassium D Lines

    Science.gov (United States)

    Kawamura, Masayuki; Jin, Wei-Guo; Takahashi, Nobuyuki; Minowa, Tatsuya

    2009-03-01

    High-resolution atomic-beam laser spectroscopy has been performed to study the Stark effect of K atoms. A compact electrode apparatus has been developed to produce a stable and strong electric field. The Stark shifts of the D1 and D2 lines as well as the splitting of the D2 line have been measured and found to be proportional to the square of the electric field. The scalar polarizability of the D1 line and the scalar and tensor polarizabilities of the D2 line have been determined to be αs (4 p{2}P1/2) -αs (4s{2}S1/2)=81.3± 2.4 kHz/(kV/cm)2, αs (4 p{2}P3/2) -αs (4s{2}S1/2)=93.0± 2.5 kHz/(kV/cm)2, and αt (4 p{2}P3/2)=-27.6± 0.7 kHz/(kV/cm)2, respectively, providing a crosscheck of the previously reported values.

  9. Dynamics and maintenance of bipartite entanglement via the Stark shift effect inside dissipative reservoirs

    Science.gov (United States)

    Golkar, S.; Tavassoly, M. K.

    2018-03-01

    In this paper, the exact entanglement dynamics are obtained of two two-level atoms with two-photon transitions accompanied by the Stark shift, where each atom is independently coupled to a dissipative reservoir at zero temperature. The results show that, in the presence of Stark shift, entanglement can be preserved for a long time and the decoherence process of entanglement slows down. In particular, we find that while the Stark shift has a constructive effect on entanglement protection for both Markovian and non-Markovian reservoirs, this positive effect can be more visible in the non-Markovian reservoir even with low Stark shift parameter values.

  10. Stark shift of impurity doped quantum dots: Role of noise

    Science.gov (United States)

    Arif, Sk. Md.; Bera, Aindrila; Ghosh, Anuja; Ghosh, Manas

    2018-02-01

    Present study makes a punctilious investigation of the profiles of Stark shift (SS) of doped GaAs quantum dot (QD) under the supervision of Gaussian white noise. A few physical parameters have been varied and the consequent variations in the SS profiles have been monitored. The said physical parameters comprise of magnetic field, confinement potential, dopant location, dopant potential, noise strength, aluminium concentration (only for AlxGa1-x As alloy QD), position-dependent effective mass (PDEM), position-dependent dielectric screening function (PDDSF), anisotropy, hydrostatic pressure (HP) and temperature. The SS profiles unfurl interesting features that heavily depend upon the particular physical quantity concerned, presence/absence of noise and the manner (additive/multiplicative) noise enters the system. The study highlights feasible means of maximizing SS of doped QD in presence of noise by suitable adjustment of several control parameters. The study deems importance in view of technological applications of QD devices where noise plays some prominent role.

  11. Ionization spectra of highly Stark-shifted rubidium Rydberg states

    Science.gov (United States)

    Grimmel, Jens; Stecker, Markus; Kaiser, Manuel; Karlewski, Florian; Torralbo-Campo, Lara; Günther, Andreas; Fortágh, József

    2017-07-01

    We report on the observation and numerical calculation of ionization spectra of highly Stark-shifted Rydberg states of rubidium beyond the classical ionization threshold. In the numerical calculations, a complex absorbing potential (CAP) allows us to predict the energy levels and ionization rates of Rydberg states in this regime. Our approach of adjusting the CAP to the external electric field reduces the number of free parameters from one per resonance to a single one. Furthermore, we have measured the ionization spectra of magneto-optically trapped rubidium atoms which are excited to principal quantum numbers of 43 and 70 at various electric fields. The emerging ions are detected using an ion optics. We find good agreement between the numerically and experimentally obtained spectra.

  12. AC Stark cooling of C 2 - ion in penning trap using Simbuca

    CERN Document Server

    Cui, Hao

    2016-01-01

    This article is going to summarize work I did in my 2 month project on AC Stark cooling simulation, and the object is to help my colleague carry on it and make further progress. In this article, I will meanly explain the formula I used, the content and flowchart of my c++ code, some conclusion and knowledge we obtained about cooling efficiency from our simulation, and some important tips we noticed before.

  13. BBR-induced Stark shifts and level broadening in a helium atom

    Science.gov (United States)

    Zalialiutdinov, T.; Solovyev, D.; Labzowsky, L.

    2018-01-01

    The precise calculations of blackbody radiation (BBR)-induced Stark shifts and depopulation rates for low-lying states of a helium atom with the use of the variational approach are presented. An effect of the BBR-induced Stark-mixing of energy levels is considered. It is shown that this effect leads to a significant reduction in the lifetimes of helium-excited states. As a consequence, the influence of the Stark-mixing effect on the decay rates of metastable states in helium is discussed in the context of formation processes of the cosmic microwave background.

  14. Stark shift and g-factor tuning in nanowires with Rashba effect

    International Nuclear Information System (INIS)

    Alhaddad, Iman; Habanjar, Khulud; Sakr, M.R.

    2015-01-01

    We report on the Stark shift of the energy subbands and the possibility of tuning the g-factor of electrons in nanowires subjected to external magnetic field. The electric field is applied along the direction of quantum confinement. Our analysis is based on numerical and perturbation calculations in the weak Rashba regime. For in-plane magnetic fields, the Stark shift is rigid and depends on the square of the electric field. Such rigid shift results in a field independent g-factor. Perpendicular magnetic fields induce a similar Stark shift accompanied by a lateral displacement of the energy spectra that is linear in the electric field. In this case, the g-factor shows square dependence on weak electric fields that varies with the subband index. However, in strong electric fields, the g-factor becomes subband independent and varies linearly with the field. - Highlights: • Energy spectra of electrons in nanowires are calculated in the weak Rashba regime. • For in-plane magnetic field, the Stark shift is rigid and the g-factor cannot be tuned. • Perpendicular magnetic fields add lateral displacement to the Stark shift. • The g-factor can be tuned by external electric field in this case. • The tuning of the g-factor is linear and unique for all subbands at high fields

  15. Strong-field ionization of polar molecules: Stark-shift-corrected strong-field approximation

    DEFF Research Database (Denmark)

    Dimitrovski, Darko; Martiny, Christian P. J.; Madsen, Lars Bojer

    2010-01-01

    We extend the molecular strong-field approximation for ionization, in the tunneling limit, to include systematically the linear and quadratic static Stark shifts of the ionizing molecular orbital. This approach, simple to implement, is capable of describing the essential physics of the process of...

  16. Estimate of the Stark shift by penetrating ions within the nearest perturber approximation for hydrogenlike spectral lines in plasmas

    Science.gov (United States)

    Sanders, P.; Oks, E.

    2017-12-01

    Red shifts of spectral lines (hereafter, SL) play an important role in astrophysics. For inferring the relativistic red shifts from the observed red shifts it is required to allow for the Stark shift of SL. In laboratory plasmas, measurements of the Stark shift can supplement measurements of the Stark width and thus enhance plasma diagnostics—specifically the determination of the electron density. In the present paper we describe a new source of the Stark shift of hydrogenlike SL. It originates from configurations where the nearest perturbing ion is within the radiating atom/ion (‘penetrating configurations’). As an example, we compare the results with the experimental shift of the Balmer-alpha SL of He II 1640 A measured in a laboratory plasma by Pittman and Fleurier (1986 Phys. Rev. A 33 1291). We show that the allowance for this new additional red shift leads to a good agreement with the measured shift for the entire range of the electron density employed in that experiment, while without this new shift the previously known shifts underestimated the measured shift by factors between two and five.

  17. Ac Stark effect for short-range potentials with intense electromagnetic fields

    International Nuclear Information System (INIS)

    Bardsley, J.N.; Comella, M.J.

    1989-01-01

    The energy spectrum of a charged particle bound by a short-range potential and subjected to an intense ac electromagnetic field is computed by using complex coordinates within the Floquet formalism. As the field strength is raised, additional discrete states appear and the lifetime of the states increase. The adequacy of a high-frequency model of the strong-field spectra is assessed

  18. Molecular quantum mechanical gradients within the polarizable embedding approach—Application to the internal vibrational Stark shift of acetophenone

    DEFF Research Database (Denmark)

    List, Nanna Holmgaard; Beerepoot, Maarten; Olsen, Jógvan Magnus Haugaard

    2015-01-01

    We present an implementation of analytical quantum mechanical molecular gradients within the polarizable embedding (PE) model to allow for efficient geometry optimizations and vibrational analysis of molecules embedded in large, geometrically frozen environments. We consider a variational ansatz...... for the quantum region, covering (multiconfigurational) self-consistent-field and Kohn–Sham density functional theory. As the first application of the implementation, we consider the internal vibrational Stark effect of the C=O group of acetophenone in different solvents and derive its vibrational linear Stark...... and water is essential in order to capture the structural modifications and the associated frequency shifts observed in water. For more apolar solvents, a proper description of dispersion and exchange–repulsion becomes increasingly important, and the quality of the optimized structures relies to a larger...

  19. Stark shift and photoionization cross section of on-center and off-center donor impurity in a core/shell ellipsoidal quantum dot

    Science.gov (United States)

    Shi, L.; Yan, Z. W.

    2018-04-01

    Within the framework of the effective-mass approximation and by using a variational method, the Stark shift of on-center and off-center donor impurity binding energies and photoionization cross section under a z-direction electric field in a prolate (oblate) core/shell ellipsoidal quantum dot has been studied. We have calculated the Stark shift as a function of the core and shell sizes and shapes, electric field, and impurity position. We also discuss the photoionization cross section as a function of photon energy with different core and shell sizes and shapes, electric field strengths, and impurity positions. The results show that the Stark shift depends strongly on the impurity position, it could be positive or negative. The core and shell sizes and shapes also have a pronounce influence on the Stark shift, and the Stark shift changes with them is non-monotonic, especially when the impurity is located at the -z-axis, the situation will become complicated. In addition, the core and shell sizes and shapes, impurity position, and electric field also have an important influence on the photoionization cross section. In particular, the photoionization cross section will vanish when the impurity is located at center of spherical core with spherical or prolate shell case at zero field.

  20. AC system stabilization via phase shift transformer with thyristor commutation

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Jose Carlos de; Guimaraes, Geraldo Caixeta; Moraes, Adelio Jose [Uberlandia Univ., MG (Brazil); Abreu, Jose Policarpo G. de [Escola Federal de Engenharia de Itajuba, MG (Brazil); Oliveira, Edimar Jose de [Juiz de Fora Univ., MG (Brazil)

    1994-12-31

    This article aims to present initially the constructive and operative forms of a phase-shift autotransformer which provides both magnitude and phase angle change through thyristor commutation, including a technic to reduce the number of thyristors. Following, it is proposed a control system to make such equipment an efficient AC system stabilizing tool. It is presented some simulation results to show the operation of this transformer in an electrical system. (author) 3 refs., 11 figs., 3 tabs.

  1. Balancing the dynamic Stark shift in a driven Jaynes-Cummings system

    International Nuclear Information System (INIS)

    Mogilevtsev, D; Kilin, S

    2004-01-01

    In this work we discuss the possibility of balancing a dynamic Shark shift in a Jaynes-Cummings system by simultaneously driving the cavity and the atom with classical fields, of the same frequency. For a lossless Jaynes-Cummings system this can lead to unusual atomic population dynamics. For a lossy Jaynes-Cummings system such balancing can lead to complete suppression of resonance fluorescence even for leaky cavities

  2. Estimation of the blackbody-radiation shift due to the Stark effect for the microwave +113Cd ion clock

    Science.gov (United States)

    Yu, Yan-mei; Sahoo, B. K.

    2017-11-01

    The microwave clock frequency of the |5 s 2S1 /2,F =0 ,mF=0 〉↔|5 s 2S1 /2,F =1 ,mF=0 〉 transition in the +113Cd ion has been reported as 15 199 862 855.0192(10) Hz [Opt. Lett. 40, 4249 (2015), 10.1364/OL.40.004249]. Fractional systematic shift (β ) due to the black-body radiation (BBR) arising from the Stark effect in the above, the clock transition was used as -1.1 ×10-16 from our unpublished preliminary estimation. We present here a precise value of β =-1.815 (77 ) ×10-16 by carrying out rigorous calculations of third-order polarizabilities of the hyperfine levels associated with the clock transition. This is determined by evaluating the matrix elements of the magnetic dipole hyperfine interaction Hamiltonian, electric dipole operator, and energies between many low-lying states of +113Cd. We employ all-order relativistic many-body theories in the frameworks of Fock-space coupled-cluster and relativistic multiconfiguration Dirac-Fock methods.

  3. Measured Stark widths and shifts of the neutral argon spectral lines in 4s-4p and 4s-4p' transitions

    International Nuclear Information System (INIS)

    Milosavljevic, V.; Ellingboe, A.R.; Djenize, S.

    2006-01-01

    We investigate the Stark widths (W) and the shift (d), of the seven neutral argon (Ar I) spectral lines from the 4s-4p and 4s-4p' transitions. The line shapes are measured in a linear, low-pressure, optically thin pulsed arc discharge at about 16 000 K electron temperature (T) and about 7.0 x 10 22 m -3 electron density (N). The new data separates the electron width (W e ) and ion width W i from the total Stark width (W t ), as well the separation of electron total Stark shift (d t ) on electron (d e ) and ion (d i ) parts. There are no theoretical predictions for these lines. Comparison to theoretical predictions for other lines within the same multiplets finds that the experimental data exhibits stronger influence by the ion contribution to the measured Ar I line shape. We have also deduced the ion broadening parameters which describe the influence of the ion static (A) and the ion-dynamical (D and E) effect on the width and the shift of the line shape. Applying the line deconvolution procedure, the basic plasma parameters i.e. electron temperature (T) and electron density (N) are recovered. The plasma parameters (T and N) are measured using independent diagnostics techniques as well. Good agreement is found among two sets of the N and T plasma parameters obtained from deconvolution procedure and independent diagnostics techniques

  4. Orthogonal Electric Field Measurements near the Green Fluorescent Protein Fluorophore through Stark Effect Spectroscopy and pKa Shifts Provide a Unique Benchmark for Electrostatics Models.

    Science.gov (United States)

    Slocum, Joshua D; First, Jeremy T; Webb, Lauren J

    2017-07-20

    Measurement of the magnitude, direction, and functional importance of electric fields in biomolecules has been a long-standing experimental challenge. pK a shifts of titratable residues have been the most widely implemented measurements of the local electrostatic environment around the labile proton, and experimental data sets of pK a shifts in a variety of systems have been used to test and refine computational prediction capabilities of protein electrostatic fields. A more direct and increasingly popular technique to measure electric fields in proteins is Stark effect spectroscopy, where the change in absorption energy of a chromophore relative to a reference state is related to the change in electric field felt by the chromophore. While there are merits to both of these methods and they are both reporters of local electrostatic environment, they are fundamentally different measurements, and to our knowledge there has been no direct comparison of these two approaches in a single protein. We have recently demonstrated that green fluorescent protein (GFP) is an ideal model system for measuring changes in electric fields in a protein interior caused by amino acid mutations using both electronic and vibrational Stark effect chromophores. Here we report the changes in pK a of the GFP fluorophore in response to the same mutations and show that they are in excellent agreement with Stark effect measurements. This agreement in the results of orthogonal experiments reinforces our confidence in the experimental results of both Stark effect and pK a measurements and provides an excellent target data set to benchmark diverse protein electrostatics calculations. We used this experimental data set to test the pK a prediction ability of the adaptive Poisson-Boltzmann solver (APBS) and found that a simple continuum dielectric model of the GFP interior is insufficient to accurately capture the measured pK a and Stark effect shifts. We discuss some of the limitations of this

  5. Study of ac loss in Bi-2223/Ag tape under the simultaneous action of ac transport current and ac magnetic field shifted in phase

    International Nuclear Information System (INIS)

    Vojenciak, M; Souc, J; Ceballos, J M; Goemoery, F; Klincok, B; Pardo, E; Grilli, F

    2006-01-01

    Investigation of ac loss under the simultaneous action of the transport ac current and the external ac magnetic field is of prime importance for the reliable prediction of dissipation in electric power devices such as motors/generators, transformers and transmission cables. An experimental rig allowing us to perform ac loss measurements in such conditions, on short (10 cm) tape samples of high-temperature superconductor Bi-2223/Ag, was designed and tested. Both the electromagnetic and thermal methods were incorporated, allowing us to combine the better sensitivity of the former and the higher reliability of the latter. Our main aim was to see how the ac loss depends on the phase shift between the transport current and the external magnetic field. Such a shift could have different values in various applications. While in a transformer winding, the maximum phase shift at full load will probably not exceed a few degrees, in a three phase transmission cable in tri-axial configuration it is around 120 0 . Therefore, we explored the whole range of phase shifts from 0 to 360 0 . Surprisingly, the maxima of dissipation did not coincide with zero shift as expected from qualitative considerations

  6. The STARK-B database VAMDC node: a repository for spectral line broadening and shifts due to collisions with charged particles

    Science.gov (United States)

    Sahal-Bréchot, S.; Dimitrijević, M. S.; Moreau, N.; Ben Nessib, N.

    2015-05-01

    Accurate spectroscopic diagnostics and modeling require the knowledge of numerous collisional line profiles. Access to such data via an online database has become indispensable. The STARK-B database is aimed at meeting these needs for widths and shifts of isolated lines of neutral and ionized elements due to electron and ion impacts. This database of the Paris Observatory is a result of scientific cooperation between S Sahal-Bréchot (LERMA) and M S Dimitrijević (AOB). Access to it is free, and it was opened online at the end of 2008. STARK-B is a node of the Virtual Atomic and Molecular Data Centre (VAMDC) and thus complies with VAMDC and Virtual Observatory standards. VAMDC is a European Union-funded collaboration among groups involved in the generation and use of interoperable atomic and molecular data. STARK-B now contains all our semiclassical-perturbation (SCP) calculated data for more than 123 neutral or ionized elements as published in international refereed journals. It is devoted to modeling and spectroscopic diagnostics of stellar atmospheres and envelopes, laboratory plasmas, laser equipment, and technological plasmas. Hence, the range of temperatures and densities covered by the tables is broad and depends on the ionization degree of the radiating atom. The modified semiempirical (MSE) results of calculations have begun to be implemented. In this paper, we highlight the key points of the method and the assumptions used in the calculations, which have lately been revisited. Then we present the database and its recent developments, as well as our ongoing work and our plans for the future.

  7. The STARK-B database VAMDC node: a repository for spectral line broadening and shifts due to collisions with charged particles

    International Nuclear Information System (INIS)

    Sahal-Bréchot, S; Moreau, N; Dimitrijević, M S; Nessib, N Ben

    2015-01-01

    Accurate spectroscopic diagnostics and modeling require the knowledge of numerous collisional line profiles. Access to such data via an online database has become indispensable. The STARK-B database is aimed at meeting these needs for widths and shifts of isolated lines of neutral and ionized elements due to electron and ion impacts. This database of the Paris Observatory is a result of scientific cooperation between S Sahal-Bréchot (LERMA) and M S Dimitrijević (AOB). Access to it is free, and it was opened online at the end of 2008. STARK-B is a node of the Virtual Atomic and Molecular Data Centre (VAMDC) and thus complies with VAMDC and Virtual Observatory standards. VAMDC is a European Union-funded collaboration among groups involved in the generation and use of interoperable atomic and molecular data. STARK-B now contains all our semiclassical-perturbation (SCP) calculated data for more than 123 neutral or ionized elements as published in international refereed journals. It is devoted to modeling and spectroscopic diagnostics of stellar atmospheres and envelopes, laboratory plasmas, laser equipment, and technological plasmas. Hence, the range of temperatures and densities covered by the tables is broad and depends on the ionization degree of the radiating atom. The modified semiempirical (MSE) results of calculations have begun to be implemented. In this paper, we highlight the key points of the method and the assumptions used in the calculations, which have lately been revisited. Then we present the database and its recent developments, as well as our ongoing work and our plans for the future. (paper)

  8. Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Aquila, A. Dell’; Liserre, Marco

    2004-01-01

    of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...

  9. Vacuum-induced Stark shifts for quantum logic using a collective system in a high-quality dispersive cavity

    International Nuclear Information System (INIS)

    Gabris, A.; Agarwal, G.S.

    2005-01-01

    A collective system of atoms in a high-quality cavity can be described by a nonlinear interaction which arises due to the Lamb shift of the energy levels due to the cavity vacuum [Agarwal et al., Phys. Rev. A 56, 2249 (1997)]. We show how this collective interaction can be used to perform quantum logic. In particular we produce schemes to realize controlled-NOT gates not only for two-qubit but also for three-qubit systems. We also discuss realizations of Toffoli gates. Our effective Hamiltonian is also realized in other systems such as trapped ions or magnetic molecules

  10. Fluxing as a new tool for bitumen rheological characterization and the use of time-concentration shift factor (ac)

    CSIR Research Space (South Africa)

    Zoorob, SE

    2018-01-01

    Full Text Available . By applying time-concentration superposition to each flux content, it was possible to shift horizontally (ac) each set of complex modulus data measured at each test temperature, so that all sets superimpose onto the master curve of the base bitumen at a...

  11. Valley-selective optical Stark effect probed by Kerr rotation

    Science.gov (United States)

    LaMountain, Trevor; Bergeron, Hadallia; Balla, Itamar; Stanev, Teodor K.; Hersam, Mark C.; Stern, Nathaniel P.

    2018-01-01

    The ability to monitor and control distinct states is at the heart of emerging quantum technologies. The valley pseudospin in transition metal dichalcogenide (TMDC) monolayers is a promising degree of freedom for such control, with the optical Stark effect allowing for valley-selective manipulation of energy levels in WS2 and WSe2 using ultrafast optical pulses. Despite these advances, understanding of valley-sensitive optical Stark shifts in TMDCs has been limited by reflectance-based detection methods where the signal is small and prone to background effects. More sensitive polarization-based spectroscopy is required to better probe ultrafast Stark shifts for all-optical manipulation of valley energy levels. Here, we show time-resolved Kerr rotation to be a more sensitive probe of the valley-selective optical Stark effect in monolayer TMDCs. Compared to the established time-resolved reflectance methods, Kerr rotation is less sensitive to background effects. Kerr rotation provides a fivefold improvement in the signal-to-noise ratio of the Stark effect optical signal and a more precise estimate of the energy shift. This increased sensitivity allows for observation of an optical Stark shift in monolayer MoS2 that exhibits both valley and energy selectivity, demonstrating the promise of this method for investigating this effect in other layered materials and heterostructures.

  12. Pressure dependence of side chain 13C chemical shifts in model peptides Ac-Gly-Gly-Xxx-Ala-NH2.

    Science.gov (United States)

    Beck Erlach, Markus; Koehler, Joerg; Crusca, Edson; Munte, Claudia E; Kainosho, Masatsune; Kremer, Werner; Kalbitzer, Hans Robert

    2017-10-01

    For evaluating the pressure responses of folded as well as intrinsically unfolded proteins detectable by NMR spectroscopy the availability of data from well-defined model systems is indispensable. In this work we report the pressure dependence of 13 C chemical shifts of the side chain atoms in the protected tetrapeptides Ac-Gly-Gly-Xxx-Ala-NH 2 (Xxx, one of the 20 canonical amino acids). Contrary to expectation the chemical shifts of a number of nuclei have a nonlinear dependence on pressure in the range from 0.1 to 200 MPa. The size of the polynomial pressure coefficients B 1 and B 2 is dependent on the type of atom and amino acid studied. For H N , N and C α the first order pressure coefficient B 1 is also correlated to the chemical shift at atmospheric pressure. The first and second order pressure coefficients of a given type of carbon atom show significant linear correlations suggesting that the NMR observable pressure effects in the different amino acids have at least partly the same physical cause. In line with this observation the magnitude of the second order coefficients of nuclei being direct neighbors in the chemical structure also are weakly correlated. The downfield shifts of the methyl resonances suggest that gauche conformers of the side chains are not preferred with pressure. The valine and leucine methyl groups in the model peptides were assigned using stereospecifically 13 C enriched amino acids with the pro-R carbons downfield shifted relative to the pro-S carbons.

  13. AC/DC electrical conduction and dielectric properties of PMMA/PVAc/C60 down-shifting nanocomposite films

    Science.gov (United States)

    El-Bashir, S. M.; Alwadai, N. M.; AlZayed, N.

    2018-02-01

    Polymer nanocomposite films were prepared by doping fullerene C60 in polymer blend composed of polymethacrylate/polyvinyl acetate blends (PMMA/PVAc) using solution cast technique. The films were characterized by differential scanning calorimeter (DSC), Transmission electron microscope (TEM), DC/AC electrical conductivity and dielectric measurements in the frequency range (100 Hz- 1 MHz). The glass transition temperature, Tg, was increased by increasing the concentration of fullerene C60; this property reflects the increase of thermal stability by increasing the nanofiller content. The DC and AC electrical conductivities were enhanced by increasing C60 concentration due to the electron hopping or tunneling between filled and empty localized states above Tg. The relaxation time was determined from the αβ -relaxations and found to be attenuated by increasing the temperature as a typical behavior of amorphous polymers. The calculated values of thermodynamic parameters revealed the increase of molecular stability by increasing the doping concentration; this feature supports the application of PMMA/PVAc/C60 nanocomposite films in a wide scale of solar energy conversion applications such as luminescent down-shifting (LDS) coatings for photovoltaic cells.

  14. Pressure dependence of backbone chemical shifts in the model peptides Ac-Gly-Gly-Xxx-Ala-NH2.

    Science.gov (United States)

    Erlach, Markus Beck; Koehler, Joerg; Crusca, Edson; Kremer, Werner; Munte, Claudia E; Kalbitzer, Hans Robert

    2016-06-01

    For a better understanding of nuclear magnetic resonance (NMR) detected pressure responses of folded as well as unstructured proteins the availability of data from well-defined model systems are indispensable. In this work we report the pressure dependence of chemical shifts of the backbone atoms (1)H(α), (13)C(α) and (13)C' in the protected tetrapeptides Ac-Gly-Gly-Xxx-Ala-NH2 (Xxx one of the 20 canonical amino acids). Contrary to expectation the chemical shifts of these nuclei have a nonlinear dependence on pressure in the range from 0.1 to 200 MPa. The polynomial pressure coefficients B 1 and B 2 are dependent on the type of amino acid studied. The coefficients of a given nucleus show significant linear correlations suggesting that the NMR observable pressure effects in the different amino acids have at least partly the same physical cause. In line with this observation the magnitude of the second order coefficients of nuclei being direct neighbors in the chemical structure are also weakly correlated.

  15. Tilt Angle and the Temperature Shifts Calculated as a Function of Concentration for the AC* Phase Transition in a Binary Mixture of Liquid Crystals

    Science.gov (United States)

    Yurtseven, H.; Kurt, M.

    We study here the tilt angle and the temperature shifts as a function of concentration for the AC* phase transition in a binary mixture, using our mean field model with the biquadratic P2θ2 coupling — and also with the bilinear Pθ and P2θ2 couplings. By expanding the free energy in terms of the tilt angle and polarization, the tilt angle and the temperature shift are evaluated by using the coefficients given in the free energy expansion. By employing a concentration-dependent coefficient, the tilt angle and the temperature shift are calculated as a function of concentration of 10.O.4 for the SmAC* transition in a binary mixture of C7 and 10.O.4. Our calculated values of the tilt angle and the temperature shifts decrease as the concentration of 10.O.4 increases, as confirmed experimentally for the AC* transition in this binary mixture. This indicates that our mean field models studied here are satisfactory to explain the observed behavior of the AC* transition of the binary mixture of C7 and 10.O.4.

  16. Scattering theory for Stark Hamiltonians

    International Nuclear Information System (INIS)

    Jensen, Arne

    1994-01-01

    An introduction to the spectral and scattering theory for Schroedinger operators is given. An abstract short range scattering theory is developed. It is applied to perturbations of the Laplacian. Particular attention is paid to the study of Stark Hamiltonians. The main result is an explanation of the discrepancy between the classical and the quantum scattering theory for one-dimensional Stark Hamiltonians. (author). 47 refs

  17. Stark Broadening Parameters for Neutral Oxygen Spectral Lines

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... The atomic data have been taken from the TOPbase and NIST atomic databases. The electron and proton Stark widths and shifts ... Department of Physics and Astronomy, College of Science, King Saud University, P. O. Box 2455, Riyadh 11451, Saudi Arabia. LERMA, Observatoire de Paris, PSL Research ...

  18. Stark effect and polarizability of graphene quantum dots

    DEFF Research Database (Denmark)

    Pedersen, Thomas Garm

    2017-01-01

    The properties of graphene quantum dots can be manipulated via lateral electric fields. Treating electrons in such structures as confined massless Dirac fermions, we derive an analytical expression for the quadratic Stark shift valid for arbitrary angular momentum and quantum dot size. Moreover, we...

  19. Stark Effect of Alkali Atoms by Laser Spectroscopy

    Science.gov (United States)

    Kawamura, Masayuki; Jin, Wei-Guo; Minowa, Tatsuya; Takahashi, Nobuyuki

    2009-03-01

    Stark effect of alkali atoms has been studied by means of high-resolution atomic-beam laser spectroscopy. A compact electrode apparatus has been developed in order to produce a stable and strong electric field. The Stark shifts and splittings of the D lines have been measured for K, Rb and Cs atoms. The scalar polarizabilities of the K and Rb D1 lines and the scalar and tensor polarizabilities of the K and Cs D2 lines have been determined, providing a crosscheck of the previously reported values.

  20. Stark resonances in disordered systems

    International Nuclear Information System (INIS)

    Grecchi, V.; Maioli, M.; Modena Univ.; Sacchetti, A.

    1992-01-01

    By slightly restricting the conditions given by Herbst and Howland, we prove the existence of resonances in the Stark effect of disordered systems (and atomic crystals) for large atomic mean distance. In the crystal case the ladders of resonances have the Wannier behavior for small complex field. (orig.)

  1. Hydrogen Stark Broadened Brackett lines

    Directory of Open Access Journals (Sweden)

    C. Stehlé

    2010-01-01

    Full Text Available Stark-broadened lines of the hydrogen Brackett series are computed for the conditions of stellar atmospheres and circumstellar envelopes. The computation is performed within the Model Microfield Method, which includes the ion dynamic effects and makes the bridge between the impact limit at low density and the static limit at high density and in the line wings. The computation gives the area normalized line shape, from the line core up to the static line wings.

  2. Experimental and theoretical investigation of the Stark effect for manipulating cold molecules: Application to nitric oxide

    International Nuclear Information System (INIS)

    Bichsel, Bryan J.; Morrison, Michael A.; Shafer-Ray, Neil; Abraham, E. R. I.

    2007-01-01

    As part of an ongoing investigation of cold-molecule collisions involving nitric oxide (NO), we here theoretically assess the first- and second-order perturbation-theory approximations to the Stark shifts; such approximations have been used almost exclusively in previous published research on NO in external electric fields. We perform this assessment by comparison to Stark shifts from the corresponding nonperturbative two-state model, considering field strengths from zero to values typical of current experimental studies of cold molecules. To facilitate the future use of this model, we give expressions for the Stark energies in a generic form that can trivially be applied to any molecules in the class under consideration. To provide insight into the validity of the two-state model, we also experimentally assess the two-state Stark shifts for NO

  3. Stark effect in finite-barrier quantum wells, wires, and dots

    International Nuclear Information System (INIS)

    Pedersen, Thomas Garm

    2017-01-01

    The properties of confined carriers in low-dimensional nanostructures can be controlled by external electric fields and an important manifestation is the Stark shift of quantized energy levels. Here, a unifying analytic theory for the Stark effect in arbitrary dimensional nanostructures is presented. The crucial role of finite potential barriers is stressed, in particular, for three-dimensional confinement. Applying the theory to CdSe quantum dots, finite barriers are shown to improve significantly the agreement with experiments. (paper)

  4. Anomalous broadening and shift of emission lines in a femtosecond laser plasma filament in air

    Science.gov (United States)

    Ilyin, A. A.; Golik, S. S.; Shmirko, K. A.; Mayor, A. Yu.; Proschenko, D. Yu.

    2017-12-01

    The temporal evolution of the width and shift of N I 746.8 and O I 777.4 nm lines is investigated in a filament plasma produced by a tightly focused femtosecond laser pulse (0.9 mJ, 48 fs). The nitrogen line shift and width are determined by the joint action of electron impact shift and the far-off resonance AC Stark effect. The intensive (I = 1.2·1010 W/cm2) electric field of ASE (amplified spontaneous emission) and post-pulses result in a possible LS coupling break for the O I 3p 5P level and the generation of Rabi sidebands. The blueshifted main femtosecond pulse and Rabi sideband cause the stimulated emission of the N2 1+ system. The maximal widths of emission lines are approximately 6.7 times larger than the calculated Stark widths.

  5. Valley-selective optical Stark effect in monolayer WS2

    Science.gov (United States)

    Gedik, Nuh

    Monolayer semiconducting transition-metal dichalcogenides (TMDs) have a pair of valleys that, by time-reversal symmetry, are energetically degenerate. Lifting the valley degeneracy in these materials is of great interest because it would allow for valley specific band engineering and offer additional control in valleytronic applications. In this talk, I will show that circularly polarized light, which breaks time-reversal symmetry, can be used to lift the valley degeneracy by means of the optical Stark effect. We demonstrate that this effect is capable of raising the exciton level in monolayer TMD WS2 by as much as 18 meV in a controllable valley-selective manner. The resulting energy shift is extremely large, comparable to the shift that would be obtained using a very high magnetic field (approximately 100 Tesla). These results offer a novel way to control valley degree of freedom, and may provide a means to realize new valley-selective Floquet topological state of matter.

  6. Stark Broadening of Se IV, Sn IV, Sb IV and Te IV Spectral Lines

    Directory of Open Access Journals (Sweden)

    Milan S. Dimitrijević

    2018-03-01

    Full Text Available Stark broadening parameters, line width and shift, are needed for investigations, analysis and modelling of astrophysical, laboratory, laser produced and technological plasmas. Especially in astrophysics, due to constantly increasing resolution of satellite borne spectrographs, and large terrestrial telescopes, data on trace elements, which were previously insignificant, now have increasing importance. Using the modified semiempirical method of Dimitrijević and Konjević, here, Stark widths have been calculated for 2 Se IV, 6 Sn IV, 2 Sb IV and 1 Te IV transitions. Results have been compared with existing theoretical data for Sn IV. Obtained results will be implemented in the STARK-B database, which is also a part of Virtual atomic and molecular data center (VAMDC.

  7. Stark resonances: asymptotics and distributional Borel sum

    International Nuclear Information System (INIS)

    Caliceti, E.; Grecchi, V.; Maioli, M.

    1993-01-01

    We prove that the Stark effect perturbation theory of a class of bound states uniquely determines the position and the width of the resonances by Distributional Borel Sum. In particular the small field asymptotics of the width is uniquely related to the large order asymptotics of the perturbation coefficients. Similar results apply to all the ''resonances'' of the anharmonic and double well oscillators. (orig.)

  8. Electroreflectance investigations of quantum confined Stark effect in GaN quantum wells

    International Nuclear Information System (INIS)

    Drabinska, A; Pakula, K; Baranowski, J M; Wysmolek, A

    2010-01-01

    In this paper we present room temperature electroreflectance studies of GaN quantum wells (QWs) with different well width. The electroreflectance measurements were performed with external voltage applied to the structure therefore it was possible to tune the electric field inside QW up to its completely screening and furthermore even reversing it. The analysis of QW spectral lines showed the Stark shift dependence on applied voltage and well width reaching about 35 meV for highest voltage and widest well width. It was possible to obtain the condition of zero electric field in QW. Both broadening and amplitude of QW lines are minimal for zero electric field and increases for increasing electric field in QW. The energy transition is maximum for zero electric field and for increasing electric field it decreases due to Stark effect. Neither amplitude and broadening parameter nor energy transition does not depend on the direction of electric field. Only parameter that depends on the direction of electric field in QW is phase of the signal. The analysis of Franz-Keldysh oscillations (FKOs) from AlGaN barriers allowed to calculate the real electric field dependence on applied voltage and therefore to obtain the Stark shift dependence on electric field. The Stark shift reached from -12 meV to -35 meV for 450 kV/cm depending on the well width. This conditions were established for highest forward voltages therefore this is the value of electric field and Stark shift caused only by the intrinsic polarization of nitrides.

  9. The multichannel motional Stark effect diagnostic on TFTR

    International Nuclear Information System (INIS)

    Levinton, F.M.

    1992-07-01

    Although the q profile plays a key role in theories of instabilities and plasma equilibrium, it has been quite difficult to measure until the recent development of the motional Stark effect (MSE) diagnostic. A multichannel motional Stark effect polarimeter system has recently been installed on the Tokamak Fusion Test Reactor (TFTR). The diagnostic can measure the magnetic field pitch angle (γ p = tan -1 (B T )/(B p )) at ten radial locations. The doppler shifted D alpha radiation from a TFTR heating beam is viewed near tangential to the toroidal magnetic field via a re-entrant front surface reflecting mirror. The field of view covers from inboard of the magnetic axis to near the outboard edge of the plasma with a radial spatial resolution of 3--5 cm. A high throughput f/2 optics system results in an uncertainty for γ p of ∼0.1 degrees--0.2 degrees with a time resolution of ∼5--10 ms. Initial pinch angle profiles from TFTR have been obtained. The MSE data is consistent with the estimated magnetic axis position from external magnetic measurements and the q=1 radius is in good agreement with the inversion radius from the electron cyclotron emission temperature measurements

  10. The multichannel motional Stark effect diagnostic on TFTR

    Energy Technology Data Exchange (ETDEWEB)

    Levinton, F.M.

    1992-07-01

    Although the q profile plays a key role in theories of instabilities and plasma equilibrium, it has been quite difficult to measure until the recent development of the motional Stark effect (MSE) diagnostic. A multichannel motional Stark effect polarimeter system has recently been installed on the Tokamak Fusion Test Reactor (TFTR). The diagnostic can measure the magnetic field pitch angle ({gamma}{sub p} = tan{sup {minus}1} (B{sub T})/(B{sup p})) at ten radial locations. The doppler shifted D{sub alpha} radiation from a TFTR heating beam is viewed near tangential to the toroidal magnetic field via a re-entrant front surface reflecting mirror. The field of view covers from inboard of the magnetic axis to near the outboard edge of the plasma with a radial spatial resolution of 3--5 cm. A high throughput f/2 optics system results in an uncertainty for {gamma}{sub p} of {approximately}0.1{degrees}--0.2{degrees} with a time resolution of {approximately}5--10 ms. Initial pinch angle profiles from TFTR have been obtained. The MSE data is consistent with the estimated magnetic axis position from external magnetic measurements and the q=1 radius is in good agreement with the inversion radius from the electron cyclotron emission temperature measurements.

  11. Stark effect, polarizability, and electroabsorption in silicon nanocrystals

    Science.gov (United States)

    Bulutay, Ceyhun; Kulakci, Mustafa; Turan, Raşit

    2010-03-01

    Demonstrating the quantum-confined Stark effect (QCSE) in silicon nanocrystals (NCs) embedded in oxide has been rather elusive, unlike the other materials. Here, the recent experimental data from ion-implanted Si NCs is unambiguously explained within the context of QCSE using an atomistic pseudopotential theory. This further reveals that the majority of the Stark shift comes from the valence states which undergo a level crossing that leads to a nonmonotonic radiative recombination behavior with respect to the applied field. The polarizability of embedded Si NCs including the excitonic effects is extracted over a diameter range of 2.5-6.5 nm, which displays a cubic scaling, α=cDNC3 , with c=2.436×10-11C/(Vm) , where DNC is the NC diameter. Finally, based on intraband electroabsorption analysis, it is predicted that p -doped Si NCs will show substantial voltage tunability, whereas n -doped samples should be almost insensitive. Given the fact that bulk silicon lacks the linear electro-optic effect as being a centrosymmetric crystal, this may offer a viable alternative for electrical modulation using p -doped Si NCs.

  12. Atomic Models for Motional Stark Effects Diagnostics

    Energy Technology Data Exchange (ETDEWEB)

    Gu, M F; Holcomb, C; Jayakuma, J; Allen, S; Pablant, N A; Burrell, K

    2007-07-26

    We present detailed atomic physics models for motional Stark effects (MSE) diagnostic on magnetic fusion devices. Excitation and ionization cross sections of the hydrogen or deuterium beam traveling in a magnetic field in collisions with electrons, ions, and neutral gas are calculated in the first Born approximation. The density matrices and polarization states of individual Stark-Zeeman components of the Balmer {alpha} line are obtained for both beam into plasma and beam into gas models. A detailed comparison of the model calculations and the MSE polarimetry and spectral intensity measurements obtained at the DIII-D tokamak is carried out. Although our beam into gas models provide a qualitative explanation for the larger {pi}/{sigma} intensity ratios and represent significant improvements over the statistical population models, empirical adjustment factors ranging from 1.0-2.0 must still be applied to individual line intensities to bring the calculations into full agreement with the observations. Nevertheless, we demonstrate that beam into gas measurements can be used successfully as calibration procedures for measuring the magnetic pitch angle through {pi}/{sigma} intensity ratios. The analyses of the filter-scan polarization spectra from the DIII-D MSE polarimetry system indicate unknown channel and time dependent light contaminations in the beam into gas measurements. Such contaminations may be the main reason for the failure of beam into gas calibration on MSE polarimetry systems.

  13. Stark Broadening of Cr III Spectral Lines: DO White Dwarfs

    Directory of Open Access Journals (Sweden)

    Milan S. Dimitrijević

    2018-04-01

    Full Text Available Using the modified semiempirical method of Dimitrijević and Konjević, Stark widths have been calculated for six Cr III transitions, for an electron density of 10 17 cm ‒ 3 and for temperatures from 5000–80,000 K. Results have been used for the investigation of the influence of Stark broadening on spectral lines in cool DO white dwarf atmospheres. Calculated Stark widths will be implemented in the STARK-B database, which is also a part of the Virtual Atomic and Molecular Data Center (VAMDC.

  14. A Plasma Edge Electron Density Diagnostic Based on a Doppler-free Measurement of Stark Broadening

    Science.gov (United States)

    Zafar, Abdullah; Martin, Elijah; Shannon, Steve

    2017-10-01

    Passive spectroscopic measurements of Stark broadening have been reliably used to determine electron density for decades. A low-density limit of 1e19 m-3 exists using these passive techniques due to Doppler and instrument broadening. At Oak Ridge National Laboratory, a novel diagnostic approach for measuring electron density using Stark broadening is currently under development and is capable of extending the low-density limit to 1e16 m-3 . The diagnostic is based on measuring the spectral line profile of a Balmer series transition using Doppler-free saturation spectroscopy, a laser-based absorption technique. The spectrum is then fit to a quantum mechanical model using the Explicit Zeeman Stark Spectral Simulator (EZSSS) code to extract the electron density. The increased sensitivity to the electron density is realized because Doppler-free saturation spectroscopy (DFSS) can greatly reduce the Doppler broadening and essentially eliminate the instrument broadening. DFSS has been successfully employed to measure spectral data in a magnetized (500-800 G), low temperature (5 eV), low density (1e17-1e18 m-3), He/H2 and He/CH4 plasma in the mTorr pressure range. Experimentally measured pi and sigma H-alpha spectra, fit using the EZSSS code, will be presented. A quantitative model to accurately predict crossover peaks and dips will also be given. This work was supported by the US. D.O.E. contract DE-AC05-00OR22725.

  15. Reframing violence against women as a human rights violation: Evan Stark's Coercive Control.

    Science.gov (United States)

    Libal, Kathryn; Parekh, Serena

    2009-12-01

    Evan Stark claims that partner-perpetrated physical abuse and other forms of violence against women ought to be understood as a human rights violation. The authors engage Stark's rhetorically powerful political and analytical innovation by outlining one theoretical and one practical challenge to shifting the paradigm that researchers, advocates, and policy makers use to describe, explain, and remedy the harms of coercive control from misdemeanor assault to human rights violation. The theoretical challenge involves overcoming the public/ private dichotomy that underpins liberal conceptions of human rights.The practical challenge involves using the human rights framework in the United States, given public indifference to human rights rhetoric or law, reluctance of U.S. policy makers to submit to scrutiny or justice-oriented processes under international law on issues of human rights and especially war crimes, and the consequent U.S. legacy of refusal to participate meaningfully in the international human rights process. The authors conclude that employing a human rights framework holds potential in the United States, but the paradigm shift Stark advocates will not materialize without widespread mobilization of interest in and understanding of human rights among domestic violence advocates and the society in general.

  16. Stark Widths of Spectral Lines of Neutral Neon

    Indian Academy of Sciences (India)

    be included in the STARK-B database, which is a part of the Virtual. Atomic and Molecular Data Center – VAMDC. Key words. Stark broadening—atomic ...... astrophysical plasma line shapes” supported by the Ministry of Education, Science and Technological Development of Serbia. It has also been supported by the Paris.

  17. Stark-like electron transfer between quantum wells

    International Nuclear Information System (INIS)

    Dubovis, S.A.; Voronko, A.N.; Basharov, A.M.

    2008-01-01

    The Stark-like mechanism of electron transfer between two energy subband localized in remote quantum wells is examined theoretically. Estimations of major parameters of the problem in case of delta-function-wells model are adduced. Schematic model allowing experimental study of Stark-like transfer is proposed

  18. Quantitative calibration of radiofrequency NMR Stark effects.

    Science.gov (United States)

    Tarasek, Matthew R; Kempf, James G

    2011-10-01

    Nuclear magnetic resonance (NMR) Stark responses can occur in quadrupolar nuclei for an electric field oscillating at twice the usual NMR frequency (2ω(0)). Calibration of responses to an applied E field is needed to establish nuclear spins as probes of native E fields within material and molecular systems. We present an improved approach and apparatus for accurate measurement of quadrupolar Stark effects. Updated values of C(14) (the response parameter in cubic crystals) were obtained for both (69)Ga and (75)As in GaAs. Keys to improvement include a modified implementation of voltage dividers to assess the 2ω(0) amplitude, |E|, and the stabilization of divider response by reduction of stray couplings in 2ω(0) circuitry. Finally, accuracy was enhanced by filtering sets of |E| through a linear response function that we established for the radiofrequency amplifier. Our approach is verified by two types of spectral results. Steady-state 2ω(0) excitation to presaturate NMR spectra yielded C(14) = (2.59 ± 0.06) × 10(12) m(-1) for (69)Ga at room-temperature and 14.1 T. For (75)As, we obtained (3.1 ± 0.1) × 10(12) m(-1). Both values reconcile with earlier results from 77 K and below 1 T, whereas current experiments are at room temperature and 14.1 T. Finally, we present results where few-microsecond pulses of the 2ω(0) field induced small (tens of Hz) changes in high-resolution NMR line shapes. There too, spectra collected vs |E| agree with the model for response, further establishing the validity of our protocols to specify |E|.

  19. Stark broadening parameters and transition probabilities of persistent lines of Tl II

    Science.gov (United States)

    de Andrés-García, I.; Colón, C.; Fernández-Martínez, F.

    2018-05-01

    The presence of singly ionized thallium in the stellar atmosphere of the chemically peculiar star χ Lupi was reported by Leckrone et al. in 1999 by analysis of its stellar spectrum obtained with the Goddard High Resolution Spectrograph (GHRS) on board the Hubble Space Telescope. Atomic data about the spectral line of 1307.50 Å and about the hyperfine components of the spectral lines of 1321.71 Å and 1908.64 Å were taken from different sources and used to analyse the isotopic abundance of thallium II in the star χ Lupi. From their results the authors concluded that the photosphere of the star presents an anomalous isotopic composition of Tl II. A study of the atomic parameters of Tl II and of the broadening by the Stark effect of its spectral lines (and therefore of the possible overlaps of these lines) can help to clarify the conclusions about the spectral abundance of Tl II in different stars. In this paper we present calculated values of the atomic transition probabilities and Stark broadening parameters for 49 spectral lines of Tl II obtained by using the Cowan code including core polarization effects and the Griem semiempirical approach. Theoretical values of radiative lifetimes for 11 levels (eight with experimental values in the bibliography) are calculated and compared with the experimental values in order to test the quality of our results. Theoretical trends of the Stark width and shift parameters versus the temperature for spectral lines of astrophysical interest are displayed. Trends of our calculated Stark width for the isoelectronic sequence Tl II-Pb III-Bi IV are also displayed.

  20. Multiphoton Rabi oscillations between highly excited Stark states of potassium

    International Nuclear Information System (INIS)

    He Yonglin

    2011-01-01

    We have applied a nonperturbative resonant theory to study the Rabi frequency of microwave multiphoton transitions between two Rydberg states of potassium in a static electric field. The Stark electric dipole moments used to calculate the Rabi frequency are determined by the Stark states' wave functions, which are obtained by the diagonalization method. The frequencies of the Rabi oscillations are in good agreement with either experimental ones or ones calculated by the time-dependent close-coupling method and the Floquet theory. Furthermore, we are able to show that the size of avoided crossings between the (n+2)s and (n,3) states can be predicted from the Stark electric dipole moment and the difference of the two Stark states' energy at a given resonance.

  1. Stark laws and fair market value exceptions: an introduction.

    Science.gov (United States)

    Siebrasse, Paul B

    2007-01-01

    This article will focus on one aspect of complexity in modern healthcare, namely the implications of Stark laws and other fraud and abuse provisions, including anti-kickback statutes and HIPAA. Also, this article explores the prevalence of fair market value as an exception in the Stark laws and discusses the meanings of those exceptions. Finally, the article explores basic approaches to assessing fair market value, including cost, income, and marketing approaches.

  2. Variable scaling method and Stark effect in hydrogen atom

    International Nuclear Information System (INIS)

    Choudhury, R.K.R.; Ghosh, B.

    1983-09-01

    By relating the Stark effect problem in hydrogen-like atoms to that of the spherical anharmonic oscillator we have found simple formulas for energy eigenvalues for the Stark effect. Matrix elements have been calculated using 0(2,1) algebra technique after Armstrong and then the variable scaling method has been used to find optimal solutions. Our numerical results are compared with those of Hioe and Yoo and also with the results obtained by Lanczos. (author)

  3. Extremely short pulses via stark modulation of the atomic transition frequencies.

    Science.gov (United States)

    Radeonychev, Y V; Polovinkin, V A; Kocharovskaya, Olga

    2010-10-29

    We propose a universal method to produce extremely short pulses of electromagnetic radiation in various spectral ranges. The essence of the method is a resonant interaction of radiation with atoms under the conditions of adiabatic periodic modulation of atomic transition frequencies by a far-off-resonant control laser field via dynamic Stark shift of the atomic levels and proper adjustment of the control field intensity and frequency, as well as the optical depth of the medium. The potential of the method is illustrated by an example in a hydrogenlike atomic system.

  4. Stark widths regularities within spectral series of sodium isoelectronic sequence

    Science.gov (United States)

    Trklja, Nora; Tapalaga, Irinel; Dojčinović, Ivan P.; Purić, Jagoš

    2018-02-01

    Stark widths within spectral series of sodium isoelectronic sequence have been studied. This is a unique approach that includes both neutrals and ions. Two levels of problem are considered: if the required atomic parameters are known, Stark widths can be calculated by some of the known methods (in present paper modified semiempirical formula has been used), but if there is a lack of parameters, regularities enable determination of Stark broadening data. In the framework of regularity research, Stark broadening dependence on environmental conditions and certain atomic parameters has been investigated. The aim of this work is to give a simple model, with minimum of required parameters, which can be used for calculation of Stark broadening data for any chosen transitions within sodium like emitters. Obtained relations were used for predictions of Stark widths for transitions that have not been measured or calculated yet. This system enables fast data processing by using of proposed theoretical model and it provides quality control and verification of obtained results.

  5. The σ-stark effect of rotational transitions : Part II: The microwave spectrum of methyl alcohol

    NARCIS (Netherlands)

    Dijkerman, H.A.; Dymanus, A.

    1962-01-01

    The method described in Part I is applied to absorption lines of methyl alcohol in the microwave region. Recorded ΔM = ± 1 Stark patterns of absorption lines with linear Stark effect are compared with calculated patterns. The ΔM = ± 1 Stark patterns of 7 absorption lines with second order Stark

  6. Simple Analytic Formula for the Stark Recurrence Spectrum

    Science.gov (United States)

    Flores-Rueda, Heric; Jensen, R. V.; Wright, J. D.; Morgan, T. J.

    2001-05-01

    Characterization of the structure of the recurrence spectrum in a strong electric field has attracted recent experimental and theoretical attention [1, 2]. Theoretical approaches have included a purely quantum mechanical explanation based on the regularities in the Stark photoabsorption spectrum, a semiquantal approach focusing on quantized energy levels and semiclassical ideas using closed orbit theory. In the present work we have used the results of our previous study [2] to find simple analytic formula that can be used to obtain the structure of the Stark recurrence spectrum. Both peak locations and amplitudes for Stark recurrences are found to be in good agreement when compared with experimental data for Rydberg Helium m = 1 states. Work supported by the National Science Foundation. [1] V. Kondratovich and J. Delos, Phys. Rev. A 57, 4604 (1998) [2] R. V. Jensen, H. Flores-Rueda, J. D. Wright, M. L. Keeler and T. J. Morgan, Phys. Rev. A 62, 53410 (2000)

  7. Influence of the dynamic Stark effect on long-term frequency stability of a self-oscillating magnetometer with laser-pumped alkali atoms

    Science.gov (United States)

    Baranov, A. A.; Ermak, S. V.; Kulachenkov, N. K.; Petrenko, M. V.; Sagitov, E. A.; Semenov, V. V.

    2017-11-01

    This paper presents the results of investigation Stark shift effect influence on the long-term stability of a dual scheme of quantum magnetometers. Such scheme allows suppressing Stark shift components when a certain pumping light polarization is applied. As a result, long-term stability of a quantum sensor increases. However, when low-frequency (LF) and microwave fields are attached to a single vapor cell a coherence circulation in hyperfine structure of alkali atoms takes place. Physical origin of this effect is associated with the so called “dressed” atom theory, when atom is “dressed” by LF field. It yields in multiphoton absorption and resonance frequency shift. First estimates for this shift based on density matrix evolution formalism are provided in the paper.

  8. Complex energies and the polyelectronic Stark problem

    Energy Technology Data Exchange (ETDEWEB)

    Themelis, Spyros I. [Theoretical and Physical Chemistry Institute, Hellenic Research Foundation, 48 Vas. Constantinou Ave., Athens 11635 (Greece)]. E-mail: stheme@eie.gr; Nicolaides, Cleanthes A. [Theoretical and Physical Chemistry Institute, Hellenic Research Foundation, 48 Vas. Constantinou Ave., Athens 11635 (Greece); Physics Department, National Technical University, Athens (Greece)]. E-mail: can@eie.gr

    2000-12-28

    The problem of computing the energy shifts and widths of ground or excited N-electron atomic states perturbed by weak or strong static electric fields is dealt with by formulating a state-specific complex eigenvalue Schroedinger equation (CESE), where the complex energy contains the field-induced shift and width. The CESE is solved to all orders nonperturbatively, by using separately optimized N-electron function spaces, composed of real and complex one-electron functions, the latter being functions of a complex coordinate. The use of such spaces is a salient characteristic of the theory, leading to economy and manageability of calculation in terms of a two-step computational procedure. The first step involves only Hermitian matrices. The second adds complex functions and the overall computation becomes non-Hermitian. Aspects of the formalism and of computational strategy are compared with those of the complex absorption potential (CAP) method, which was recently applied for the calculation of field-induced complex energies in H and Li. Also compared are the numerical results of the two methods, and the questions of accuracy and convergence that were posed by Sahoo and Ho (Sahoo S and Ho Y K 2000 J. Phys. B: At. Mol. Opt. Phys. 33 2195) are explored further. We draw attention to the fact that, because in the region where the field strength is weak the tunnelling rate (imaginary part of the complex eigenvalue) diminishes exponentially, it is possible for even large-scale nonperturbative complex eigenvalue calculations either to fail completely or to produce seemingly stable results which, however, are wrong. It is in this context that the discrepancy in the width of Li 1s{sup 2}2s {sup 2}S between results obtained by the CAP method and those obtained by the CESE method is interpreted. We suggest that the very-weak-field regime must be computed by the golden rule, provided the continuum is represented accurately. In this respect, existing one-particle semiclassical

  9. Vibrational Stark Effect to Probe the Electric-Double Layer of the Ionic Liquid-Metal Electrodes

    Science.gov (United States)

    Garcia Rey, Natalia; Moore, Alexander Knight; Toyouchi, Shuichi; Dlott, Dana

    2017-06-01

    Vibrational sum frequency generation (VSFG) spectroscopy is used to study the effect of room temperature ionic liquids (RTILs) in situ at the electrical double layer (EDL). RTILs have been recognized as electrolytes without solvent for applications in batteries, supercapacitors and electrodeposition^{1}. The molecular response of the RTIL in the EDL affects the performance of these devices. We use the vibrational Stark effect on CO as a probe to detect the changes in the electric field affected by the RTIL across the EDL on metal electrodes. The Stark effect is a shift in the frequency in response to an externally applied electric field and also influenced by the surrounding electrolyte and electrode^{2}. The CO Stark shift is monitored by the CO-VSFG spectra on Pt or Ag in a range of different imidazolium-based RTILs electrolytes, where their composition is tuned by exchanging the anion, the cation or the imidazolium functional group. We study the free induction decay (FID)^{3} of the CO to monitor how the RTIL structure and composition affect the vibrational relaxation of the CO. Combining the CO vibrational Stark effect and the FID allow us to understand how the RTIL electrochemical response, molecular orientation response and collective relaxation affect the potential drop of the electric field across the EDL, and, in turn, how determines the electrical capacitance or reactivity of the electrolyte/electrode interface. ^{1}Fedorov, M. V.; Kornyshev, A. A., Ionic Liquids at Electrified Interfaces. Chem. Rev. 2014, 114, 2978-3036. ^{2} (a) Lambert, D. K., Vibrational Stark Effect of Adsorbates at Electrochemical Interfaces. Electrochim. Acta 1996, 41, 623-630. (b) Oklejas, V.; Sjostrom, C.; Harris, J. M., SERS Detection of the Vibrational Stark Effect from Nitrile-Terminated SAMs to Probe Electric Fields in the Diffuse Double-Layer. J. Am. Chem. Soc. 2002, 124, 2408-2409. ^{3}Symonds, J. P. R.; Arnolds, H.; Zhang, V. L.; Fukutani, K.; King, D. A

  10. On the Stark Broadening of Lu III Spectral Lines

    Indian Academy of Sciences (India)

    1Faculty of Humanities and Social Sciences, University of Rijeka, 51000 Rijeka, Croatia. 2Astronomical Observatory, Volgina 7, 11060 Belgrade, Serbia. 3LERMA ..... and complete atomic data needed for the inclusion of Stark broadening mechanism in modeling of CP star and white dwarf atmospheres and synthesis of ...

  11. Rydberg-Stark states of Positronium for atom optics

    International Nuclear Information System (INIS)

    Alonso, A M; Cooper, B S; Deller, A; Hogan, S D; Wall, T E; Cassidy, D B

    2015-01-01

    Positronium atoms were produced in Rydberg states by means of a two-step optical excitation process (1s→2p→nd/ns). The n = 11 Rydberg-Stark manifold has been studied using different laser polarizations providing greater control over the electric dipole moment. (paper)

  12. Stark Widths of Spectral Lines of Neutral Neon

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... The obtained data will be included in the STARK-B database, which is a part of the Virtual Atomic and Molecular Data Center – VAMDC. ... University of Kosovska Mitrovica, Faculty of Natural Science and Mathematics, Department of Geography, Ive Lole Ribara 29, 38220 Kosovska Mitrovica, Serbia.

  13. Existence of the Stark-Wannier quantum resonances

    Energy Technology Data Exchange (ETDEWEB)

    Sacchetti, Andrea, E-mail: andrea.sacchetti@unimore.it [Department of Physics, Computer Sciences and Mathematics, University of Modena e Reggio Emilia, Modena (Italy)

    2014-12-15

    In this paper, we prove the existence of the Stark-Wannier quantum resonances for one-dimensional Schrödinger operators with smooth periodic potential and small external homogeneous electric field. Such a result extends the existence result previously obtained in the case of periodic potentials with a finite number of open gaps.

  14. THz quantum-confined Stark effect in semiconductor quantum dots

    DEFF Research Database (Denmark)

    Turchinovich, Dmitry; Monozon, Boris S.; Livshits, Daniil A.

    2012-01-01

    We demonstrate an instantaneous all-optical manipulation of optical absorption at the ground state of InGaAs/GaAs quantum dots (QDs) via a quantum-confined Stark effect (QCSE) induced by the electric field of incident THz pulses with peak electric fields reaching 200 kV/cm in the free space...

  15. The Stark effect of the Hydrogen Balmer-lines as a versatile tool for plasma diagnostics

    International Nuclear Information System (INIS)

    Helbig, V.

    2005-01-01

    The Stark effect offers the possibility to use the shift and the broadening of spectral lines to determine the strength of the electric field surrounding the radiating atoms. Depending on the plasma investigated the electric field may arise from the moving charged particles of the plasma itself or from the applied voltage of a power supply used to drive the discharge creating the plasma. In either case the Stark effect will be useful to deduce the plasma parameters desired. In the talk the results of experiments carried out in our research group at Kiel University will be discussed. Various plasma sources have been used for the investigations that cover a wide range of electron densities. In a second part electric field strength results will be communicated that were obtained in the cathode fall of a low density gas discharge. Plasma sources: Electron densities spanning a range of more than ten orders of magnitude were obtained in essentially five different gas discharges. Starting at low densities the Stark effect of the fine structure of Hydrogen was investigated in low pressure gas discharges. Intermediate densities could be obtained in hollow cathode arcs at low pressure. With constricted arcs at low and high pressure we were able to span the the region between several times 10 14 to 10 17 cm -3 . The highest electron densities were observed in laser produced plasmas and capillary discharges. Calibration: The shift and the broadening of the Balmer lines due to Stark effect can be used as diagnostic tool for determining the electron density of plasma with high accuracy. In order to do that you have either to rely on theoretical calculations of the Stark effect or you have to come up with a reliable and independent experimental way to calibrate your spectra. As experimentalists we were very much concerned with the second approach. However, it turns out that the different regions of the electron density require different experimental methods to measure the plasma

  16. On the Application of Stark Broadening Data Determined with a Semiclassical Perturbation Approach

    Directory of Open Access Journals (Sweden)

    Milan S. Dimitrijević

    2014-08-01

    Full Text Available The significance of Stark broadening data for problems in astrophysics, physics, as well as for technological plasmas is discussed and applications of Stark broadening parameters calculated using a semiclassical perturbation method are analyzed.

  17. Laser control of the radiationless decay in pyrazine using the dynamic Stark effect

    Science.gov (United States)

    Sala, Matthieu; Saab, Mohamad; Lasorne, Benjamin; Gatti, Fabien; Guérin, Stéphane

    2014-05-01

    The laser control of the radiationless decay between the B3u(nπ*) and B2u(ππ*) states of pyrazine using the dynamic Stark effect has been investigated. A vibronic coupling model Hamiltonian in diabatic representation, including potential energy, transition dipole, and static polarizability surfaces as a function of the four most important vibrational modes of the molecule has been parametrized using multi-reference electronic structure calculations. The interaction of the molecule with a strong non-resonant laser pulse has been analyzed in terms of dressed potential energy surfaces. Because of the large polarizability difference between the vibronically coupled B3u(nπ*) and B2u(ππ*) states, the Stark effect induced by the non-resonant laser pulse shifts the conical intersection away from the Franck-Condon region. We have shown, by solving the time-dependent Schrödinger equation for the molecule interacting with a relatively weak pump pulse driving the electronic excitation from the ground state to the B2u(ππ*) state, and a strong non-resonant control pulse, that this control mechanism can be used to trap the wavepacket on the B2u(ππ*) potential energy surface for a much longer time than the natural B2u(ππ*) lifetime.

  18. Universal interrogation protocol with zero probe-field-induced frequency shift for quantum clocks and high-accuracy spectroscopy

    Science.gov (United States)

    Zanon-Willette, T.; Lefevre, R.; Taichenachev, A. V.; Yudin, V. I.

    2017-08-01

    Optical clock interrogation protocols, based on laser-pulse spectroscopy, suffer from probe-induced frequency shifts and their variations induced by laser power. The original hyper-Ramsey probing scheme, which was proposed to alleviate those issues, does not fully eliminate the shift, especially when decoherence and relaxation by spontaneous emission or collisions are present. We propose to solve the fundamental problem of frequency shifts induced by the laser probe by deriving the exact canonical form of a multipulse generalized hyper-Ramsey resonance, including decoherence and relaxation. We present a universal interrogation protocol based on composite laser-pulse spectroscopy with phase modulation eliminating probe-induced frequency shifts at all orders in the presence of various dissipative processes. Unlike frequency shift extrapolation based methods, a universal interrogation protocol based on ±π /4 and ±3 π /4 phase-modulated resonances is proposed which does not compromise the stability of the optical clock while maintaining an ultrarobust error signal gradient in the presence of substantial uncompensated ac Stark shifts. Such a scheme can be implemented in two flavors: either by inverting clock state initialization or by pulse order reversal even without a perfect quantum state initialization. This universal interrogation protocol can be applied to atomic, molecular, and nuclear frequency metrology, mass spectrometry, and the field of precision spectroscopy. It might be designed using magic-wave-induced transitions, two-photon excitation, and magnetically induced spectroscopy or it might even be implemented with quantum logic gate circuit and qubit entanglement.

  19. Stark effect of excitons in corrugated lateral surface superlattices: effect of centre-of-mass quantization

    International Nuclear Information System (INIS)

    Hong Sun

    1998-11-01

    The quantum confined Stark effect (QCSE) of excitons in GaAs/AlAs corrugated lateral surface superlattices (CLSSLs) is calculated. Blue and red shifts in the exciton energies are predicted for the heavy- and light-excitons in the CLSSLs, respectively, comparing with those in the unmodulated quantum well due to the different effective hole masses in the parallel direction. Sensitive dependence of the QCSE on the hole effective mass in the parallel direction is expected because of the ''centre-of-mass'' quantization (CMQ) induced by the periodic corrugated interfaces of the CLSSLs. The effect of the CMQ on the exciton mini-bands and the localization of the excitons in the CLSSLs is discussed. (author)

  20. DC Stark addressing for quantum memory in Tm:YAG

    Directory of Open Access Journals (Sweden)

    Gerasimov Konstantin

    2017-01-01

    Full Text Available We observed a linear DC Stark effect for 3H6 – 3H4 optical transition of Tm3+ ions in Y3Al5O12. We observed that application of electric field pulse suppresses the two-pulse photon echo signal. If we then apply a second electric pulse of opposite polarity the echo signal is restored again, which indicates the linear nature of the observed effect. The effect is present despite the D2 symmetry of the Tm3+ sites that prohibits a linear Stark effect. Experimental data analysis shows that the observed electric field influence can be attributed to defects that break the local crystal field symmetry near Tm3+ ions. Using this effect we demonstrate selective retrieval of light pulses in two-pulse photon echo.

  1. Exceptions to the Stark law: practical considerations for surgeons.

    Science.gov (United States)

    Satiani, Bhagwan

    2006-03-01

    The purpose of this study was to provide an understanding of the applicable legislative exceptions to prohibitions under the Stark law, which governs common legitimate business relationships in surgical practice. Stark I and II prohibits all referrals (and claims) for the provision of designated health services for federal reimbursement if a physician or immediate family member has any financial relationship with the entity. Regardless of intent (unlike the antikickback statute), any financial relationship is illegal unless specifically excepted by statute. These exceptions are relevant to ownership, compensation arrangements, or both. The most important ones relevant to surgeons are as follows: physician service exception (services rendered in an intragroup referral); in-office ancillary services exception (office-based vascular laboratory); the whole hospital exception (ownership interest in a hospital or department); lease exception (conditions that must be met for a lease not to be considered illegal); bona fide employment exception (important to academic medical centers); personal services arrangement exception (vascular laboratory medical directorship); physician incentive plans exception (if volume or value of referrals are an issue); hospital-affiliated group practice exception (physician services billed by a hospital); recruitment arrangement exception (inducements by hospitals to relocate); items/services exception (transcription services purchased from a hospital); fair market value exception (covers services provided to health care entities); indirect compensation arrangements (dealings between a hospital and entity owned by physicians); and academic medical centers exception (new phase II rules broaden the definition of academic medical centers and ease the requirement that practice plans be tax-exempt organizations, among other changes. Although expert legal advice is required for navigation through the maze of Stark laws, it is incumbent on surgeons

  2. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  3. State-labeling Wannier-Stark atomic interferometers

    Science.gov (United States)

    Pelle, B.; Hilico, A.; Tackmann, G.; Beaufils, Q.; Pereira dos Santos, F.

    2013-02-01

    Using cold 87Rb atoms trapped in a one-dimensional (1D)-optical lattice, atomic interferometers involving coherent superpositions between different Wannier-Stark atomic states are realized. Two different kinds of trapped interferometer schemes are presented: a Ramsey-type interferometer sensitive both to clock frequency and external forces, and a symmetric accordion-type interferometer, sensitive to external forces only. We evaluate the limits in terms of sensitivity and accuracy of those schemes and discuss their application as force sensors. As a first step, we apply these interferometers to the measurement of the Bloch frequency and the demonstration of a compact gravimeter.

  4. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  5. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  6. Raman-laser spectroscopy of Wannier-Stark states

    International Nuclear Information System (INIS)

    Tackmann, G.; Pelle, B.; Hilico, A.; Beaufils, Q.; Pereira dos Santos, F.

    2011-01-01

    Raman lasers are used as a spectroscopic probe of the state of atoms confined in a shallow one-dimensional (1D) vertical lattice. For sufficiently long laser pulses, resolved transitions in the bottom band of the lattice between Wannier Stark states corresponding to neighboring wells are observed. Couplings between such states are measured as a function of the lattice laser intensity and compared to theoretical predictions, from which the lattice depth can be extracted. Limits to the linewidth of these transitions are investigated. Transitions to higher bands can also be induced, as well as between transverse states for tilted Raman beams. All these features allow for a precise characterization of the trapping potential and for an efficient control of the atomic external degrees of freedom.

  7. Raman-laser spectroscopy of Wannier-Stark states

    Science.gov (United States)

    Tackmann, G.; Pelle, B.; Hilico, A.; Beaufils, Q.; Pereira Dos Santos, F.

    2011-12-01

    Raman lasers are used as a spectroscopic probe of the state of atoms confined in a shallow one-dimensional (1D) vertical lattice. For sufficiently long laser pulses, resolved transitions in the bottom band of the lattice between Wannier Stark states corresponding to neighboring wells are observed. Couplings between such states are measured as a function of the lattice laser intensity and compared to theoretical predictions, from which the lattice depth can be extracted. Limits to the linewidth of these transitions are investigated. Transitions to higher bands can also be induced, as well as between transverse states for tilted Raman beams. All these features allow for a precise characterization of the trapping potential and for an efficient control of the atomic external degrees of freedom.

  8. Raman-laser spectroscopy of Wannier-Stark states

    Energy Technology Data Exchange (ETDEWEB)

    Tackmann, G.; Pelle, B.; Hilico, A.; Beaufils, Q.; Pereira dos Santos, F. [LNE-SYRTE, UMR 8630 CNRS, Observatoire de Paris, UPMC, 61 avenue de l' Observatoire, F-75014 Paris (France)

    2011-12-15

    Raman lasers are used as a spectroscopic probe of the state of atoms confined in a shallow one-dimensional (1D) vertical lattice. For sufficiently long laser pulses, resolved transitions in the bottom band of the lattice between Wannier Stark states corresponding to neighboring wells are observed. Couplings between such states are measured as a function of the lattice laser intensity and compared to theoretical predictions, from which the lattice depth can be extracted. Limits to the linewidth of these transitions are investigated. Transitions to higher bands can also be induced, as well as between transverse states for tilted Raman beams. All these features allow for a precise characterization of the trapping potential and for an efficient control of the atomic external degrees of freedom.

  9. Identification of Ion-Pair Structures in Solution by Vibrational Stark Effects.

    Science.gov (United States)

    Hack, John; Grills, David C; Miller, John R; Mani, Tomoyasu

    2016-02-18

    Ion pairing is a fundamental consideration in many areas of chemistry and has implications in a wide range of sciences and technologies that include batteries and organic photovoltaics. Ions in solution are known to inhabit multiple possible states, including free ions (FI), contact ion pairs (CIP), and solvent-separated ion pairs (SSIP). However, in solutions of organic radicals and nonmetal electrolytes, it is often difficult to distinguish between these states. In the first part of this work, we report evidence for the formation of SSIPs in low-polarity solvents and distinct measurements of CIP, SSIP, and FI, by using the ν(C≡N) infrared (IR) band of a nitrile-substituted fluorene radical anion. Use of time-resolved IR detection following pulse radiolysis allowed us to unambiguously assign the peak of the FI. In the presence of nonmetal electrolytes, two distinct red-shifted peaks were observed and assigned to the CIP and SSIP. The assignments are interpreted in the framework of the vibrational Stark effect (VSE) and are supported by (1) the solvent dependence of ion-pair populations, (2) the observation of a cryptand-separated sodium ion pair that mimics the formation of SSIPs, and (3) electronic structure calculations. In the second part of this work, we show that a blue-shift of the ν(C≡N) IR band due to the VSE can be induced in a nitrile-substituted fluorene radical anion by covalently tethering it to a metal-chelating ligand that forms an intramolecular ion pair upon reduction and complexation with sodium ion. This adds support to the conclusion that the shift in IR absorptions by ion pairing originates from the VSE. These results combined show that we can identify ion-pair structures by using the VSE, including the existence of SSIPs in a low-polarity solvent.

  10. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    possesses an interesting dualism: the periodic ac fields that are least effective in suppress- ing conductance fluctuations by dephasing, turn out to be the most effective in breaking the time-reversal symmetry. An important exception is the periodic ac field that is anti- symmetric with respect to a shift by a half-period τ/2.

  11. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  12. Stark Widths of Ar II Spectral Lines in the Atmospheres of Subdwarf B Stars

    Directory of Open Access Journals (Sweden)

    Rafik Hamdi

    2017-09-01

    Full Text Available Stark broadening parameters are of interest for many problems in astrophysics and laboratory plasmas investigation. Ar II spectral lines are observed in many kinds of stellar atmospheres such as the atmospheres of B-Type stars and subdwarf B stars. In this work, we present theoretical Stark widths for Ar II spectral lines. We use the impact semiclassical perturbation approach. Our results are compared with the available experimental values. Finally, the importance of the Stark broadening mechanism is studied in atmospheric conditions of subdwarf B stars.

  13. Real-time motional Stark effect in jet

    International Nuclear Information System (INIS)

    Alves, D.; Stephen, A.; Hawkes, N.; Dalley, S.; Goodyear, A.; Felton, R.; Joffrin, E.; Fernandes, H.

    2004-01-01

    The increasing importance of real-time measurements and control systems in JET experiments, regarding e.g. Internal Transport Barrier (ITB) and q-profile control, has motivated the development of a real-time motional Stark effect (MSE) system. The MSE diagnostic allows the measurement of local magnetic fields in different locations along the neutral beam path providing, therefore, local measurement of the current and q-profiles. Recently in JET, an upgrade of the MSE diagnostic has been implemented, incorporating a totally new system which allows the use of this diagnostic as a real-time control tool as well as an extended data source for off-line analysis. This paper will briefly describe the technical features of the real-time diagnostic with main focus on the system architecture, which consists of a VME crate hosting three PowerPC processor boards and a fast ADC, all connected via Front Panel Data Port (FPDP). The DSP algorithm implements a lockin-amplifier required to demodulate the JET MSE signals. Some applications for the system will be covered such as: feeding the real-time equilibrium reconstruction code (EQUINOX) and allowing the full coverage analysis of the Neutral Beam time window. A brief comparison between the real-time MSE analysis and the off-line analysis will also be presented

  14. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  15. PRESSURE SHIFT AND GRAVITATIONAL REDSHIFT OF BALMER LINES IN WHITE DWARFS: REDISCUSSION

    Energy Technology Data Exchange (ETDEWEB)

    Halenka, Jacek; Olchawa, Wieslaw [Institute of Physics, University of Opole, ul. Oleska 48, 45-052, Opole (Poland); Madej, Jerzy [Astronomical Observatory, University of Warsaw, Al. Ujazdowskie 4, 00-478 Warszawa (Poland); Grabowski, Boleslaw, E-mail: halenka@uni.opole.pl, E-mail: wolch@uni.opole.pl, E-mail: jm@astrouw.edu.pl, E-mail: bgrab@uni.opole.pl [Wroclaw School of Information Technology WWSIS “Horyzont,” ul. Wejherowska 28, 54-239 Wroclaw (Poland)

    2015-08-01

    The Stark-induced shift and asymmetry, the so-called pressure shift (PS) of H{sub α} and H{sub β} Balmer lines in spectra of DA white dwarfs (WDs), have been examined in detail as masking effects in measurements of the gravitational redshift in WDs. The results are compared with our earlier ones from a quarter of a century ago. In these earlier papers, the standard, symmetrical Stark line profiles, as a dominant constituent of the Balmer line profiles but shifted as a whole by the PS effect, were applied to all spectrally active layers of the WD atmosphere. At present, in each of the WD layers, the Stark line profiles (especially of H{sub β}) are inherently asymmetrical and shifted due to the effects of strong inhomogeneity of the perturbing fields in plasma. To calculate the Stark line profiles in successive layers of the WD atmosphere we used the modified Full Computer Simulation Method, able to take adequately into account the complexity of local elementary quantum processes in plasma. In the case of the H{sub α} line, the present value of Stark-induced shift of the synthetic H{sub α} line profile is about half the previous one and it is negligible in comparison with the gravitational redshift. In the case of the H{sub β} line, the present value of Stark-induced shift of the synthetic H{sub β} line profile is about twice the previous one. The source of this extra shift is the asymmetry of H{sub β} peaks.

  16. Semiconductor-metal transition induced by giant Stark effect in blue phosphorene nanoribbons

    Energy Technology Data Exchange (ETDEWEB)

    Xiong, Peng-Yu; Chen, Shi-Zhang; Zhou, Wu-Xing; Chen, Ke-Qiu, E-mail: keqiuchen@hnu.edu.cn

    2017-06-28

    The electronic structures and transport properties in monolayer blue phosphorene nanoribbons (BPNRs) with transverse electric field have been studied by using density functional theory and nonequilibrium Green's functions method. The results show that the band gaps of BPNRs with both armchair and zigzag edges are linearly decreased with the increasing of the strength of transverse electric field. A semiconductor-metal transition occurs when the electric field strength reaches to 5 V/nm. The Stark coefficient presents a linear dependency on BPNRs widths, and the slopes of both zBPNRs and aBPNRs are 0.41 and 0.54, respectively, which shows a giant Stark effect occurs. Our studies show that the semiconductor-metal transition originates from the giant Stark effect. - Highlights: • The electronic transport in blue phosphorene nanoribbons. • Semiconductor-metal transition can be observed. • The semiconductor-metal transition originates from the giant Stark effect.

  17. Surface Acoustic Analog of Bloch Oscillations, Wannier-Stark Ladders and Landau-Zener Tunneling

    Science.gov (United States)

    de Lima, M. M.; Kosevich, Yu. A.; Santos, P. V.; Cantarero, A.

    2011-12-01

    In this contribution, we discuss the recent experimental demonstration of Wannier-Stark ladders, Bloch Oscillations and Landau Zener tunneling in a solid by means of surface acoustic waves propagating through perturbed grating structures.

  18. Stark width regularities within spectral series of the lithium isoelectronic sequence

    Science.gov (United States)

    Tapalaga, Irinel; Trklja, Nora; Dojčinović, Ivan P.; Purić, Jagoš

    2018-03-01

    Stark width regularities within spectral series of the lithium isoelectronic sequence have been studied in an approach that includes both neutrals and ions. The influence of environmental conditions and certain atomic parameters on the Stark widths of spectral lines has been investigated. This study gives a simple model for the calculation of Stark broadening data for spectral lines within the lithium isoelectronic sequence. The proposed model requires fewer parameters than any other model. The obtained relations were used for predictions of Stark widths for transitions that have not yet been measured or calculated. In the framework of the present research, three algorithms for fast data processing have been made and they enable quality control and provide verification of the theoretically calculated results.

  19. The Stark effect of 1H and 4He+ in the beam foil source

    International Nuclear Information System (INIS)

    Doobov, M.H.; Hay, H.J.; Sofield, C.J.; Newton, C.S.

    1974-01-01

    The appearance of Stark patterns obtained with a beam-foil source differed from those characteristically obtained from gas discharge sources. In the former source excitation of the hydrogenic ions occurred in a brief time interval ( 14 s) during the passage of a high velocity unidirectional beam of ions which produces non-statistical population distributions for the Stark perturbed states. The relative intensities of Stark perturbed components of the Hsub(β) hydrogen line and the Fsub(α) ionized helium line have been measured in a beam-foil source. In each case an initial population of states of principal quantum number n = 4 due to radiative decay and Stark mixing, and comparing the resultant patterns with the observed patterns. The inferred population distributions indicate that the states of low orbital angular momentum (L) are preferentially populated, and alignment referred to the beam axis is produced such that states with lower z component of L are preferentially populated. (author)

  20. A High Power CH3OH Laser System Using Stark Stabilized CO2 Pump Lasers

    Science.gov (United States)

    Hutchinson, D. P.; Bennett, C. A.; Lee, J.; Fl etcher, L. K.; Ma, C. H.; Vander Sluis, K. L.

    1988-11-01

    A dual channel, 119μm wavelength laser system has been constructed for the ATF experiment at Oak Ridge. The pump lasers utilize external Stark cells for locking the CO2 laser to the absorption frequency of the CH3OH lasers. Stark plates have also been attached to the dielectric waveguide resonators of the FIR lasers to affect precise tuning of the 119 μm lasers.

  1. Periodicity of resonant tunneling current induced by the Stark resonances in semiconductor nanowire

    Science.gov (United States)

    Wołoszyn, M.; Adamowski, J.; Wójcik, P.; Spisak, B. J.

    2013-10-01

    The modification of the electronic current resulting from Stark resonances has been studied for the semiconductor nanowire with the double-barrier structure. Based on the calculated current-voltage characteristics, we have shown that the resonant tunneling current is a periodic function of the width of the spacer layer. We have also demonstrated that the simultaneous change of the source-drain voltage and the voltage applied to the gate located near the nanowire leads to almost periodic changes of the resonant tunneling current as a function of the source-drain and gate voltages. The periodic properties of the resonant tunneling current result from the formation of the Stark resonance states. If we change the electric field acting in the nanowire, the Stark states periodically acquire the energies from the transport window and enhance the tunneling current in a periodic manner. We have found that the separations between the resonant current peaks on the source-drain voltage scale can be described by a slowly increasing linear function of the Stark state quantum number. This allows us to identify the quantum states that are responsible for the enhancement of the resonant tunneling. We have proposed a method of the experimental observation of the Stark resonances in semiconductor double-barrier heterostructures.

  2. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  3. Shifting Attention

    Science.gov (United States)

    Ingram, Jenni

    2014-01-01

    This article examines the shifts in attention and focus as one teacher introduces and explains an image that represents the processes involved in a numeric problem that his students have been working on. This paper takes a micro-analytic approach to examine how the focus of attention shifts through what the teacher and students do and say in the…

  4. A New Understanding on AC Corrosion of Pipeline Steel in Alkaline Environment

    Science.gov (United States)

    Zhu, M.; Du, C. W.

    2017-01-01

    In this work, the corrosion behavior of X80 pipeline steel at various frequencies AC was investigated in carbonate/bicarbonate solution using the polarization curve, EIS test, Mott-Schottky curve and immersion tests. A new understanding on AC corrosion of the steel in alkaline environment is proposed. Decreasing AC frequency negatively shifts the corrosion potential and increases the corrosion rate of steel, as well as corrosion pits occur more readily. The superimposed AC shifts the critical pitting potential negatively and degrades the passivity of the steel. AC reduces the compactness and uniformity of the passive film formed on the steel and increases the possibility of the breakdown of the film, as well decreases the film thickness. The application of AC could prevent the passive film forming on the surface of X80 steel and result in a destructive effect on the film formed on the steel surface, especially at the low-frequency AC.

  5. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  6. Spectral-Kinetic Coupling and Effect of Microfield Rotation on Stark Broadening in Plasmas

    Directory of Open Access Journals (Sweden)

    Alexander V. Demura

    2014-07-01

    Full Text Available The study deals with two conceptual problems in the theory of Stark broadening by plasmas. One problem is the assumption of the density matrix diagonality in the calculation of spectral line profiles. This assumption is closely related to the definition of zero wave functions basis within which the density matrix is assumed to be diagonal, and obviously violated under the basis change. A consistent use of density matrix in the theoretical scheme inevitably leads to interdependence of atomic kinetics, describing the population of atomic states with the Stark profiles of spectral lines, i.e., to spectral-kinetic coupling. The other problem is connected with the study of the influence of microfield fluctuations on Stark profiles. Here the main results of the perturbative approach to ion dynamics, called the theory of thermal corrections (TTC, are presented, within which the main contribution to effects of ion dynamics is due to microfield fluctuations caused by rotations. In the present study the qualitative behavior of the Stark profiles in the line center within predictions of TTC is confirmed, using non-perturbative computer simulations.

  7. Quantum confined Stark effect in Gaussian quantum wells: A tight-binding study

    Energy Technology Data Exchange (ETDEWEB)

    Ramírez-Morales, A.; Martínez-Orozco, J. C.; Rodríguez-Vargas, I. [Unidad Académica de Física, Universidad Autónoma de Zacatecas, Calzada Solidaridad Esquina Con Paseo La Bufa S/N, 98060 Zacatecas, Zac. (Mexico)

    2014-05-15

    The main characteristics of the quantum confined Stark effect (QCSE) are studied theoretically in quantum wells of Gaussian profile. The semi-empirical tight-binding model and the Green function formalism are applied in the numerical calculations. A comparison of the QCSE in quantum wells with different kinds of confining potential is presented.

  8. Safety factor profiles from spectral motional Stark effect for ITER applications

    Science.gov (United States)

    Ko, Jinseok; Chung, Jinil; Wi, Han Min

    2017-10-01

    Depositions on the first mirror and multiple reflections on the other mirrors in the labyrinth of the optical system in the motional Stark effect (MSE) diagnostic for ITER are regarded as one of the main obstacles to overcome. One of the alternatives to the present-day conventional photoelastic-modulation-based MSE principles is the spectroscopic analyses on the motional Stark emissions where either the ratios among individual Stark multiplets or the amount of the Stark split are measured based on precise and accurate atomic data and models to ultimately provide the critical internal constraints in the magnetic equilibrium reconstruction. Equipped with the PEM-based conventional MSE hardware since 2015, the KSTAR MSE diagnostic system is capable of investigating the feasibility of the spectroscopic MSE approach particularly via comparative studies with the PEM approach. Available atomic data and models are used to analyze the beam emission spectra with a high-spectral-resolution spectrometer with a patent-pending dispersion calibration technology. Experimental validation on the atomic data and models is discussed in association with the effect of the existence of mirrors, the Faraday rotation in the relay optics media, and the background polarized light on the measured spectra. Work supported by the Ministry of Science, ICT and Future Planning, Korea.

  9. Stark spectroscopy of the light-harvesting complex II in different oligomerisation states

    NARCIS (Netherlands)

    Palacios, M.A.; Frese, R.N.; Gradinaru, C.C.; Stokkum, van I.H.M.; Premvardhan, L.L.; Horton, P.; Ruban, A.V.; Grondelle, van R.; Amerongen, van H.

    2003-01-01

    The electric field-induced absorption changes (Stark effect) of light-harvesting complex 11 (LHCII) in different oligomerisation states-monomeric, trimeric and aggregated-have been probed at 77 K. All the chlorophyll (Chl) a molecules exhibit electro-optic properties in the Q(y) absorption region

  10. Superconducting ac cable

    International Nuclear Information System (INIS)

    Schmidt, F.

    1980-01-01

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de

  11. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  12. AC resistance measuring instrument

    Science.gov (United States)

    Hof, P.J.

    1983-10-04

    An auto-ranging AC resistance measuring instrument for remote measurement of the resistance of an electrical device or circuit connected to the instrument includes a signal generator which generates an AC excitation signal for application to a load, including the device and the transmission line, a monitoring circuit which provides a digitally encoded signal representing the voltage across the load, and a microprocessor which operates under program control to provide an auto-ranging function by which range resistance is connected in circuit with the load to limit the load voltage to an acceptable range for the instrument, and an auto-compensating function by which compensating capacitance is connected in shunt with the range resistance to compensate for the effects of line capacitance. After the auto-ranging and auto-compensation functions are complete, the microprocessor calculates the resistance of the load from the selected range resistance, the excitation signal, and the load voltage signal, and displays of the measured resistance on a digital display of the instrument. 8 figs.

  13. Single-Phase Direct Boost AC-AC Converter

    Directory of Open Access Journals (Sweden)

    URSARU, O.

    2017-11-01

    Full Text Available This paper introduces and studies a boost AC-AC converter circuit that can be used to supply power to the 220V receivers in the 110V grids or to increase and adjust voltage at the end of long lines. High frequency AC-AC converters have better specifications than alternative voltage phase control drives with thyristors or TRIACs. When frequency exceeds 20kHz, noise is eliminated, filters are smaller and efficiency is higher. The current waveform is much better, the output voltage can be higher than the input voltage and voltage control is more accurate.

  14. Tough Shift

    DEFF Research Database (Denmark)

    Brewer, Robert S.; Verdezoto, Nervo; Holst, Thomas

    2015-01-01

    people to change their behavior at home. Leveraging prior research on encouraging reductions in residential energy use through game play, we introduce ShareBuddy: a casual mobile game intended to encourage players not only to reduce, but also to shift their electricity use. We conducted two field studies...... real-world resource use into a game....

  15. ACS Postflash Characterization

    Science.gov (United States)

    Smith, Linda

    2011-10-01

    This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.

  16. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax ...

    Indian Academy of Sciences (India)

    Prakash

    Therefore, these glycoproteins appear to be potential candidates for a vector- directed transmission-blocking vaccine (TBV). [Chugh M, Gulati B R and Gakhar S K 2010 Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae); J.

  17. Time Ordering Effects on Hydrogen Zeeman-Stark Line Profiles in Low-Density Magnetized Plasmas

    Directory of Open Access Journals (Sweden)

    J. Rosato

    2010-01-01

    Full Text Available Stark broadening of hydrogen lines is investigated in low-density magnetized plasmas, at typical conditions of magnetic fusion experiments. The role of time ordering is assessed numerically, by using a simulation code accounting for the evolution of the microscopic electric field generated by the charged particles moving at the vicinity of the atom. The Zeeman effect due to the magnetic field is also retained. Lyman lines with a low principal quantum number n are first investigated, for an application to opacity calculations; next Balmer lines with successively low and high principal quantum numbers are considered for diagnostic purposes. It is shown that neglecting time ordering results in a dramatic underestimation of the Stark effect on the low-n lines. Another conclusion is that time ordering becomes negligible only when ion dynamics effects vanish, as shown in the case of high-n lines.

  18. Development of a wavy Stark velocity filter for studying interstellar chemistry

    Science.gov (United States)

    Okada, Kunihiro; Takada, Yusuke; Kimura, Naoki; Wada, Michiharu; Schuessler, Hans A.

    2017-08-01

    Cold polar molecules are key to both the understanding of fundamental physics and the characterization of the chemical evolution of interstellar clouds. To facilitate such studies over a wide range of temperatures, we developed a new type of Stark velocity filter for changing the translational and rotational temperatures of velocity-selected polar molecules without changing the output beam position. The translational temperature of guided polar molecules can be significantly varied by exchanging the wavy deflection section with one having a different radius of the curvature and a different deflection angle. Combining in addition a temperature variable gas cell with the wavy Stark velocity filter enables to observe the translational and rotational temperature dependence of the reaction-rate constants of cold ion-polar molecule reactions over the interesting temperature range of 10-100 K.

  19. Can the Stark-Einstein law resolve the measurement problem from an animate perspective?

    Science.gov (United States)

    Thaheld, Fred H

    2015-09-01

    Analysis of the Stark-Einstein law as it applies to the retinal molecule, which is part of the rhodopsin molecule within the rod cells of the retina, reveals that it may provide the solution to the measurement problem from an animate perspective. That it represents a natural boundary where the Schrödinger equation or wave function automatically goes from linear to nonlinear while remaining in a deterministic state. It will be possible in the near future to subject this theory to empirical tests as has been previously proposed. This analysis provides a contrast to the many decades well studied and debated inanimate measurement problem and would represent an addition to the Stark-Einstein law involving information carried by the photon. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  20. Development of a wavy Stark velocity filter for studying interstellar chemistry.

    Science.gov (United States)

    Okada, Kunihiro; Takada, Yusuke; Kimura, Naoki; Wada, Michiharu; Schuessler, Hans A

    2017-08-01

    Cold polar molecules are key to both the understanding of fundamental physics and the characterization of the chemical evolution of interstellar clouds. To facilitate such studies over a wide range of temperatures, we developed a new type of Stark velocity filter for changing the translational and rotational temperatures of velocity-selected polar molecules without changing the output beam position. The translational temperature of guided polar molecules can be significantly varied by exchanging the wavy deflection section with one having a different radius of the curvature and a different deflection angle. Combining in addition a temperature variable gas cell with the wavy Stark velocity filter enables to observe the translational and rotational temperature dependence of the reaction-rate constants of cold ion-polar molecule reactions over the interesting temperature range of 10-100 K.

  1. Stark broadening of the Hα line of hydrogen at low densities: quantal and semiclassical results

    International Nuclear Information System (INIS)

    Stehle, C.; Feautrier, N.

    1984-01-01

    Stark profiles of the Hα lines of hydrogen are computed at low densities in the 'impact' theory. By a comparison with quantal results, it is shown that a simple semiclassical perturbational approach with appropriate cutoffs is sufficient to give accurate profiles in the line centre. Neglecting the natural broadening and the fine-structure effects, the authors prove that the electronic broadening is negligible and that the profile has a Lorentzian shape. An analytical expression of the half width is given. (author)

  2. Observation of asymmetric Stark profiles from plasmas created by a picosecond KrF laser

    International Nuclear Information System (INIS)

    Nam, C.H.; Tighe, W.; Suckewer, S.; Seely, J.F.; Feldman, U.; Woltz, L.A.

    1987-10-01

    High-resolution extreme ultraviolet (XUV) spectra from solid targets irradiated by a picosecond KrF* laser focused to 10 16 W/cm 2 have been recorded. The line profiles of transitions in Li-like fluorine and oxygen are asymmetric and up to 2 A in width. Calculations indicate the presence of transitions of the type 2p-3p and other forbidden Stark components. 11 refs., 6 figs

  3. Motional Stark Effect measurements of the local magnetic field in high temperature fusion plasmas

    Science.gov (United States)

    Wolf, R. C.; Bock, A.; Ford, O. P.; Reimer, R.; Burckhart, A.; Dinklage, A.; Hobirk, J.; Howard, J.; Reich, M.; Stober, J.

    2015-10-01

    The utilization of the Motional Stark Effect (MSE) experienced by the neutral hydrogen or deuterium injected into magnetically confined high temperature plasmas is a well established technique to infer the internal magnetic field distribution of fusion experiments. In their rest frame, the neutral atoms experience a Lorentz electric field, EL = v × B, which results in a characteristic line splitting and polarized line emission. The different properties of the Stark multiplet allow inferring, both the magnetic field strength and the orientation of the magnetic field vector. Besides recording the full MSE spectrum, several types of polarimeters have been developed to measure the polarization direction of the Stark line emission. To test physics models of the magnetic field distribution and dynamics, the accuracy requirements are quite demanding. In view of these requirements, the capabilities and issues of the different techniques are discussed, including the influence of the Zeeman Effect and the sensitivity to radial electric fields. A newly developed Imaging MSE system, which has been tested on the ASDEX Upgrade tokamak, is presented. The sensitivity allows to resolve sawtooth oscillations. A shorter version of this contribution is due to be published in PoS at: 1st EPS conference on Plasma Diagnostics

  4. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  5. Electricity-AC versus DC

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Electricity - AC versus DC. D P Sen Gupta. General Article Volume 2 Issue 10 October 1997 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/10/0046-0053. Author Affiliations.

  6. Stark broadening of potassium ns-4p and nd-4p lines in a wall-stabilized arc

    International Nuclear Information System (INIS)

    Hohimer, J.P.

    1984-01-01

    Stark-width measurements are reported for lines in the ns-4p (n = 7--10) and nd-4p (n = 5--8) series in neutral potassium (K I). These measurements were made by observing the end-on emission from a low pressure (20 Torr) potassium-argon wall-stabilized arc source. The on-axis electron density and temperature in the 20-A arc were (2.0 +- 0.2) x 10 15 cm -3 and 2955 +- 100 K, respectively. The experimentally determined Stark widths were compared with the theoretical values calculated by Griem. The measured Stark widths agreed with theory to within 30% for lines in the ns-4p series; while the measured Stark widths of the nd-4p series lines were only one-third of the theoretical values

  7. A strontium lattice clock with reduced blackbody radiation shift

    Energy Technology Data Exchange (ETDEWEB)

    Al-Masoudi, Ali Khalas Anfoos

    2016-09-30

    Optical clocks have been quickly moving to the forefront of the frequency standards field due to their high spectral resolution, and therefore the potential high stability and accuracy. The accuracy and stability of the optical clocks are nowadays two orders of magnitude better than microwave Cs clocks, which realize the SI second. Envisioned applications of highly accurate optical clocks are to perform tests of fundamental physics, for example, searching for temporal drifts of the fine structure constant α, violations of the Local Position Invariance (LPI), dark matter and dark energy, or to performance relativistic geodesy. In this work, the uncertainty of a strontium lattice clock, based on the {sup 1}S{sub 0}-{sup 3}P{sub 0} transition in {sup 87}Sr, due to the blackbody radiation (BBR) shift has been reduced to less than 1 x 10{sup -18} by more than one order of magnitude compared to the previous evaluation of the BBR shift uncertainty in this clock. The BBR shift has been reduced by interrogating the atoms in a cryogenic environment. The systematic uncertainty of the cryogenic lattice clock is evaluated to be 1.3 x 10{sup -17} which is dominated by the uncertainty of the AC Stark shift of the lattice laser and the uncertainty contribution of the BBR shift is negligible. Concerning the instability of the clock, the detection noise of the clock has been measured, and a model linking noise and clock instability has been developed. This noise model shows that, in our lattice clock, quantum projection noise is reached if more than 130 atoms are interrogated. By combining the noise model with the degradation due to the Dick effect reflecting the frequency noise of the interrogation laser, the instability of the clock is estimated to be 1.6 x 10{sup -16}/√(τ/s) in regular operation. During this work, several high-accuracy comparisons to other atomic clocks have been performed, including several absolute frequency measurements. The Sr clock transition frequency

  8. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  9. Measured, calculated and predicted stark widths along a beryllium isoelectronic sequence in the 3s-3p transition

    Directory of Open Access Journals (Sweden)

    Djeniže S.

    2001-01-01

    Full Text Available On the basis of the observed satisfactory agreement between recent experimental and calculated Stark width values with our earlier predicted ones along the beryllium isoelectronic sequence (BeI, BII, CIII, NIV, OV FVI, NeVII,.. new Stark width values have been predicted for high ionized emitters (NaVIII, MgIX, AlX, SiXI and PXII in the 3s-3p transition interesting for astrophysical investigations.

  10. I am Iron Man:Tony Stark as a mythical and modern hero in Marvel cinematic universe

    OpenAIRE

    Kalliokoski, E. (Eleonoora)

    2013-01-01

    Abstract In this study I analyze the character of Tony Stark as both a mythical hero and a modern heroic figure in the Marvel Cinematic Universe. My primary materials for this analysis are the movies Iron Man, Iron Man 2, and Marvel’s The Avengers. I chose these movies for the study because they all feature Tony Stark in a significant role and are part of one continuous story arc. ...

  11. Fluid Shifts

    Science.gov (United States)

    Stenger, M. B.; Hargens, A. R.; Dulchavsky, S. A.; Arbeille, P.; Danielson, R. W.; Ebert, D. J.; Garcia, K. M.; Johnston, S. L.; Laurie, S. S.; Lee, S. M. C.; hide

    2017-01-01

    Introduction. NASA's Human Research Program is focused on addressing health risks associated with long-duration missions on the International Space Station (ISS) and future exploration-class missions beyond low Earth orbit. Visual acuity changes observed after short-duration missions were largely transient, but now more than 50 percent of ISS astronauts have experienced more profound, chronic changes with objective structural findings such as optic disc edema, globe flattening and choroidal folds. These structural and functional changes are referred to as the visual impairment and intracranial pressure (VIIP) syndrome. Development of VIIP symptoms may be related to elevated intracranial pressure (ICP) secondary to spaceflight-induced cephalad fluid shifts, but this hypothesis has not been tested. The purpose of this study is to characterize fluid distribution and compartmentalization associated with long-duration spaceflight and to determine if a relation exists with vision changes and other elements of the VIIP syndrome. We also seek to determine whether the magnitude of fluid shifts during spaceflight, as well as any VIIP-related effects of those shifts, are predicted by the crewmember's pre-flight status and responses to acute hemodynamic manipulations, specifically posture changes and lower body negative pressure. Methods. We will examine a variety of physiologic variables in 10 long-duration ISS crewmembers using the test conditions and timeline presented in the figure below. Measures include: (1) fluid compartmentalization (total body water by D2O, extracellular fluid by NaBr, intracellular fluid by calculation, plasma volume by CO rebreathe, interstitial fluid by calculation); (2) forehead/eyelids, tibia, and calcaneus tissue thickness (by ultrasound); (3) vascular dimensions by ultrasound (jugular veins, cerebral and carotid arteries, vertebral arteries and veins, portal vein); (4) vascular dynamics by MRI (head/neck blood flow, cerebrospinal fluid

  12. AC propulsion system for an electric vehicle, phase 2

    Science.gov (United States)

    Slicker, J. M.

    1983-01-01

    A second-generation prototype ac propulsion system for a passenger electric vehicle was designed, fabricated, tested, installed in a modified Mercury Lynx vehicle and track tested at the Contractor's site. The system consisted of a Phase 2, 18.7 kw rated ac induction traction motor, a 192-volt, battery powered, pulse-width-modulated, transistorized inverter packaged for under rear seat installation, a 2-axis, 2-speed, automatically-shifted mechanical transaxle and a microprocessor-based powertrain/vehicle controller. A diagnostics computer to assist tuning and fault finding was fabricated. Dc-to-mechanical-system efficiency varied from 78% to 82% as axle speed/torque ranged from 159 rpm/788 nm to 65 rpm/328 nm. Track test efficiency results suggest that the ac system will be equal or superior to dc systems when driving urban cycles. Additional short-term work is being performed under a third contract phase (AC-3) to raise transaxle efficiency to predicted levels, and to improve starting and shifting characteristics. However, the long-term challenge to the system's viability remains inverter cost. A final report on the Phase 2 system, describing Phase 3 modifications, will be issued at the conclusion of AC-3.

  13. Shifting Blame?

    DEFF Research Database (Denmark)

    Garofalo, Orsola; Rott, Christina

    2017-01-01

    either the decision maker or a spokesperson communicates the decided allocation to recipients, who then determine whether to punish either of them. We find that receivers punish both the decision maker and the spokesperson more often, and more heavily, for unfair allocations communicated...... by the spokesperson if there is room for shifting blame. The increased punishment results from the messenger’s style of delivery: spokespersons are more likely than decision makers to express emotional regret instead of rational need. Receivers seem to punish the former style of communication because they view...

  14. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  15. AcEST: DK945159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  16. AcEST: DK945724 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  17. The ac propulsion system for an electric vehicle, phase 1

    Science.gov (United States)

    Geppert, S.

    1981-01-01

    A functional prototype of an electric vehicle ac propulsion system was built consisting of a 18.65 kW rated ac induction traction motor, pulse width modulated (PWM) transistorized inverter, two speed mechanically shifted automatic transmission, and an overall drive/vehicle controller. Design developmental steps, and test results of individual components and the complex system on an instrumented test frame are described. Computer models were developed for the inverter, motor and a representative vehicle. A preliminary reliability model and failure modes effects analysis are given.

  18. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax ...

    Indian Academy of Sciences (India)

    The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 ...

  19. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  20. Iris pigmentation and AC thresholds.

    Science.gov (United States)

    Roche, A F; Mukherjee, D; Chumlea, W C; Siervogel, R M

    1983-03-01

    Data from 160 White children were used to analyze possible associations between iris pigmentation and AC pure-tone thresholds. Iris pigmentation was graded from iris color using glass models of eyes, and AC thresholds were obtained under carefully controlled conditions. Analyses of variance using two groupings of iris color grades showed no evidence of an association between iris color grade and AC thresholds. Furthermore, inspection of arrays of the actual glass eye models, in conjunction with the order of mean thresholds at each test frequency, did not indicate the presence of an association between iris color grades and thresholds. It was concluded that while iris pigmentation may be related to some aspects of hearing ability, it does not appear to be related to AC thresholds in children.

  1. Phonon-assisted hopping of an electron on a Wannier-Stark ladder in a strong electric field

    International Nuclear Information System (INIS)

    Emin, D.; Hart, C.F.

    1987-01-01

    With the application of a spatially constant electric field, the degeneracy of electronic energy levels of geometrically equivalent sites of a crystal is generally lifted. As a result, the electric field causes the electronic eigenstates of a one-dimensional periodic chain to become localized. In particular, they are Wannier-Stark states. With sufficiently large electric-field strengths these states become sufficiently well localized that it becomes appropriate to consider electronic transport to occur via a succession of phonon-assisted hops between the localized Wannier-Stark states. In this paper, we present calculations of the drift velocity arising from acoustic- and optical-phonon-assisted hopping motion between Wannier-Stark states. When the intersite electronic transfer energy is sufficiently small so that the Wannier-Stark states are essentially each confined to a single atomic site, the transport reduces to that of a small polaron. In this regime, while the drift velocity initially rises with increasing electric field strength, the drift velocity ultimately falls with increasing electric-field strength at extremely large electric fields. More generally, for common values of the electronic bandwidth and electric field strength, the Wannier-Stark states span many sites. At sufficiently large electric fields, the energy separation between Wannier-Stark states exceeds the energy uncertainty associated with the carrier's interaction with phonons. Then, it is appropriate to treat the electronic transport in terms of phonon-assisted hopping between Wannier-Stark states. The resulting high-field drift velocity falls with increasing field strength in a series of steps. Thus, we find a structured negative differential mobility at large electric fields

  2. Comparison of three Stark problem solution techniques for the bounded case

    Science.gov (United States)

    Hatten, Noble; Russell, Ryan P.

    2015-01-01

    Three methods of obtaining solutions to the Stark problem—one developed by Lantoine and Russell using Jacobi elliptic and related functions, one developed by Biscani and Izzo using Weierstrass elliptic and related functions, and one developed by Pellegrini, Russell, and Vittaldev using and Taylor series extended to the Stark problem—are compared qualitatively and quantitatively for the bounded motion case. For consistency with existing available code for the series solution, Fortran routines of the Lantoine method and Biscani method are newly implemented and made available. For these implementations, the Lantoine formulation is found to be more efficient than the Biscani formulation in the propagation of a single trajectory segment. However, for applications for which acceptable accuracy may be achieved by orders up to 16, the Pellegrini series solution is shown to be more efficient than either analytical method. The three methods are also compared in the propagation of sequentially connected trajectory segments in a low-thrust orbital transfer maneuver. Separate tests are conducted for discretizations between 8 and 96 segments per orbit. For the series solution, the interaction between order and step size leads to computation times that are nearly invariable to discretization for a given truncation error tolerance over the tested range of discretizations. This finding makes the series solution particularly attractive for mission design applications where problems may require both coarse and fine discretizations. Example applications include the modeling of low-thrust propulsion and time-varying perturbations—problems for which the efficient propagation of relatively short Stark segments is paramount because the disturbing acceleration generally varies continuously.

  3. On the Stark broadening in the Au I and Au II spectra from a helium plasma

    Science.gov (United States)

    Djeniže, S.

    2009-03-01

    The Stark FWHM (Full-Width at Half of the Maximal line intensity, W) of 5 neutral and 26 singly ionized gold (Au I and Au II, respectively) spectral lines have been measured in laboratory helium plasma at approximately 16,600 K electron temperature and 7.4 × 10 22 m - 3 electron density. Five Au I and ten Au II W values are reported for the first time. The Au II W values are compared with recent theoretical data, calculated based on a modified semi-empirical approach, and also with existing experimental W values. Our normalized Stark widths are six times higher than those measured in a laser-produced plasma. Possible explanation of this is recommended here. An agreement (within the accuracy of the experiment and uncertainties of the theoretical approach used) with the recently calculated W data was found in the 6p-7s Au II transition. The calculated hyperfine splitting for the five Au II lines in the 6s-6p transition is also presented. At the stated helium plasma conditions, Stark broadening has been found to be the dominant mechanism in the Au I and Au II line shape formation. A modified version of the linear low-pressure pulsed arc was used as a plasma source operated in helium, with gold atoms as impurities evaporated from the thin gold cylindrical plates located in the homogeneous part of the discharge, providing conditions free of self-absorption. This plasma source ensures good conditions for generation of excited gold ions due to Penning and charge exchange effects.

  4. K-shell spectroscopy in hot plasmas: Stark effect, Breit interaction and QED corrections

    Science.gov (United States)

    Pain, J.-C.; Gilleron, F.; Comet, M.; Gilles, D.

    2017-03-01

    The broadening of lines by Stark effect is widely used for inferring electron density and temperature in plasmas. Stark-effect calculations often rely on atomic data (transition rates, energy levels,…) not always exhaustive and/or valid only for isolated atoms. In this work, we first present a recent development in the detailed opacity code SCO-RCG for K-shell spectroscopy. The approach is adapted from the work of Gilles and Peyrusse. Neglecting non-diagonal terms in dipolar and collision operators, the line profile is expressed as a sum of Voigt functions associated to the Stark components. The formalism relies on the use of parabolic coordinates and the relativistic fine structure of Lyman lines is included by diagonalizing the Hamiltonian matrix associated to quantum states having the same principal quantum number n. The SCO-RCG code enables one to investigate plasma environment effects, the impact of the microfield distribution, the decoupling between electron and ion temperatures and the role of satellite lines (such as Li-like 1snℓn'ℓ' - 1s2nℓ, Be-like, etc.). Atomic structure calculations have reached levels of accuracy which require evaluation of Breit interaction and many-electron quantum electro-dynamics (QED) contributions. Although much work was done for QED effects (self-energy and vacuum polarization) in hydrogenic atoms, the case of an arbitrary number of electrons is more complicated. Since exact analytic solutions do not exist, a number of heuristic methods have been used to approximate the screening of additional electrons in the self-energy part. We compare different ways of including such effects in atomic-structure codes (Slater-Condon, Multi-Configuration Dirac-Fock, etc.).

  5. Shifting Sugars and Shifting Paradigms

    Science.gov (United States)

    Siegal, Mark L.

    2015-01-01

    No organism lives in a constant environment. Based on classical studies in molecular biology, many have viewed microbes as following strict rules for shifting their metabolic activities when prevailing conditions change. For example, students learn that the bacterium Escherichia coli makes proteins for digesting lactose only when lactose is available and glucose, a better sugar, is not. However, recent studies, including three PLOS Biology papers examining sugar utilization in the budding yeast Saccharomyces cerevisiae, show that considerable heterogeneity in response to complex environments exists within and between populations. These results join similar recent results in other organisms that suggest that microbial populations anticipate predictable environmental changes and hedge their bets against unpredictable ones. The classical view therefore represents but one special case in a range of evolutionary adaptations to environmental changes that all organisms face. PMID:25688600

  6. Shifting sugars and shifting paradigms.

    Directory of Open Access Journals (Sweden)

    Mark L Siegal

    2015-02-01

    Full Text Available No organism lives in a constant environment. Based on classical studies in molecular biology, many have viewed microbes as following strict rules for shifting their metabolic activities when prevailing conditions change. For example, students learn that the bacterium Escherichia coli makes proteins for digesting lactose only when lactose is available and glucose, a better sugar, is not. However, recent studies, including three PLOS Biology papers examining sugar utilization in the budding yeast Saccharomyces cerevisiae, show that considerable heterogeneity in response to complex environments exists within and between populations. These results join similar recent results in other organisms that suggest that microbial populations anticipate predictable environmental changes and hedge their bets against unpredictable ones. The classical view therefore represents but one special case in a range of evolutionary adaptations to environmental changes that all organisms face.

  7. Cross-sectional nanophotoluminescence studies of Stark effects in self-assembled quantum dots

    International Nuclear Information System (INIS)

    Htoon, H.; Keto, J. W.; Baklenov, O.; Holmes, A. L. Jr.; Shih, C. K.

    2000-01-01

    By using a cross-sectional geometry, we show the capability to perform single-dot spectroscopy in self-assembled quantum dots using far-field optics. By using this method, we study the quantum-confined Stark effect in self-assembled quantum dots. For single-stack quantum dots (QDs), we find that the spectra are redshifted with an increase in electric field. For vertically coupled double-stack quantum dots, while most of the QDs are redshifted, some QDs show blueshifted spectra, which can be interpreted as an evidence of coupled QD molecules. (c) 2000 American Institute of Physics

  8. Development of signal analysis method for the motional Stark effect diagnostic on EAST

    Science.gov (United States)

    Fu, Jia; Lyu, Bo; Liu, Haiqing; Li, Yingying; Liu, Dongmei; Wei, Yongqing; Fan, Chao; Shi, Yuejiang; Wu, Zhenwei; Wan, Baonian

    2017-10-01

    A pilot single-channel Motional Stark Effect (MSE) diagnostic has been developed on EAST since 2015. The dual photo-elastic modulators (PEM) were employed to encode the polarization angle into a time-varying signal. The pitch angle was related to the ratio of modulation amplitude at the second harmonic frequency. A digital harmonic analyzer (DHA) technique was developed for extracting the second harmonic amplitude. The results were validated with a hardware phase lock-in amplifier, and is also consistent with the software dual phase-locking algorithm.

  9. The giant Stark effect in armchair-edge phosphorene nanoribbons under a transverse electric field

    Science.gov (United States)

    Zhou, Benliang; Zhou, Benhu; Liu, Pu; Zhou, Guanghui

    2018-01-01

    We study the variation of electronic properties for armchair-edge phosphorene nanoribbons (APNRs) modulated by a transverse electric field. Within the tight-binding model Hamiltonian, and by solving the differential Schrödinger equation, we find that a band gap closure appears at the critical field due to the giant Stark effect for an APNR. The gap closure has no field polarity, and the gap varies quadratically for small fields but becomes linear for larger ones. We attribute the giant Stark effect to the broken edge degeneracy, i.e., the charge redistributions of the conduction band minimum and valence band maximum states localized at opposite edges induced by the field. By combined with the Green's function approach, it is shown that in the presence of the critical field a gap of density of states (DOS) disappears and a high value DOS turns up at the energy position of the band gap closure. Finally, as the field increases, we find the band gap decreases more rapidly and the gap closure occurs at smaller fields for wider ribbons. Both the band gap and DOS variations with the field show an insulator-metal transition induced by a transverse electric field for the APNR. Our results show that wider APNRs are more appreciable to design field-effect transistors.

  10. Stark broadening in the laser-induced Cu I and Cu II spectra

    International Nuclear Information System (INIS)

    Skočić, M; Burger, M; Nikolić, Z; Bukvić, S; Djeniže, S

    2013-01-01

    In this work we present the Stark widths (W) of 22 neutral (Cu I) and 100 singly ionized (Cu II) copper spectral lines that have been measured at 18 400 K and 19 300 K electron temperatures and 6.3 × 10  22 m −3 and 2.1 × 10  23 m −3 electron densities, respectively. The experiment is conducted in the laser-induced plasma—the Nd:YAG laser, operating at 532 nm, was used to produce plasma from the copper sample in the residual air atmosphere at a pressure of 8 Pa. The electron temperature and density were estimated by the Boltzmann-plot method and from the Saha equation. The investigated Cu I lines belong to the 4s–4p′, 4s  2 –4p″ and 4p′–4d′ transitions while Cu II spectral lines belong to the 4s–4p, 4p–5s, 4p–4d, 4p–4s  2 , 4d–4f and 4d–v transitions. Comparison with existing experimental data was possible only in the case of 17 Cu II lines due to a lack of experimental and theoretical values. The rest of the data, Stark widths of 22 Cu I and 83 Cu II lines are published for the first time. (paper)

  11. Plasma density characterization at SPARC-LAB through Stark broadening of Hydrogen spectral lines

    Energy Technology Data Exchange (ETDEWEB)

    Filippi, F., E-mail: francesco.filippi@roma1.infn.it [Dipartimento di Scienze di Base e Applicate per l' Ingegneria (SBAI), ‘Sapienza’ Università di Roma, Via A. Scarpa 14-16, 00161 Roma (Italy); INFN-Roma1, Piazzale Aldo Moro, 2 00161 Roma (Italy); Anania, M.P.; Bellaveglia, M.; Biagioni, A.; Chiadroni, E. [Laboratori Nazionali di Frascati, INFN, Via E. Fermi, Frascati (Italy); Cianchi, A. [Dipartimento di Fisica, Universitá di Roma Tor Vergata, Via della Ricerca Scientifica 1, 00133 Roma (Italy); Di Giovenale, D.; Di Pirro, G.; Ferrario, M. [Laboratori Nazionali di Frascati, INFN, Via E. Fermi, Frascati (Italy); Mostacci, A.; Palumbo, L. [Dipartimento di Scienze di Base e Applicate per l' Ingegneria (SBAI), ‘Sapienza’ Università di Roma, Via A. Scarpa 14-16, 00161 Roma (Italy); INFN-Roma1, Piazzale Aldo Moro, 2 00161 Roma (Italy); Pompili, R.; Shpakov, V.; Vaccarezza, C.; Villa, F. [Laboratori Nazionali di Frascati, INFN, Via E. Fermi, Frascati (Italy); Zigler, A. [Hebrew University of Jerusalem, Jerusalem 91904 (Israel)

    2016-09-01

    Plasma-based acceleration techniques are of great interest for future, compact accelerators due to their high accelerating gradient. Both particle-driven and laser-driven Plasma Wakefield Acceleration experiments are foreseen at the SPARC-LAB Test Facility (INFN National Laboratories of Frascati, Italy), with the aim to accelerate high-brightness electron beams. In order to optimize the efficiency of the acceleration in the plasma and preserve the quality of the accelerated beam, the knowledge of the plasma electron density is mandatory. The Stark broadening of the Hydrogen spectral lines is one of the candidates used to characterize plasma density. The implementation of this diagnostic for plasma-based experiments at SPARC-LAB is presented. - Highlights: • Stark broadening of Hydrogen lines has been measured to determine plasma density. • Plasma density diagnostic tool for plasma-based experiments at SPARC-LAB is presented. • Plasma density in tapered laser triggered ablative capillary discharge was measured. • Results of plasma density measurements in ablative capillaries are shown.

  12. Shift and broadening of emission lines in Nd :YAG laser crystal ...

    Indian Academy of Sciences (India)

    Abstract. Spectroscopic properties of the flashlamp-pumped Nd3+:YAG laser as a function of input energy were studied over the range of 18–75 J. The spectral widths and shifts of quasi-three-level and four-level inter-Stark emissions within the respective intermanifold transi- tions of 4F3/2 →4I9/2 and 4F3/2 →4I11/2 were ...

  13. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  14. AcEST: BP913556 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N Ubiquitin-protein ligase E3B OS=Homo sapie... 31 3.5 sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/F/G/H O...SVPALVTHLSTVTPERLTVLESHDMLRKF 287 >sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/

  15. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  16. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  17. Nuclear structure of 231Ac

    International Nuclear Information System (INIS)

    Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

    2008-01-01

    The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

  18. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  19. Surface Acoustic Bloch Oscillations, the Wannier-Stark Ladder, and Landau-Zener Tunneling in a Solid

    Science.gov (United States)

    de Lima, M. M., Jr.; Kosevich, Yu. A.; Santos, P. V.; Cantarero, A.

    2010-04-01

    We present the experimental observation of Bloch oscillations, the Wannier-Stark ladder, and Landau-Zener tunneling of surface acoustic waves in perturbed grating structures on a solid substrate. A model providing a quantitative description of our experimental observations, including multiple Landau-Zener transitions of the anticrossed surface acoustic Wannier-Stark states, is developed. The use of a planar geometry for the realization of the Bloch oscillations and Landau-Zener tunneling allows a direct access to the elastic field distribution. The vertical surface displacement has been measured by interferometry.

  20. POP Experiment of Laser Stripping via a Broad Stark State Using BNL 200MeV H- Beams

    International Nuclear Information System (INIS)

    Yamane, I.; Mimashi, T.; Nakayama, H.; Suzuki, T.; Takayama, K.; Tawada, M.; Satoh, K.; Raparia, D.; Alessi, J.; Blaskiewicz, M.; Cameron, P.; Connoly, R.; Hershcovitch, A.; Lee, Y.Y.; LoDestro, V.; Ritter, J.; Wei, J.

    2005-01-01

    Present status of the project of the POP (proof of principle) experiment of laser stripping using BNL 200MeV H- is presented. First, the principle of the laser stripping via a broad Stark state and the role of the broad Stark state are introduced. Then, the scheme of the POP experiment using 200MeV H- is given. Then, the concrete plan of experimental setup in the REF beam line of the BNL 200MeV H- Linac and present status of construction are given

  1. Stark-state resonances induced by low-frequency elliptically polarized fields

    Science.gov (United States)

    Richards, D.

    1997-09-01

    We analyse the effect of a low-frequency elliptically polarized electric field on an excited hydrogen atom using classical dynamics. It is shown that at particular frequencies the ionization probability is a non-monotonic function of the field strength and that at these frequencies the classical ionization probabilities agree well with those of experiment. We show that this unusual behaviour is produced by resonance between Stark states and the driving field near the circularly polarized limit. By averaging over the fast motion, to produce a mean-motion approximation, we show how the resonance affects the motion and that the effect is different according to whether the electron is initially rotating in the same or in the opposite direction to the field.

  2. Quality Of Starking Apples After Exposure To Gamma Radiation As A Quarantine Treatment

    International Nuclear Information System (INIS)

    Mansour, M.; Mohamad, F.; Al-Bachir, M.

    2004-01-01

    Starking apples approaching physiological maturity were exposed, immediately after harvest, to gamma radiation doses ranging from 100 to 400 Gy. The irradiated fruit were stored for six months in a cold storage facility at 1±1 deg. C and 90±5 % RH. Effects of gamma radiation on weight loss, fruit firmness, pH of fruit juice, fruit taste, color and visible injuries were evaluated. The results showed that gamma irradiation increased weight loss, particularly in the first 45 days of storage. Doses higher than 200 Gy, on the other hand, reduced apple firmness after 45 days of storage while a 400 Gy dose decreased fruit pH immediately after irradiation. (Authors)

  3. A New Analysis of Stark and Zeeman Effects on Hydrogen Lines in Magnetized DA White Dwarfs

    Directory of Open Access Journals (Sweden)

    Ny Kieu

    2017-11-01

    Full Text Available White dwarfs with magnetic field strengths larger than 10 T are understood to represent more than 10% of the total population of white dwarfs. The presence of such strong magnetic fields is clearly indicated by the Zeeman triplet structure visible on absorption lines. In this work, we discuss the line broadening mechanisms and focus on the sensitivity of hydrogen lines on the magnetic field. We perform new calculations in conditions relevant to magnetized DA stellar atmospheres using models inspired from magnetic fusion plasma spectroscopy. A white dwarf spectrum from the Sloan Digital Sky Survey (SDSS database is analyzed. An effective temperature is provided by an adjustment of the background radiation with a Planck function, and the magnetic field is inferred from absorption lines presenting a Zeeman triplet structure. An order-of-magnitude estimate for the electron density is also performed from Stark broadening analysis.

  4. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  5. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  6. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  7. AC-coupled front-end for biopotential measurements.

    Science.gov (United States)

    Spinelli, Enrique Mario; Pallàs-Areny, Ramon; Mayosky, Miguel Angel

    2003-03-01

    AC coupling is essential in biopotential measurements. Electrode offset potentials can be several orders of magnitude larger than the amplitudes of the biological signals of interest, thus limiting the admissible gain of a dc-coupled front end to prevent amplifier saturation. A high-gain input stage needs ac input coupling. This can be achieved by series capacitors, but in order to provide a bias path, grounded resistors are usually included, which degrade the common mode rejection ratio (CMRR). This paper proposes a novel balanced input ac-coupling network that provides a bias path without any connection to ground, thus resulting in a high CMRR. The circuit being passive, it does not limit the differential dc input voltage. Furthermore, differential signals are ac coupled, whereas common-mode voltages are dc coupled, thus allowing the closed-loop control of the dc common mode voltage by means of a driven-right-leg circuit. This makes the circuit compatible with common-mode dc shifting strategies intended for single-supply biopotential amplifiers. The proposed circuit allows the implementation of high-gain biopotential amplifiers with a reduced number of parts, thus resulting in low power consumption. An electrocardiogram amplifier built according to the proposed design achieves a CMRR of 123 dB at 50 Hz.

  8. Quantum confined Stark effects of single dopant in polarized hemispherical quantum dot: Two-dimensional finite difference approach and Ritz-Hassé variation method

    Science.gov (United States)

    El Harouny, El Hassan; Nakra Mohajer, Soukaina; Ibral, Asmaa; El Khamkhami, Jamal; Assaid, El Mahdi

    2018-05-01

    Eigenvalues equation of hydrogen-like off-center single donor impurity confined in polarized homogeneous hemispherical quantum dot deposited on a wetting layer, capped by insulated matrix and submitted to external uniform electric field is solved in the framework of the effective mass approximation. An infinitely deep potential is used to describe effects of quantum confinement due to conduction band offsets at surfaces where quantum dot and surrounding materials meet. Single donor ground state total and binding energies in presence of electric field are determined via two-dimensional finite difference approach and Ritz-Hassé variation principle. For the latter method, attractive coulomb correlation between electron and ionized single donor is taken into account in the expression of trial wave function. It appears that off-center single dopant binding energy, spatial extension and radial probability density are strongly dependent on hemisphere radius and single dopant position inside quantum dot. Influence of a uniform electric field is also investigated. It shows that Stark effect appears even for very small size dots and that single dopant energy shift is more significant when the single donor is near hemispherical surface.

  9. Magnetic quantum phase transition in Cr-doped Bi2(SexTe1-x)3 driven by the Stark effect

    Science.gov (United States)

    Zhang, Zuocheng; Feng, Xiao; Wang, Jing; Lian, Biao; Zhang, Jinsong; Chang, Cuizu; Guo, Minghua; Ou, Yunbo; Feng, Yang; Zhang, Shou-Cheng; He, Ke; Ma, Xucun; Xue, Qi-Kun; Wang, Yayu

    2017-10-01

    The recent experimental observation of the quantum anomalous Hall effect has cast significant attention on magnetic topological insulators. In these magnetic counterparts of conventional topological insulators such as Bi2Te3, a long-range ferromagnetic state can be established by chemical doping with transition-metal elements. However, a much richer electronic phase diagram can emerge and, in the specific case of Cr-doped Bi2(SexTe1-x)3, a magnetic quantum phase transition tuned by the actual chemical composition has been reported. From an application-oriented perspective, the relevance of these results hinges on the possibility to manipulate magnetism and electronic band topology by external perturbations such as an electric field generated by gate electrodes—similar to what has been achieved in conventional diluted magnetic semiconductors. Here, we investigate the magneto-transport properties of Cr-doped Bi2(SexTe1-x)3 with different compositions under the effect of a gate voltage. The electric field has a negligible effect on magnetic order for all investigated compositions, with the remarkable exception of the sample close to the topological quantum critical point, where the gate voltage reversibly drives a ferromagnetic-to-paramagnetic phase transition. Theoretical calculations show that a perpendicular electric field causes a shift in the electronic energy levels due to the Stark effect, which induces a topological quantum phase transition and, in turn, a magnetic phase transition.

  10. Slowing and cooling of heavy or light (even with a tiny electric dipole moment) polar molecules using a novel, versatile electrostatic Stark decelerator.

    Science.gov (United States)

    Wang, Qin; Hou, Shunyong; Xu, Liang; Yin, Jianping

    2016-02-21

    To meet some demands for realizing precise measurements of an electric dipole moment of electron (eEDM) and examining cold collisions or cold chemical physics, we have proposed a novel, versatile electrostatic Stark decelerator with an array of true 3D electric potential wells, which are created by a series of horizontally-oriented, U-shaped electrodes with time-sequence controlling high voltages (± HV) and two guiding electrodes with a constant voltage. We have calculated the 2D electric field distribution, the Stark shifts of the four lowest rotational sub-levels of PbF molecules in the X1(2)Π1/2(v = 0) electronic and vibrational ground states as well as the population in the different rotational levels. We have discussed the 2D longitudinal and transverse phase-space acceptances of PbF molecules in our decelerator. Subsequently, we have simulated the dynamic processes of the decelerated PbF molecules using the 3D Monte-Carlo method, and have found that a supersonic PbF beam with a velocity of 300 m s(-1) can be efficiently slowed to about 5 m s(-1), which will greatly enhance the sensitivities to research a parity violation and measure an eEDM. In addition, we have investigated the dependences of the longitudinal velocity spread, longitudinal temperature and bunching efficiency on both the number of guiding stages and high voltages, and found that after bunching, a cold packet of PbF molecules in the J = 7/2, MΩ = -7/4 state with a longitudinal velocity spread of 0.69 m s(-1) (corresponding to a longitudinal temperature of 2.35 mK) will be produced by our high-efficient decelerator, which will generate a high energy-resolution molecular beam for studying cold collision physics. Finally, our novel decelerator can also be used to efficiently slow NO molecules with a tiny electric dipole moment (EDM) of 0.16 D from 315 m s(-1) to 28 m s(-1). It is clear that our proposed new decelerator has a good slowing performance and experimental feasibility as well as wide

  11. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  12. Strong quantum-confined stark effect in germanium quantum-well structures on silicon

    International Nuclear Information System (INIS)

    Kuo, Y.; Lee, Y. K.; Gei, Y.; Ren, S; Roth, J. E.; Miller, D. A.; Harris, J. S.

    2006-01-01

    Silicon is the dominant semiconductor for electronics, but there is now a growing need to integrate such component with optoelectronics for telecommunications and computer interconnections. Silicon-based optical modulators have recently been successfully demonstrated but because the light modulation mechanisms in silicon are relatively weak, long (for example, several millimeters) devices or sophisticated high-quality-factor resonators have been necessary. Thin quantum-well structures made from III-V semiconductors such as GaAs, InP and their alloys exhibit the much stronger Quantum-Confined Stark Effect (QCSE) mechanism, which allows modulator structures with only micrometers of optical path length. Such III-V materials are unfortunately difficult to integrate with silicon electronic devices. Germanium is routinely integrated with silicon in electronics, but previous silicon-germanium structures have also not shown strong modulation effects. Here we report the discovery of the QCSE, at room temperature, in thin germanium quantum-well structures grown on silicon. The QCSE here has strengths comparable to that in III-V materials. Its clarity and strength are particularly surprising because germanium is an indirect gap semiconductor, such semiconductors often display much weak optical effects than direct gap materials (such as the III-V materials typically used for optoelectronics). This discovery is very promising for small, high-speed, low-power optical output devices fully compatible with silicon electronics manufacture. (author)

  13. Quantum-confined Stark effect in GaN/AlN quantum dots in nanowires

    Science.gov (United States)

    Renard, Julien; Songmuang, R.; Tourbot, G.; Bougerol, C.; Daudin, B.; Gayral, B.

    2010-03-01

    GaN/AlGaN heterostructures have attracted much interest in the past few years due to their potential for optoelectronic applications such as UV light emission or telecommunication wavelength intersubband devices. More recently, many studies focused on nanowire heterostructures, because such geometry is very likely to lead to a dramatic reduction of the defect density thanks to the free surface in comparison with two dimensional (2D) structures. This reduction is indeed very appealing for light emission application. It is well known that the quantum confined Stark effect strongly influences the optical properties of 2D heterostructures. In contrast, the strain reduction and the presence of the surface could potentially lead to a very different picture for nanowire heterostructures. In InGaN/GaN nanowire heterostructures, it has been shown that the QCSE is strongly reduced [1] as a consequence of the decrease of the piezoelectric polarization. We addressed this issue for GaN/AlN nanowire heterostructures and evidenced the presence of a strong QCSE [2]. This demonstrates the importance of the spontaneous polarization in nanowire heterostructures. [1] Y. Kawakami et al, Appl. Phys. Lett. 89, 163124 (2006) [2] J. Renard et al, Phys. Rev. B 80, 121305 (R) (2009)

  14. Electron Stark Broadening Database for Atomic N, O, and C Lines

    Science.gov (United States)

    Liu, Yen; Yao, Winifred M.; Wray, Alan A.; Carbon, Duane F.

    2012-01-01

    A database for efficiently computing the electron Stark broadening line widths for atomic N, O, and C lines is constructed. The line width is expressed in terms of the electron number density and electronatom scattering cross sections based on the Baranger impact theory. The state-to-state cross sections are computed using the semiclassical approximation, in which the atom is treated quantum mechanically whereas the motion of the free electron follows a classical trajectory. These state-to-state cross sections are calculated based on newly compiled line lists. Each atomic line list consists of a careful merger of NIST, Vanderbilt, and TOPbase line datasets from wavelength 50 nm to 50 micrometers covering the VUV to IR spectral regions. There are over 10,000 lines in each atomic line list. The widths for each line are computed at 13 electron temperatures between 1,000 K 50,000 K. A linear least squares method using a four-term fractional power series is then employed to obtain an analytical fit for each line-width variation as a function of the electron temperature. The maximum L2 error of the analytic fits for all lines in our line lists is about 5%.

  15. Determination of ground and excited state dipole moments via electronic Stark spectroscopy: 5-methoxyindole

    Energy Technology Data Exchange (ETDEWEB)

    Wilke, Josefin; Wilke, Martin; Schmitt, Michael, E-mail: mschmitt@uni-duesseldorf.de [Institut für Physikalische Chemie, Heinrich-Heine-Universität, D-40225 Düsseldorf (Germany); Meerts, W. Leo, E-mail: leo.meerts@science.ru.nl [Institute for Molecules and Materials, Radboud University, NL-6525 AS Nijmegen (Netherlands)

    2016-01-28

    The dipole moments of the ground and lowest electronically excited singlet state of 5-methoxyindole have been determined by means of optical Stark spectroscopy in a molecular beam. The resulting spectra arise from a superposition of different field configurations, one with the static electric field almost parallel to the polarization of the exciting laser radiation, the other nearly perpendicular. Each field configuration leads to different intensities in the rovibronic spectrum. With an automated evolutionary algorithm approach, the spectra can be fit and the ratio of both field configurations can be determined. A simultaneous fit of two spectra with both field configurations improved the precision of the dipole moment determination by a factor of two. We find a reduction of the absolute dipole moment from 1.59(3) D to 1.14(6) D upon electronic excitation to the lowest electronically excited singlet state. At the same time, the dipole moment orientation rotates by 54{sup ∘} showing the importance of the determination of the dipole moment components. The dipole moment in the electronic ground state can approximately be obtained from a vector addition of the indole and the methoxy group dipole moments. However, in the electronically excited state, vector addition completely fails to describe the observed dipole moment. Several reasons for this behavior are discussed.

  16. Study on theta-pinch turbulent plasma parameters by Stark broadenning of hydrogen-like helium ion spectral lines

    International Nuclear Information System (INIS)

    Bardinov, A.A.; Berezin, A.B.; Burtsev, V.A.; Lyublin, B.V.; Ratkevich, V.K.; Smirnov, V.G.; Solnyshkov, D.A.; Yasevich, V.Yu.

    1986-01-01

    A method for studying parameters of turbulent fields excited in a high-temperature plasma based on the analysis of a hydrogen-like helium ion He 2 having the ionization potential 4 times greater than that of a hydrogen atom is proposed. If turbulent oscillations are excited in plasma, their electric fields also broaden the spectral lines due to the Stark effect that can be used for studying characteristics of these fields. The method is used for studying parameters of the θ-pinch turbulent plasma, when the θ-pinch discharge is initiated in a quartz discharge chamber 6 cm in diameter. The experiments have permitted to find the θ-pinch plasma parameters. They have shown the prospecs of using the Stark broadening of hydrogen-like ions for studying characteristics of instabilities excited in a hot plasma

  17. Ca2+-stimulated adenylyl cyclase isoform AC1 is preferentially expressed in guinea-pig sino-atrial node cells and modulates the I(f) pacemaker current.

    Science.gov (United States)

    Mattick, Paul; Parrington, John; Odia, Efe; Simpson, Alasdair; Collins, Thomas; Terrar, Derek

    2007-08-01

    Ca(2+)-stimulated adenylyl cyclases (AC) are known to play important roles in neurons but have not previously been reported in the heart. Here we present the first evidence for selective expression of Ca(2+)-stimulated AC in the sino-atrial node (SAN) but not in ventricular muscle of the guinea-pig heart. The AC1 isoform of Ca(2+)-stimulated AC was shown to be present in SAN, both as mRNA using RT-PCR and as protein using immuno-blotting with a specific antibody. Confocal immuno-fluorescence studies detected membrane localization of AC1 in SAN cells, but no AC1 in ventricular muscle. Ca(2+)-stimulated AC8 may also be present in SAN. The functional importance of AC activity was investigated by monitoring activation of I(f) (gated by hyperpolarization and regulated by cAMP, which shifts activation to more depolarized voltages). Basal activity of AC in isolated SAN myocytes was demonstrated by the observations that an inhibitor of AC activity (MDL 12330A, 10 microm) shifted activation in the hyperpolarizing direction, while inhibition of phosphodiesterases (IBMX, 100 microm) shifted I(f) activation in the depolarizing direction. Buffering cytosolic Ca(2+) with the Ca(2+) chelator BAPTA (by exposure to BAPTA-AM) shifted activation of I(f) in the hyperpolarizing direction, and under these conditions the AC inhibitor MDL had little or no further effect. The actions of BAPTA were overcome by exposure to forskolin (10 microm), a direct stimulator of all AC isoforms, to restore cAMP levels. These effects are consistent with the functional importance of Ca(2+)-stimulated AC, which is expected to be fundamental to initiation and regulation of the heartbeat.

  18. SNS AC Power Distribution and Reliability of AC Power Supply

    CERN Document Server

    Holik, Paul S

    2005-01-01

    The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*

  19. Dokumentation der Fachtagung "Resilienz - Was Kinder aus armen Familien stark macht" am 13. September 2005 in Frankfurt am Main

    OpenAIRE

    2006-01-01

    "Die Dokumentation ist das Ergebnis der Fachtagung 'Resilienz: Was Kinder aus armen Familien stark macht', die das ISS-Frankfurt a.M. am 13. September 2005 durchgeführt hat. Ziel der Fachtagung war es, notwendige Brücken zwischen den fachlichen Diskursen zu bauen. Es sollten Informationen zur aktuellen Kinderarmutsforschung und Resilienzforschung gegeben, Herausforderungen für das professionelle sozialpädagogische Handeln identifiziert sowie Erfahrungen praktische Handlungsansätze reflektiert...

  20. Bloch oscillations and Wannier-Stark localization in a tight-binding lattice with increasing intersite coupling

    International Nuclear Information System (INIS)

    Longhi, S.

    2009-01-01

    The onset of Bloch oscillations in an exactly solvable one-dimensional tight-binding lattice model with increasing hopping rates between adjacent sites is theoretically investigated. In particular, it is shown that Wannier-Stark localization is attained at a finite value of the applied dc field. An optical realization of the lattice model, based on light transport in engineered waveguide arrays, is also proposed.

  1. Study of Stark broadening of Li I 460 and 497 nm spectral lines with independent plasma diagnostics by Thomson scattering

    Science.gov (United States)

    Dzierżȩga, Krzysztof; Piȩta, Tomasz; Zawadzki, Witold; Stambulchik, Evgeny; Gavrilović-Božović, Marijana; Jovićević, Sonja; Pokrzywka, Bartłomiej

    2018-02-01

    We present results of experimental and theoretical studies of the Stark broadening of the Li I 460 nm spectral line with forbidden components and of the isolated 497 nm line. Plasma was induced by Nd:YAG laser radiation at 1064 nm with pulse duration ∼4.5 ns. Laser-induced plasma was generated in front of the alumina pellet, with some content of Li2CO3, placed in a vacuum chamber filled with argon under reduced pressure. Plasma diagnostics was performed using the laser Thomson scattering technique, free from assumptions about the plasma equilibrium state and its composition and so independently of plasma emission spectra. Spatially resolved spectra with Li lines were obtained from the measured, laterally integrated ones applying the inverse Abel transform. The Stark profiles were calculated by computer simulation method assuming a plasma in the local thermodynamic equilibrium. Calculations were performed for experimentally-inferred electron densities and temperatures, from 1.422 × 1023 to 3.55 × 1022 m‑3 and from 1.96 eV to 1.04 eV, respectively. Our studies show very good agreement between experimental Stark profiles and those computer simulated.

  2. WATER TEMPERATURE and other data from STARK in the NW Atlantic from 1992-04-28 to 1992-04-30 (NODC Accession 9200106)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The data in this accession were collected in NW Atlantic (limit-40 W) from ship STARK between April 28, 1992 and April 30, 1992. The real time data of water...

  3. Measured, calculated and predicted Stark widths of the singly ionized C, N, O, F, Ne, Si, P, S, Cl and Ar spectral lines

    Directory of Open Access Journals (Sweden)

    Djeniže S.

    2000-01-01

    Full Text Available In order to find reliable Stark width data, needed in plasma spectroscopy comparision between the existing measured, calculated and predicted Stark width values was performed for ten singly ionized emitters: C, N, O, F, Ne Si, P, S, Cl and Ar in the lower lying 3s - 3p, 3p - 3d and 4s - 4p transitions. These emitters are present in many cosmic light sources. On the basis of the agreement between mentioned values 17 spectral lines from six singly ionized spectra have been recommended, for the first time, for plasma spectroscopy as spectral lines with reliable Stark width data. Critical analysis of the existing Stark width data is also given.

  4. Turbidity, SOLAR RADIATION - ATMOSPHERIC and other data from STARK in the NW Atlantic from 1991-01-01 to 1991-12-31 (NODC Accession 9600031)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Station Data from 17 stations; and Conductivity, Temperature and Depth (CTD) data from 49 casts were collected using ship Stark during cruises # 688-711....

  5. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  6. OpenShift Workshop

    CERN Multimedia

    CERN. Geneva; Rodriguez Peon, Alberto

    2017-01-01

    Workshop to introduce developers to the OpenShift platform available at CERN. Several use cases will be shown, including deploying an existing application into OpenShift. We expect attendees to realize about OpenShift features and general architecture of the service.

  7. Microwave-induced crystallization of AC/TiO{sub 2} for improving the performance of rhodamine B dye degradation

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Fei [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Wu, Zhansheng, E-mail: wuzhans@126.com [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Chen, Qiuyu; Yan, Yujun [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Cravotto, Giancarlo; Wu, Zhilin [Dipartimento di Scienza e Tecnologia del Farmaco, University of Turin, Torino 10125 (Italy)

    2015-10-01

    Graphical abstract: - Highlights: • Mixed phase titania coated with AC was obtained by microwave irradiation method. • The TiO{sub 2} nanoparticles were spherical and well distributed on the surface of AC. • The light absorption edges of AC/TiO{sub 2} showed red-shift compared to the pure TiO{sub 2}. • Higher surface and TiO{sub 2} content of AC/TiO{sub 2} could improve photocatalytic efficiency. - Abstract: Titanium dioxide (TiO{sub 2}) deposition on activated carbon (AC) is widely used for pollutant photodegradation. In this study, a simple and efficient method for preparing AC/TiO{sub 2} composites under microwave irradiation was developed for photocatalytic degradation of rhodamine B (RhB) under UV light. Results of X-ray diffraction, scanning electron microscopy, and transmission electron microscopy revealed that TiO{sub 2} nanoparticles are anatase and rutile, with a spherical shape and a particle size of 20–50 nm and are well distributed on the AC surface. The UV–vis spectrum of TiO{sub 2} coated on AC showed an evident red-shift and exhibited stronger optical absorption capacity than pure TiO{sub 2}. The AC/TiO{sub 2} nanoparticles prepared at a microwave power of 700 W for 15 min exhibited 98% efficiency in removing RhB dye under UV irradiation for 30 min. The high photocatalytic activity of AC/TiO{sub 2}-700 W could be mainly attributed to the high sorption capacity of the mesoporous carbon material and high TiO{sub 2} content, which could produce higher quantity of ·OH. This study provides a rapid synthesis technique to prepare AC/TiO{sub 2} and a novel method to improve photocatalytic efficiency via synergistic effect for other catalytic systems.

  8. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  9. Three phase AC motor controller

    Science.gov (United States)

    Vuckovich, Michael; Wright, Maynard K.; Burkett, John P.

    1984-03-20

    A motor controller for a three phase AC motor (10) which is adapted to operate bidirectionally from signals received either from a computer (30) or a manual control (32). The controller is comprised of digital logic circuit means which implement a forward and reverse command signal channel (27, 29) for the application of power through the forward and reverse power switching relays (16, 18, 20, 22). The digital logic elements are cross coupled to prevent activation of both channels simultaneously and each includes a plugging circuit (65, 67) for stopping the motor upon the removal of control signal applied to one of the two channels (27, 29) for a direction of rotation desired. Each plugging circuit (65, 67) includes a one-shot pulse signal generator (88, 102) which outputs a single pulse signal of predetermined pulsewidth which is adapted to inhibit further operation of the application of power in the channel which is being activated and to apply a reversal command signal to the other channel which provides a reversed phase application of power to the motor for a period defined by the pulse-width output of the one-shot signal generator to plug the motor (10) which will then be inoperative until another rotational command signal is applied to either of the two channels.

  10. Influence of SDBD plasma aerodynamic actuation on flow control by AC power supply and AC-DC power supply

    Science.gov (United States)

    Hu, Xu; Gao, Chao; Hao, Jiangnan

    2018-01-01

    In this paper, the excitation effect of single dielectric barrier discharge plasma actuator (SDBD) is compared by using AC power supply and AC-DC power supply. AC-DC power supply is based on the AC power supply, just adding DC component. The flow measurement is carried out by PIV technique. Results show that the excitation effect of AC power supply and AC-DC power supply increases by the increase of voltage, the range of speed field excited by AC power is greater than that of AC-DC power supply. For x direction maximum speed, excited by AC power supply is close to AC-DC, and for y direction maximum speed, AC power supply is greater than AC-DC power supply. So the excitation effect of AC power supply is better than that of AC-DC power supply for SDBD.

  11. Isotope shifts in the 7 S -> 8 S transition of francium: measurements and comparison to ab-initio theory

    Science.gov (United States)

    Kalita, Mukut; Behr, John; Gorelov, Alexandre; Pearson, Matthew; Dehart, Austin; Gwinner, Gerald; Kossin, Michael; Aubin, Seth; Gomez, Eduardo; Orozco, Luis A.; Dzuba, Vladimir; Flambaum, Victor; Safronova, Marianna

    2017-04-01

    The Standard Model can be tested at low energies by probing parity non-conservation (PNC) effects in atomic systems. At the francium trapping facility at TRIUMF, we are developing a Stark interference experiment to probe PNC in neutral francium atoms using the 7 S -> 8 S atomic transition. We have observed this transition in francium using two-photon spectroscopy. This allows the extraction of the isotope shifts of the 8 S state. We have measured the shifts on five isotopes 208 , 209 , 210 , 211 , 213Fr of cold trapped atoms. Using our previously measured isotope shifts of the 7P1 / 2 level we can extract the ratio of field shift constants and the relation between specific mass shift constants. The experimental results will be compared to recent ab-initio calculations. Funded by NSERC, NRC/TRIUMF, DOE, NSF, CONACYT, Australian Research Council and U. of Manitoba.

  12. Implementing OpenShift

    CERN Document Server

    Miller, Adam

    2013-01-01

    A standard tutorial-based approach to using OpenShift and deploying custom or pre-built web applications to the OpenShift Online cloud.This book is for software developers and DevOps alike who are interested in learning how to use the OpenShift Platform-as-a-Service for developing and deploying applications, how the environment works on the back end, and how to deploy their very own open source Platform-as-a-Service based on the upstream OpenShift Origin project.

  13. Improved transistorized AC motor controller for battery powered urban electric passenger vehicles

    Science.gov (United States)

    Peak, S. C.

    1982-01-01

    An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.

  14. An MRI-Compatible High Frequency AC Resistive Heating System for Homeothermic Maintenance in Small Animals.

    Science.gov (United States)

    Gilchrist, Stuart; Gomes, Ana L; Kinchesh, Paul; Kersemans, Veerle; Allen, Philip D; Smart, Sean C

    2016-01-01

    To develop an MRI-compatible resistive heater, using high frequency alternating current (AC), for temperature maintenance of anaesthetised animals. An MRI-compatible resistive electrical heater was formed from narrow gauge wire connected to a high frequency (10-100 kHz) AC power source. Multiple gradient echo images covering a range of echo times, and pulse-acquire spectra were acquired with the wire heater powered using high frequency AC or DC power sources and without any current flowing in order to assess the sensitivity of the MRI acquisitions to the presence of current flow through the heater wire. The efficacy of temperature maintenance using the AC heater was assessed by measuring rectal temperature immediately following induction of general anaesthesia for a period of 30 minutes in three different mice. Images and spectra acquired in the presence and absence of 50-100 kHz AC through the wire heater were indistinguishable, whereas DC power created field shifts and lineshape distortions. Temperature lost during induction of anaesthesia was recovered within approximately 20 minutes and a stable temperature was reached as the mouse's temperature approached the set target. The AC-powered wire heater maintains adequate heat input to the animal to maintain body temperature, and does not compromise image quality.

  15. An MRI-Compatible High Frequency AC Resistive Heating System for Homeothermic Maintenance in Small Animals.

    Directory of Open Access Journals (Sweden)

    Stuart Gilchrist

    Full Text Available To develop an MRI-compatible resistive heater, using high frequency alternating current (AC, for temperature maintenance of anaesthetised animals.An MRI-compatible resistive electrical heater was formed from narrow gauge wire connected to a high frequency (10-100 kHz AC power source. Multiple gradient echo images covering a range of echo times, and pulse-acquire spectra were acquired with the wire heater powered using high frequency AC or DC power sources and without any current flowing in order to assess the sensitivity of the MRI acquisitions to the presence of current flow through the heater wire. The efficacy of temperature maintenance using the AC heater was assessed by measuring rectal temperature immediately following induction of general anaesthesia for a period of 30 minutes in three different mice.Images and spectra acquired in the presence and absence of 50-100 kHz AC through the wire heater were indistinguishable, whereas DC power created field shifts and lineshape distortions. Temperature lost during induction of anaesthesia was recovered within approximately 20 minutes and a stable temperature was reached as the mouse's temperature approached the set target.The AC-powered wire heater maintains adequate heat input to the animal to maintain body temperature, and does not compromise image quality.

  16. Stark shift and electric-field-induced dissociation of excitons in monolayer MoS2 and hBN/MoS2 heterostructures

    DEFF Research Database (Denmark)

    Haastrup, Sten; Latini, Simone; Bolotin, Kirill

    2016-01-01

    of an applied in-plane electric field. The dissociation rates are obtained as the inverse lifetime of the resonant states of a two-dimensional hydrogenic Hamiltonian which describes the exciton within the Mott-Wannier model. The resonances are computed using complex scaling, and the effective masses...

  17. Accurate evaluation of fast threshold voltage shift for SiC MOS devices under various gate bias stress conditions

    Science.gov (United States)

    Sometani, Mitsuru; Okamoto, Mitsuo; Hatakeyama, Tetsuo; Iwahashi, Yohei; Hayashi, Mariko; Okamoto, Dai; Yano, Hiroshi; Harada, Shinsuke; Yonezawa, Yoshiyuki; Okumura, Hajime

    2018-04-01

    We investigated methods of measuring the threshold voltage (V th) shift of 4H-silicon carbide (SiC) metal–oxide–semiconductor field-effect transistors (MOSFETs) under positive DC, negative DC, and AC gate bias stresses. A fast measurement method for V th shift under both positive and negative DC stresses revealed the existence of an extremely large V th shift in the short-stress-time region. We then examined the effect of fast V th shifts on drain current (I d) changes within a pulse under AC operation. The fast V th shifts were suppressed by nitridation. However, the I d change within one pulse occurred even in commercially available SiC MOSFETs. The correlation between I d changes within one pulse and V th shifts measured by a conventional method is weak. Thus, a fast and in situ measurement method is indispensable for the accurate evaluation of I d changes under AC operation.

  18. Homogeneous bilateral block shifts

    Indian Academy of Sciences (India)

    Homogeneous bilateral block shifts. ADAM KORÁNYI. Department of Mathematics, The Graduate Center, City University of New York,. New York, NY 10016, USA. E-mail: Adam.Koranyi@lehman.cuny.edu. MS received 18 January 2013. Abstract. A new 3-parameter family of homogeneous 2-by-2 block shifts is described.

  19. Homogeneous bilateral block shifts

    Indian Academy of Sciences (India)

    A new 3-parameter family of homogeneous 2-by-2 block shifts is described. These are the first examples of irreducible homogeneous bilateral block shifts of block size larger than 1. Author Affiliations. Adam Korányi1. Department of Mathematics, The Graduate Center, City University of New York, New York, NY 10016, USA ...

  20. Homogeneous bilateral block shifts

    Indian Academy of Sciences (India)

    Douglas class were classified in [3]; they are unilateral block shifts of arbitrary block size (i.e. dim H(n) can be anything). However, no examples of irreducible homogeneous bilateral block shifts of block size larger than 1 were known until now.

  1. Shifting employment revisited

    NARCIS (Netherlands)

    Cremers, Jan; Gramuglia, Alessia

    2014-01-01

    The CLR-network examined in 2006 the phenomenon of undeclared labour, with specific regard to the construction sector. The resulting study, Shifting Employment: undeclared labour in construction (Shifting-study hereafter), gave evidence that this is an area particularly affected by undeclared

  2. OpenShift cookbook

    CERN Document Server

    Gulati, Shekhar

    2014-01-01

    If you are a web application developer who wants to use the OpenShift platform to host your next big idea but are looking for guidance on how to achieve this, then this book is the first step you need to take. This is a very accessible cookbook where no previous knowledge of OpenShift is needed.

  3. Dynamic-Stark-effect-induced coherent mixture of virtual paths in laser-dressed helium: energetic electron impact excitation

    Science.gov (United States)

    Agueny, Hicham; Makhoute, Abdelkader; Dubois, Alain

    2017-06-01

    We theoretically investigate quantum virtual path interference caused by the dynamic Stark effect in bound-bound electronic transitions. The effect is studied in an intermediate resonant region and in connection with the energetic electron impact excitation of a helium atom embedded in a weak low-frequency laser field. The process under investigation is dealt with via a Born-Floquet approach. Numerical calculations show a resonant feature in laser-assisted cross sections. The latter is found to be sensitive to the intensity of the laser field dressing. We show that this feature is a signature of quantum beats which result from the coherent mixture of different quantum virtual pathways, and that excitation may follow in order to end up with a common final channel. This mixture arises from the dynamic Stark effect, which produces a set of avoided crossings in laser-dressed states. The effect allows one to coherently control quantum virtual path interference by varying the intensity of the laser field dressing. Our findings suggest that the combination of an energetic electron and a weak laser field is a useful tool for the coherent control of nonadiabatic transitions in an intermediate resonant region.

  4. Two-Gyro Pointing Stability of HST measured with ACS

    Science.gov (United States)

    Koekemoer, Anton M.; Kozhurina-Platais, Vera; Riess, Adam; Sirianni, Marco; Biretta, John; Pavlovsky

    2005-06-01

    We present the results of the pointing stability tests for HST, as measured with the ACS/ HRC during the Two-Gyro test program conducted in February 2005. We measure the shifts of 185 exposures of the globular clusters NGC6341 and Omega Centauri, obtained over a total of 13 orbits, and compare the measured pointings to those that were commanded in the observing program. We find in all cases that the measured shifts and rotations have the same level of accuracy as those that were commanded in three-gyro mode. Specifically, the pointing offsets during an orbit relative to the first exposure can be characterized with distributions having a dispersion of 2.3 milliarcseconds for shifts and 0.00097 degrees for rotations, thus less than 0.1 HRC pixels, and agree extremely well with similar values measured for comparable exposures obtained in three-gyro mode. In addition, we successfully processed these two-gyro test data through the MultiDrizzle software which is used in the HST pipeline to perform automated registration, cosmic ray rejection and image combination for multiple exposure sequences, and we find excellent agreement with similar exposures obtained in three-gyro mode. In summary, we find no significant difference between the quality of HST pointing as measured from these two-gyro test data, relative to the nominal behavior of HST in regular three-gyro operations.

  5. AC distribution system for TFTR pulsed loads

    International Nuclear Information System (INIS)

    Carroll, R.F.; Ramakrishnan, S.; Lemmon, G.N.; Moo, W.I.

    1977-01-01

    This paper outlines the AC distribution system associated with the Tokamak Fusion Test Reactor and discusses the significant areas related to design, protection, and equipment selection, particularly where there is a departure from normal utility and industrial applications

  6. Logistics Reduction: Advanced Clothing System (ACS)

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

  7. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  8. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  9. Nurses' shift reports

    DEFF Research Database (Denmark)

    Buus, Niels; Hoeck, Bente; Hamilton, Bridget Elizabeth

    2017-01-01

    practices were described as highly conventionalised and locally situated, but with occasional opportunities for improvisation and negotiation between nurses. Finally, shift reports were described as multifunctional meetings, with individual and social effects for nurses and teams. CONCLUSION: Innovations...... of nurses' shift reports. BACKGROUND: Nurses' shift reports are routine occurrences in healthcare organisations that are viewed as crucial for patient outcomes, patient safety and continuity of care. Studies of communication between nurses attend primarily to 1:1 communication and analyse the adequacy...... and negotiate care....

  10. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  11. Shift Verification and Validation

    Energy Technology Data Exchange (ETDEWEB)

    Pandya, Tara M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Evans, Thomas M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Davidson, Gregory G [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Johnson, Seth R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Godfrey, Andrew T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2016-09-07

    This documentation outlines the verification and validation of Shift for the Consortium for Advanced Simulation of Light Water Reactors (CASL). Five main types of problems were used for validation: small criticality benchmark problems; full-core reactor benchmarks for light water reactors; fixed-source coupled neutron-photon dosimetry benchmarks; depletion/burnup benchmarks; and full-core reactor performance benchmarks. We compared Shift results to measured data and other simulated Monte Carlo radiation transport code results, and found very good agreement in a variety of comparison measures. These include prediction of critical eigenvalue, radial and axial pin power distributions, rod worth, leakage spectra, and nuclide inventories over a burn cycle. Based on this validation of Shift, we are confident in Shift to provide reference results for CASL benchmarking.

  12. Extensión del Formalismo de Orbitales de Defecto Cuántico al tratamiento del efecto Stark (SQDO).

    Science.gov (United States)

    Menéndez, J. M.; Martín, I.; Velasco, A. M.

    El estudio experimental de las interacciones de átomos Rydberg altamente excitados con campos eléctricos ha experimentado un creciente interés durante las dos últimas décadas debido, en gran medida, al desarrollo de nuevas técnicas para crear y estudiar átomos Rydberg en el laboratorio. Acompañando a estas nuevas técnicas experimentales, es necesario el desarrollo de modelos teóricos que nos permitan contrastar sus medidas y conocer mejor los fundamentos de los mismos. Desde el punto de vista teórico el conocimiento del desdoblamiento de los niveles energéticos de un átomo en función de la magnitud del campo eléctrico aplicado (lo que se conoce como mapa Stark) es el mejor punto de partida para la descripción del sistema y un prerrequisito fundamental para el cálculo de distintas propiedades atómicas en presencia del campo eléctrico tales como intensidades de transición, umbrales de ionización de campo eléctrico, tiempos de vida, posición y anchura de cruces evitados, etc. En este trabajo presentamos la adaptación del método de orbitales de defecto cuántico [1,2,3] al tratamiento del efecto Stark (SQDO) [4] y su aplicación al cálculo de los desdoblamientos energéticos y fuerzas de oscilador de estados Rydberg en los átomos de Li, Na y K. El propósito de este estudio es, por un lado, desarrollar métodos fiables para la determinación de propiedades atómicas en presencia de campos eléctricos y, por otro, mostrar la fiabilidad de las funciones de onda QDO en la descripción del efecto Stark en sistemas atómicos.

  13. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (< 1 mCi) quantities for in-house chemistry and imaging research that aims to improve and assess 225Ac radiopharmaceutical targeting. This presentation provides an overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  14. Overview of equilibrium reconstruction on DIII-D using new measurements from an expanded motional Stark effect diagnostic

    International Nuclear Information System (INIS)

    Holcomb, C; Makowski, M; Allen, S; Meyer, W; Van Zeeland, M

    2008-01-01

    Motional Stark effect (MSE) measurements constrain equilibrium reconstruction of DIII-D tokamak plasmas using the equilibrium code EFIT. In 2007, two new MSE arrays were brought online, bringing the system to three core arrays, two edge arrays, and 64 total channels. We present the first EFIT reconstructions using this expanded system. Safety factor and E R profiles produced by fitting to data from the two new arrays and one of the other three agree well with independent measurements. Comparison of the data from the three arrays that view the core shows that one of the older arrays is inconsistent with the other two unless the measured calibration factors for this array are adjusted. The required adjustments depend on toroidal field and plasma current direction, and on still other uncertain factors that change as the plasma evolves. We discuss possible sources of calibration error for this array

  15. An expanded genetic code for probing the role of electrostatics in enzyme catalysis by vibrational Stark spectroscopy.

    Science.gov (United States)

    Völler, Jan-Stefan; Biava, Hernan; Hildebrandt, Peter; Budisa, Nediljko

    2017-11-01

    To find experimental validation for electrostatic interactions essential for catalytic reactions represents a challenge due to practical limitations in assessing electric fields within protein structures. This review examines the applications of non-canonical amino acids (ncAAs) as genetically encoded probes for studying the role of electrostatic interactions in enzyme catalysis. ncAAs constitute sensitive spectroscopic probes to detect local electric fields by exploiting the vibrational Stark effect (VSE) and thus have the potential to map the protein electrostatics. Mapping the electrostatics in proteins will improve our understanding of natural catalytic processes and, in beyond, will be helpful for biocatalyst engineering. This article is part of a Special Issue entitled "Biochemistry of Synthetic Biology - Recent Developments" Guest Editor: Dr. Ilka Heinemann and Dr. Patrick O'Donoghue. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. single-phase dc phase dc-ac boost converter ac boost converter

    African Journals Online (AJOL)

    User

    supply (UPS) AC motor drives and other power sup systems, need to step-up the DC input voltage. increase the output voltage level in order requirements, DC-DC boost converter is used provide DC bus voltage for PWM inverters. Hence, conventional design always cascades DC and a separate DC-AC converter.

  17. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  18. Stark Widths of Hydrogen Spectral Lines in Plasmas: a Highly-Advanced Non-Simulative Semiclassical Theory and Tables

    International Nuclear Information System (INIS)

    Oks, Eugene

    2006-01-01

    Plasma spectroscopy had served as a fertile field for applications of the formalism of Dressed Atomic States in Plasmas (DASP). The theory named in the title of this paper is based primarily on a generalization of the formalism of DASP. In its contemporary composition, this theory brings together: A) non-impact description of the indirect coupling of the electron and ion microfields; B) non-binary description of the direct coupling of the electron and ion microfields; C) non-binary non-impact description of the ion-dynamical broadening. The latter produces, in particular, a new counter-intuitive result for the dependence of the Ion-Dynamical Stark Width (IDSW) on the temperature T: it predicts that in distinction to the high-T limit, for which it was known that IDSW ∼ 1/T1/2, in the low-T limit the temperature dependence changes to IDSW ∼ T1/4. In other words, as the temperature decreases from the high-T limit, the IDSW first increases ∼ 1/T1/2, then reaches a maximum, and then decreases ∼ T1/4 (this being a non-binary result). A non-binary result on the density dependence of the IDSW is also presented. The theory composed of the above items A), B), C), is used for creating extensive Tables of Stark widths of hydrogen lines in plasmas. By comparison with benchmark experiments, it is shown that these Tables are more accurate than the corresponding tables published previously by other authors

  19. Experimental determination of the Stark broadening of Cu I spectral lines in a plasma of a capillary discharge

    International Nuclear Information System (INIS)

    Sandolache, G.; Zoita, V.; Bauchire, M.; Le Menn, E.; Gentils, F.; Fleurier, C.

    2001-01-01

    Copper lines are frequently observed in various types of plasma device and industrial plasmas and then it is desirable to develop methods of plasma diagnostics using the emission spectrum of copper lines. The aim of this work is to create a database for the neutral copper spectral lines directly usable for the diagnostic of plasmas with metal vapors. An experimental device has been developed to create a metal plasma having the required metrological properties to facilitate the spectroscopic measurements. A capillary discharge technique has been used to create a plasma jet representing a radially symmetric light source. The copper-hydrogen plasma jet was produced by the ablation of the capillary wall consisting of a copper-embedded elastomer. The plasma jet was observed side-on using the high-resolution spectrometers equipped with ICCD detectors. The 2D square matrix ICCD detectors have permitted the observation of cross sections of the plasma jet. The high-speed time resolved camera equipped with interference filters has been used to check the cylindrical shape and the homogeneity of the plasma jet. The electron density of the plasma jet was obtained by using the H α spectral line of the hydrogen component plasma. The temperature was determined by applying the relative intensity method to the measured intensities of the neutral copper spectral lines emitted by the plasma jet. The hydrogen and copper lines were broadened principally by the Stark effect. The measured temperatures were about 15,000 K and the electron density of about 2x10 17 cm -3 . The results of the Stark broadening of the neutral cooper concerned particularly the lines 453.9 nm, 465.1 nm, 515.3 nm and 529.2 nm. (authors)

  20. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  1. Alternating current (AC) iontophoretic transport across human epidermal membrane: effects of AC frequency and amplitude.

    Science.gov (United States)

    Yan, Guang; Xu, Qingfang; Anissimov, Yuri G; Hao, Jinsong; Higuchi, William I; Li, S Kevin

    2008-03-01

    As a continuing effort to understand the mechanisms of alternating current (AC) transdermal iontophoresis and the iontophoretic transport pathways in the stratum corneum (SC), the objectives of the present study were to determine the interplay of AC frequency, AC voltage, and iontophoretic transport of ionic and neutral permeants across human epidermal membrane (HEM) and use AC as a means to characterize the transport pathways. Constant AC voltage iontophoresis experiments were conducted with HEM in 0.10 M tetraethyl ammonium pivalate (TEAP). AC frequencies ranging from 0.0001 to 25 Hz and AC applied voltages of 0.5 and 2.5 V were investigated. Tetraethyl ammonium (TEA) and arabinose (ARA) were the ionic and neutral model permeants, respectively. In data analysis, the logarithm of the permeability coefficients of HEM for the model permeants was plotted against the logarithm of the HEM electrical resistance for each AC condition. As expected, linear correlations between the logarithms of permeability coefficients and the logarithms of resistances of HEM were observed, and the permeability data were first normalized and then compared at the same HEM electrical resistance using these correlations. Transport enhancement of the ionic permeant was significantly larger than that of the neutral permeant during AC iontophoresis. The fluxes of the ionic permeant during AC iontophoresis of 2.5 V in the frequency range from 5 to 1,000 Hz were relatively constant and were approximately 4 times over those of passive transport. When the AC frequency decreased from 5 to 0.001 Hz at 2.5 V, flux enhancement increased to around 50 times over passive transport. While the AC frequency for achieving the full effect of iontophoretic enhancement at low AC frequency was lower than anticipated, the frequency for approaching passive diffusion transport at high frequency was higher than expected from the HEM morphology. These observations are consistent with a transport model of multiple

  2. Shapiro steps for skyrmion motion on a washboard potential with longitudinal and transverse ac drives

    Science.gov (United States)

    Reichhardt, C.; Reichhardt, C. J. Olson

    2015-12-01

    We numerically study the behavior of two-dimensional skyrmions in the presence of a quasi-one-dimensional sinusoidal substrate under the influence of externally applied dc and ac drives. In the overdamped limit, when both dc and ac drives are aligned in the longitudinal direction parallel to the direction of the substrate modulation, the velocity-force curves exhibit classic Shapiro step features when the frequency of the ac drive matches the washboard frequency that is dynamically generated by the motion of the skyrmions over the substrate, similar to previous observations in superconducting vortex systems. In the case of skyrmions, the additional contribution to the skyrmion motion from a nondissipative Magnus force shifts the location of the locking steps to higher dc drives, and we find that the skyrmions move at an angle with respect to the direction of the dc drive. For a longitudinal dc drive and a perpendicular or transverse ac drive, the overdamped system exhibits no Shapiro steps; however, when a finite Magnus force is present, we find pronounced transverse Shapiro steps along with complex two-dimensional periodic orbits of the skyrmions in the phase-locked regimes. Both the longitudinal and transverse ac drives produce locking steps whose widths oscillate with increasing ac drive amplitude. We examine the role of collective skyrmion interactions and find that additional fractional locking steps occur for both longitudinal and transverse ac drives. At higher skyrmion densities, the system undergoes a series of dynamical order-disorder transitions, with the skyrmions forming a moving solid on the phase locking steps and a fluctuating dynamical liquid in regimes between the steps.

  3. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    Over the last decade, distributed energy resources (DER) technology has undergone a fast development. Increased penetration of DER units and wide spread use of renewable energy sources challenge the entire architecture of traditional power system. Microgrid, characterizing higher flexibility...... and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  4. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  5. Superconducting three element synchronous ac machine

    International Nuclear Information System (INIS)

    Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

    1975-01-01

    There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

  6. Recovery of slow potentials in AC-coupled electrocorticography: application to spreading depolarizations in rat and human cerebral cortex

    DEFF Research Database (Denmark)

    Hartings, Jed A; Watanabe, Tomas; Dreier, Jens P

    2009-01-01

    -band waveforms from AC-coupled recordings. We constructed digital filters that reproduced the phase and amplitude distortions introduced by specific AC-coupled amplifiers and, based on this characterization, derived digital inverse filters to remove these distortions from ECoG recordings. Performance....... The spreading SPCs of depolarization waves are observed in human cortex with AC-coupled electrocorticography (ECoG), although SPC morphology is distorted by the high-pass filter stage of the amplifiers. Here, we present a signal processing method to reverse these distortions and recover approximate full...... recovered full-band waveforms with morphologic characteristics typical of the negative DC shifts recorded in animals. Compared with those recorded in the rat cortex with the same analog and digital methods, the negative DC shifts of human depolarizations had significantly greater durations (1:47 vs. 0...

  7. Vibrational Stark effect of the electric-field reporter 4-mercaptobenzonitrile as a tool for investigating electrostatics at electrode/SAM/solution interfaces

    NARCIS (Netherlands)

    Schkolnik, G.; Salewski, J.; Millo, D.; Zebger, I.; Franzen, S.; Hildebrandt, P.

    2012-01-01

    4-mercaptobenzonitrile (MBN) in self-assembled monolayers (SAMs) on Au and Ag electrodes was studied by surface enhanced infrared absorption and Raman spectroscopy, to correlate the nitrile stretching frequency with the local electric field exploiting the vibrational Stark effect (VSE). Using MBN

  8. Mixing of exciton and charge-transfer states in Photosystem II reaction centers: Modeling of stark spectra with modified redfield theory

    NARCIS (Netherlands)

    Novoderezhkin, V.I.; Dekker, J.P.; van Grondelle, R.

    2007-01-01

    We propose an exciton model for the Photosystem II reaction center (RC) based on a quantitative simultaneous fit of the absorption, linear dichroism, circular dichroism, steady-state fluorescence, triplet-minus-singlet, and Stark spectra together with the spectra of pheophytin-modified RCs, and

  9. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  10. Preliminary study on AC superconducting machines

    International Nuclear Information System (INIS)

    Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

    1988-01-01

    This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

  11. AC conductivity for a holographic Weyl semimetal

    Energy Technology Data Exchange (ETDEWEB)

    Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)

    2017-03-23

    We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.

  12. Relativistic light-shift theory of few-electron systems: Heliumlike highly charged ions

    Science.gov (United States)

    Postavaru, O.; Scafes, A. C.

    2017-09-01

    The light-shift theory of many-electron systems in a laser field is described using the projection operators technique. In heavy ions, the electrons are tightly bound by the Coulomb potential of the nucleus, which prohibits ionization even by strong lasers. However, interaction with the monofrequent laser field leads to dynamic shifts of the electronic energy levels, and the process is treated by second-order time-dependent perturbation theory. In order to treat heliumlike systems, one decomposes the corresponding matrix elements into hydrogenlike matrix elements using the independent particle model. We are applying a fully relativistic description of the electronic states by means of the Dirac equation. Our formalism goes beyond the Stark long-wavelength dipole approximation and takes into account nondipole effects of retardation and interaction with the magnetic field components of the laser beam.

  13. Multi-phase AC/AC step-down converter for distribution systems

    Energy Technology Data Exchange (ETDEWEB)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  14. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  15. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles.

    Science.gov (United States)

    Monte, Tainá C C; Gentile, Rosana; Garcia, Juberlan; Mota, Ester; Santos, Jeannie N; Maldonado Júnior, Arnaldo

    2014-12-01

    Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. cantonensis: ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1), but the same was not observed for ac8 (1.2:1). The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male) and distance from the anus to the rear end (female) compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  16. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  17. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele...

  18. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    intuition and reason, not by perception and induction'. On the Platonist view, because sentences cannot have either spatial or temporal location, they cannot have material properties either. This timeless and 'spaceless' nature of sentences Katz and Postal (1989:7) illustrate with reference http://spilplus.journals.ac.za/ ...

  19. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    deficiency, but to boorishness or ill-will. While grammatical error may reveal a speaker to be a less than proficient language- http://spilplus.journals.ac.za/ .... problems of meanlng, language use and the various linguistic aspects of interaction... contrastive analysis without a pragmalinguistic dimension is inadequate.".

  20. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    in general terms,. ° what does Gutt see as significant conceptual consequences of his work? Needless to say, the framework for this talk will be Sperber and. Wilson's relevance theory of verbal communication, which was sketched in yesterday's contribution by Melinda Sinclair. Within http://spilplus.journals.ac.za/ ...

  1. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  2. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to dat...

  3. Shifting Up a Gear.

    Science.gov (United States)

    Palmer, Martin

    1997-01-01

    Shift workers are often excluded from educational opportunities on and off the job. General education and leisure learning needs are addressed less than job-specific training needs. Providers should consider open/distance learning, creative marketing, targeted funding, and consortia of employer-developed programs. (SK)

  4. Understanding regime shifts

    DEFF Research Database (Denmark)

    Heymann, Matthias; Nielsen, Kristian Hvidtfelt

    ”. Danish wind power development is all the more surprising, as the innovation process in wind technology was carried to a large extent by non-academic craftsmen and political activists. Many features of this innovation story have been investigated and that research makes it possible to summarize...... the current understanding of the regime shift....

  5. Shifting employment revisited

    NARCIS (Netherlands)

    Cremers, J.; Gramuglia, A.

    2014-01-01

    The CLR-network examined in 2006 the phenomenon of undeclared labour, with specific regard to the construction sector. The resulting study, Shifting Employment: undeclared labour in construction, gave evidence that this is an area particularly affected by undeclared activities with one of the

  6. Paradigm Shifts into Giftedness.

    Science.gov (United States)

    Meckstroth, Elizabeth

    1992-01-01

    The process of recognizing qualities of giftedness in a child evokes a range of responses in families, affecting the roles and relationships of an entire family system as the whole family constellation shifts to accommodate a child's giftedness, and each family member's reactions differ because of their own particular temperament, personality,…

  7. The role of baculovirus apoptotic suppressors in AcMNPV-mediated translation arrest in Ld652Y cells

    International Nuclear Information System (INIS)

    Thiem, Suzanne M.; Chejanovsky, Nor

    2004-01-01

    Infecting the insect cell line IPLB-Ld652Y with the baculovirus Autographa californica multinucleocapsid nucleopolyhedrovirus (AcMNPV) results in global translation arrest, which correlates with the presence of the AcMNPV apoptotic suppressor, p35. In this study, we investigated the role of apoptotic suppression on AcMNPV-induced translation arrest. Infecting cells with AcMNPV bearing nonfunctional mutant p35 did not result in global translation arrest. In contrast, global translation arrest was observed in cells infected with AcMNPV in which p35 was replaced with Opiap, Cpiap, or p49, baculovirus apoptotic suppressors that block apoptosis by different mechanisms than p35. These results indicated that suppressing apoptosis triggered translation arrest in AcMNPV-infected Ld652Y cells. Experiments using the DNA synthesis inhibitor aphidicolin and temperature shift experiments, using the AcMNPV replication mutants ts8 and ts8Δp35, indicated that translation arrest initiated during the early phase of infection, but events during the late phase were required for global translation arrest. Peptide caspase inhibitors could not substitute for baculovirus apoptotic suppressors to induce translation arrest in Ld652Y cells infected with a p35-null virus. However, if the p35-null-AcMNPV also carried hrf-1, a novel baculovirus host range gene, progeny virus was produced and treatment with peptide caspase inhibitors enhanced translation of a late viral gene transcript. Together, these results indicate that translation arrest in AcMNPV-infected Ld652Y cells is due to the anti-apoptotic function of p35, but suggests that rather than simply preventing caspase activation, its activity enhances signaling to a separate translation arrest pathway, possibly by stimulating the late stages of the baculovirus infection cycle

  8. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  9. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  10. Mechanical spectral shift reactor

    International Nuclear Information System (INIS)

    Wilson, J.F.; Sherwood, D.G.

    1982-01-01

    A mechanical spectral shift reactor comprises a reactive core having fuel assemblies accommodating both water displacer elements and neutron absorbing control rods for selectively changing the volume of water-moderator in the core. The fuel assemblies with displacer and control rods are arranged in alternating fashion so that one displacer element drive mechanism may move displacer elements in more than one fuel assembly without interfering with the movement of control rods of a corresponding control rod drive mechanisms. (author)

  11. Validation of archived chemical shifts through atomic coordinates

    Science.gov (United States)

    Rieping, Wolfgang; Vranken, Wim F

    2010-01-01

    The public archives containing protein information in the form of NMR chemical shift data at the BioMagResBank (BMRB) and of 3D structure coordinates at the Protein Data Bank are continuously expanding. The quality of the data contained in these archives, however, varies. The main issue for chemical shift values is that they are determined relative to a reference frequency. When this reference frequency is set incorrectly, all related chemical shift values are systematically offset. Such wrongly referenced chemical shift values, as well as other problems such as chemical shift values that are assigned to the wrong atom, are not easily distinguished from correct values and effectively reduce the usefulness of the archive. We describe a new method to correct and validate protein chemical shift values in relation to their 3D structure coordinates. This method classifies atoms using two parameters: the per-atom solvent accessible surface area (as calculated from the coordinates) and the secondary structure of the parent amino acid. Through the use of Gaussian statistics based on a large database of 3220 BMRB entries, we obtain per-entry chemical shift corrections as well as Z scores for the individual chemical shift values. In addition, information on the error of the correction value itself is available, and the method can retain only dependable correction values. We provide an online resource with chemical shift, atom exposure, and secondary structure information for all relevant BMRB entries (http://www.ebi.ac.uk/pdbe/nmr/vasco) and hope this data will aid the development of new chemical shift-based methods in NMR. Proteins 2010. © 2010 Wiley-Liss, Inc. PMID:20602353

  12. Mid-infrared signatures of hydroxyl containing water clusters: Infrared laser Stark spectroscopy of OH–H{sub 2}O and OH(D{sub 2}O){sub n} (n = 1-3)

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez, Federico J. [Department of Chemistry, University of Georgia, Athens, Georgia 30602 (United States); INFIQC, Dpto. de Fisicoquímica, Facultad de Ciencias Químicas, Centro Láser de Ciencias Moleculares, Universidad Nacional de Córdoba, Ciudad Universitaria, Pabellón, X5000HUA Córdoba (Argentina); Brice, Joseph T.; Leavitt, Christopher M.; Liang, Tao; Douberly, Gary E., E-mail: douberly@uga.edu [Department of Chemistry, University of Georgia, Athens, Georgia 30602 (United States); Raston, Paul L. [Department of Chemistry and Biochemistry, James Madison University, Harrisonburg, Virginia 22807 (United States); Pino, Gustavo A. [INFIQC, Dpto. de Fisicoquímica, Facultad de Ciencias Químicas, Centro Láser de Ciencias Moleculares, Universidad Nacional de Córdoba, Ciudad Universitaria, Pabellón, X5000HUA Córdoba (Argentina)

    2015-10-28

    Small water clusters containing a single hydroxyl radical are synthesized in liquid helium droplets. The OH–H{sub 2}O and OH(D{sub 2}O){sub n} clusters (n = 1-3) are probed with infrared laser spectroscopy in the vicinity of the hydroxyl radical OH stretch vibration. Experimental band origins are qualitatively consistent with ab initio calculations of the global minimum structures; however, frequency shifts from isolated OH are significantly over-predicted by both B3LYP and MP2 methods. An effective Hamiltonian that accounts for partial quenching of electronic angular momentum is used to analyze Stark spectra of the OH–H{sub 2}O and OH–D{sub 2}O binary complexes, revealing a 3.70(5) D permanent electric dipole moment. Computations of the dipole moment are in good agreement with experiment when large-amplitude vibrational averaging is taken into account. Polarization spectroscopy is employed to characterize two vibrational bands assigned to OH(D{sub 2}O){sub 2}, revealing two nearly isoenergetic cyclic isomers that differ in the orientation of the non-hydrogen-bonded deuterium atoms relative to the plane of the three oxygen atoms. The dipole moments for these clusters are determined to be approximately 2.5 and 1.8 D for “up-up” and “up-down” structures, respectively. Hydroxyl stretching bands of larger clusters containing three or more D{sub 2}O molecules are observed shifted approximately 300 cm{sup −1} to the red of the isolated OH radical. Pressure dependence studies and ab initio calculations imply the presence of multiple cyclic isomers of OH(D{sub 2}O){sub 3}.

  13. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  14. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    is then added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  15. Collapse of DNA in ac Electric Fields

    Science.gov (United States)

    Zhou, Chunda; Reisner, Walter W.; Staunton, Rory J.; Ashan, Amir; Austin, Robert H.; Riehn, Robert

    2011-06-01

    We report that double-stranded DNA collapses in the presence of ac electric fields at frequencies of a few hundred Hertz, and does not stretch as commonly assumed. In particular, we show that confinement-stretched DNA can collapse to about one quarter of its equilibrium length. We propose that this effect is based on finite relaxation times of the counterion cloud, and the subsequent partitioning of the molecule into mutually attractive units. We discuss alternative models of those attractive units.

  16. Collapse of DNA in ac electric fields.

    Science.gov (United States)

    Zhou, Chunda; Reisner, Walter W; Staunton, Rory J; Ashan, Amir; Austin, Robert H; Riehn, Robert

    2011-06-17

    We report that double-stranded DNA collapses in the presence of ac electric fields at frequencies of a few hundred Hertz, and does not stretch as commonly assumed. In particular, we show that confinement-stretched DNA can collapse to about one quarter of its equilibrium length. We propose that this effect is based on finite relaxation times of the counterion cloud, and the subsequent partitioning of the molecule into mutually attractive units. We discuss alternative models of those attractive units.

  17. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  18. Tunable room-temperature spin-selective optical Stark effect in solution-processed layered halide perovskites.

    Science.gov (United States)

    Giovanni, David; Chong, Wee Kiang; Dewi, Herlina Arianita; Thirumal, Krishnamoorthy; Neogi, Ishita; Ramesh, Ramamoorthy; Mhaisalkar, Subodh; Mathews, Nripan; Sum, Tze Chien

    2016-06-01

    Ultrafast spin manipulation for opto-spin logic applications requires material systems that have strong spin-selective light-matter interaction. Conventional inorganic semiconductor nanostructures [for example, epitaxial II to VI quantum dots and III to V multiple quantum wells (MQWs)] are considered forerunners but encounter challenges such as lattice matching and cryogenic cooling requirements. Two-dimensional halide perovskite semiconductors, combining intrinsic tunable MQW structures and large oscillator strengths with facile solution processability, can offer breakthroughs in this area. We demonstrate novel room-temperature, strong ultrafast spin-selective optical Stark effect in solution-processed (C6H4FC2H4NH3)2PbI4 perovskite thin films. Exciton spin states are selectively tuned by ~6.3 meV using circularly polarized optical pulses without any external photonic cavity (that is, corresponding to a Rabi energy of ~55 meV and equivalent to applying a 70 T magnetic field), which is much larger than any conventional system. The facile halide and organic replacement in these perovskites affords control of the dielectric confinement and thus presents a straightforward strategy for tuning light-matter coupling strength.

  19. Position- and time-resolved Stark broadening diagnostics of a non-thermal laser-induced plasma

    International Nuclear Information System (INIS)

    Liu, Hao; Truscott, Benjamin S; Ashfold, Michael N R

    2016-01-01

    We present an analysis of the Stark-broadened line shapes of silicon ions in a laser-induced plasma using a model constructed, without assuming local thermodynamic equilibrium (LTE), using a Druyvesteyn electron energy distribution function (EEDF). The method is applied to temporally and spatially resolved measurements of Si 2+ and Si 3+ emissions from a transient plasma expanding into vacuum, produced by 1064 nm, nanosecond pulsed laser ablation of a Si (1 0 0) target. The best-fitting simulated line shapes and the corresponding electron number densities and temperatures (or equivalently, Druyvesteyn average energies) are compared with those returned assuming LTE (i.e. for a Maxwellian EEDF). Non-thermal behavior is found to dominate at all but the very earliest stages of expansion close to the target surface, consistent with McWhirter’s criterion for the establishment of LTE. The Druyvesteyn EEDF always yields an equivalent or better model of the experimental measurements, and the observed increasingly strong departure from the Maxwellian case with time and distance from the ablation event highlights the essential invalidity of the LTE assumption for moderate-power, nanosecond laser-induced plasma expanding in vacuo. (paper)

  20. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  1. UARS PEM Level 2 VMAG AC V001

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  2. Impedance Spectroscopy and AC Conductivity Studies of Bulk 3-Amino-7-(dimethylamino)-2-methyl-hydrochloride

    Science.gov (United States)

    El-Shabaan, M. M.

    2018-02-01

    Impedance spectroscopy and alternating-current (AC) conductivity (σ AC) studies of bulk 3-amino-7-(dimethylamino)-2-methyl-hydrochloride (neutral red, NR) have been carried out over the temperature (T) range from 303 K to 383 K and frequency (f) range from 0.5 kHz to 5 MHz. Dielectric data were analyzed using the complex impedance (Z *) and complex electric modulus (M *) for bulk NR at various temperatures. The impedance loss peaks were found to shift towards high frequencies, indicating an increase in the relaxation time (τ 0) and loss in the material, with increasing temperature. For each temperature, a single depressed semicircle was observed at high frequencies, originating from the bulk transport, and a spike in the low-frequency region, resulting from the electrode effect. Fitting of these curves yielded an equivalent circuit containing a parallel combination of a resistance R and constant-phase element (CPE) Q. The carrier transport in bulk NR is governed by the correlated barrier hopping (CBH) mechanism, some parameters of which, such as the maximum barrier height (W M), charge density (N), and hopping distance (r), were determined as functions of both temperature and frequency. The frequency dependence of σ AC at different temperatures indicated that the conduction in bulk NR is a thermally activated process. The σ AC value at different frequencies increased linearly with temperature.

  3. Anti-Stokes emissions and determination of Stark sub-level diagram of Er{sup 3+} ions in KY{sub 3}F{sub 10}

    Energy Technology Data Exchange (ETDEWEB)

    Boulma, E [Laboratoire d' Energetique et d' Optique, UTAP, Universite de Reims Champagne-Ardenne, BP 1039, Reims Cedex 51 687 (France); Diaf, M [Departement de Physique, Universite Badji Mokhtar Annaba, BP12, 23000 Annaba, Algerie (Germany); Jouart, J P [Laboratoire d' Energetique et d' Optique, UTAP, Universite de Reims Champagne-Ardenne, BP 1039, Reims Cedex 51 687 (France); Bouffard, M [Laboratoire d' Energetique et d' Optique, UTAP, Universite de Reims Champagne-Ardenne, BP 1039, Reims Cedex 51 687 (France); Doualan, J L [Centre Interdisciplinaire de Recherches Ions Lasers (CIRIL), UMR 6637 CNRS-CEA-ISMRA, ENSI de Caen, 6 Boulevard Marechal Juin, 14050 Caen Cedex (France); Moncorge, R [Centre Interdisciplinaire de Recherches Ions Lasers (CIRIL), UMR 6637 CNRS-CEA-ISMRA, ENSI de Caen, 6 Boulevard Marechal Juin, 14050 Caen Cedex (France)

    2006-07-26

    We are interested, in this work, in determining the Stark sub-level of Er{sup 3+} ions doping a KY{sub 3}F{sub 10} single crystal with a molar concentration of 1%. We have used a new method of measurement of energies of the ground level and emitting levels from excitation and anti-Stokes emission spectra recorded at liquid nitrogen temperature. This technique is based on a spectral analysis of the anti-Stokes emissions recorded after selective excitation with a red dye tunable laser. Thus, we could determine the Stark sub-levels of the ground and the principal emitting levels in the infrared, visible and near-UV ranges with a very good precision.

  4. Experimental evidence in favour of the Stark mixing of atomic L-subshell states in the boron impact of Au and Bi

    International Nuclear Information System (INIS)

    Padhi, H.C.; Dhal, B.B.; Nandi, T.; Trautmann, D.

    1995-01-01

    L-subshell ionization of Au and Bi induced by boron impact has been investigated for impact energies ranging from 0.48 to 0.88 MeV/μ. The energy dependence of the measured ionization cross section shows, for the first time, a plateau structure for all three subshells. The plateau structure revealed by previous data for proton and helium impact was for the L 1 subshell only and this had been attributed to the bimodal nature of the 2s electron density. The observed plateau structure for all the three subshells and its occurrence at a somewhat lower energy signifies a considerable amount of Stark mixing of target 2s and 2p atomic wavefunctions. Fresh calculations incorporating the Stark mixing effect in target atomic wavefunctions are necessary to improve agreement with the present data. The existing theories, however, are found to be inadequate. (author)

  5. Anti-Stokes emissions and determination of Stark sub-level diagram of Er3+ ions in KY3F10

    International Nuclear Information System (INIS)

    Boulma, E; Diaf, M; Jouart, J P; Bouffard, M; Doualan, J L; Moncorge, R

    2006-01-01

    We are interested, in this work, in determining the Stark sub-level of Er 3+ ions doping a KY 3 F 10 single crystal with a molar concentration of 1%. We have used a new method of measurement of energies of the ground level and emitting levels from excitation and anti-Stokes emission spectra recorded at liquid nitrogen temperature. This technique is based on a spectral analysis of the anti-Stokes emissions recorded after selective excitation with a red dye tunable laser. Thus, we could determine the Stark sub-levels of the ground and the principal emitting levels in the infrared, visible and near-UV ranges with a very good precision

  6. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  7. Local Electric Field Strength in a Hollow Cathode Determined by Stark Splitting of the 2S Level of Hydrogen Isotopes by Optogalvanic Spectroscopy

    International Nuclear Information System (INIS)

    Perez, C.; Rosa, M. I. de la; Gruetzmacher, K.; Fuentes, L. M.; Gonzalo, A. B.

    2008-01-01

    In this work we present Doppler-free two-photon optogalvanic spectroscopy as a tool to measure the electric field strength in the cathode fall region of a hollow cathode discharge via the Stark splitting of the 2S level of atomic deuterium. The strong electric field strength present in the hollow cathode is determined for various discharge conditions which allows studying the corresponding variations of the cathode fall, and its changes with discharge operation time.

  8. Roles of the quadrupole interaction and of the quadratic stark effect in spectral lines from plasmas interacting with a strong quasimonochromatic electric field

    Czech Academy of Sciences Publication Activity Database

    Sauvan, P.; Dalimier, E.; Riconda, C.; Oks, E.; Renner, Oldřich; Weber, S.

    2010-01-01

    Roč. 1, č. 2 (2010), s. 123-128 ISSN 2229-3159 R&D Projects: GA MŠk(CZ) LC528 Institutional research plan: CEZ:AV0Z10100523 Keywords : laser-plasma interaction * PIC plasma model ing * strong quasimonochromatic electric fields * x-ray line broadening * stark effect * floquet theory Subject RIV: BH - Optics, Masers, Lasers http://www.auburn.edu/academic/cosam/departments/physics/iramp/1_2/sauvan_et_al.pdf

  9. Shift rostering using decomposition: assign weekend shifts first

    NARCIS (Netherlands)

    van der Veen, Egbert; Hans, Elias W.; Post, Gerhard F.; Veltman, Bart

    This paper introduces a shift rostering problem that surprisingly has not been studied in literature: the weekend shift rostering problem. It is motivated by our experience that employees’ shift preferences predominantly focus on the weekends, since many social activities happen during weekends. The

  10. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  11. Repetition and Translation Shifts

    Directory of Open Access Journals (Sweden)

    Simon Zupan

    2006-06-01

    Full Text Available Repetition manifests itself in different ways and at different levels of the text. The first basic type of repetition involves complete recurrences; in which a particular textual feature repeats in its entirety. The second type involves partial recurrences; in which the second repetition of the same textual feature includes certain modifications to the first occurrence. In the article; repetitive patterns in Edgar Allan Poe’s short story “The Fall of the House of Usher” and its Slovene translation; “Konec Usherjeve hiše”; are compared. The author examines different kinds of repetitive patterns. Repetitions are compared at both the micro- and macrostructural levels. As detailed analyses have shown; considerable microstructural translation shifts occur in certain types of repetitive patterns. Since these are not only occasional; sporadic phenomena; but are of a relatively high frequency; they reduce the translated text’s potential for achieving some of the gothic effects. The macrostructural textual property particularly affected by these shifts is the narrator’s experience as described by the narrative; which suffers a reduction in intensity.

  12. Lanthanide shift reagents, binding, shift mechanisms and exchange

    International Nuclear Information System (INIS)

    Boer, J.W.M. de

    1977-01-01

    Paramagnetic lanthanide shift reagents, when added to a solution of a substrate, induce shifts in the nuclear magnetic resonance (NMR) spectrum of the substrate molecules. The induced shifts contain information about the structure of the shift reagent substrate complex. The structural information, however, may be difficult to extract because of the following effects: (1) different complexes between shift reagent and substrate may be present in solution, e.g. 1:1 and 1:2 complexes, and the shift observed is a weighed average of the shifts of the substrate nuclei in the different complexes; (2) the Fermi contact interaction, arising from the spin density at the nucleus, contributes to the induced shift; (3) chemical exchange effects may complicate the NMR spectrum. In this thesis, the results of an investigation into the influence of these effects on the NMR spectra of solutions containing a substrate and LSR are presented. The equations describing the pseudo contact and the Fermi contact shift are derived. In addition, it is shown how the modified Bloch equations describing the effect of the chemical exchange processes occurring in the systems studied can be reduced to the familiar equations for a two-site exchange case. The binding of mono- and bifunctional ethers to the shift reagent are reported. An analysis of the induced shifts is given. Finally, the results of the experiments performed to study the exchange behavior of dimethoxyethane and heptafluorodimethyloctanedionato ligands are presented

  13. Efficient relaxations for joint chance constrained AC optimal power flow

    Energy Technology Data Exchange (ETDEWEB)

    Baker, Kyri; Toomey, Bridget

    2017-07-01

    Evolving power systems with increasing levels of stochasticity call for a need to solve optimal power flow problems with large quantities of random variables. Weather forecasts, electricity prices, and shifting load patterns introduce higher levels of uncertainty and can yield optimization problems that are difficult to solve in an efficient manner. Solution methods for single chance constraints in optimal power flow problems have been considered in the literature, ensuring single constraints are satisfied with a prescribed probability; however, joint chance constraints, ensuring multiple constraints are simultaneously satisfied, have predominantly been solved via scenario-based approaches or by utilizing Boole's inequality as an upper bound. In this paper, joint chance constraints are used to solve an AC optimal power flow problem while preventing overvoltages in distribution grids under high penetrations of photovoltaic systems. A tighter version of Boole's inequality is derived and used to provide a new upper bound on the joint chance constraint, and simulation results are shown demonstrating the benefit of the proposed upper bound. The new framework allows for a less conservative and more computationally efficient solution to considering joint chance constraints, specifically regarding preventing overvoltages.

  14. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  15. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  16. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  17. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    OpenAIRE

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  18. Comportamento Acústico de Fachadas: Isolamento Acústico versus Permeabilidade ao Ar

    OpenAIRE

    Ferreira, Diogo Miguel do Rosário

    2016-01-01

    Nos dias de hoje, o conforto acústico dos edifícios revela-se como um factor muito importante no contexto da comodidade global dos seus habitantes. Para tanto, contribui de forma relevante o isolamento sonoro que as fachadas dos edifícios possam assegurar. Sendo as fachadas constituídas por uma parte opaca e uma outra translúcida, é esta última a que mais condiciona o isolamento acústico que o elemento fachada proporciona, o qual é influenciado tanto pela janela propriamente dita, como pelas ...

  19. The effects of ultrasonic pretreatment and structural changes during the osmotic dehydration of the 'Starking' apple (Malus domestica Borkh)

    Energy Technology Data Exchange (ETDEWEB)

    Rosa-Mendoza, M. E.; Fernandez-Munoz, J. L.; Arjona-Roman, J. L.

    2012-11-01

    During the osmotic dehydration (OD) of fruit, the cell membrane displays a high resistance to mass transfer, thereby reducing the dehydration rate. To reduce thermal damage to cell membranes, alternative methods have recently been introduced to reduce the initial moisture content and/or modify the structure of fruit tissue. The aim of this work was to evaluate the effects of an ultrasound (US) pretreatment for OD on the effective diffusion coefficients and to observe the changes in the molecular structure of 'Starking' apple cubes by Fourier-transform infrared spectroscopy (FTIR) during a 3 h process using a 45 dregee Bx sucrose solution at 60 degree centigrade. In the pretreatment step, apple samples were immersed in an ultrasonic bath at 45 kHz for 20 min. The effective diffusion coefficients for water (Dew) and solids (Des) were calculated from the observed osmotic kinetics according to Fick's second law for the transient state. The solids coefficients were higher than the water coefficients in both processes due to the concentration difference (De = 7.7 × 10{sup -}9 and 9.7 × 10{sup -}9 m{sup 2} s{sup -}1 for ODUS). The structural changes were determined by FTIR by measuring the molecular vibration frequency for sucrose. The 1,500-900 cm{sup -}1 region of the infrared spectra was used to monitor the effect of sucrose concentration on fruit structure. We observed that the first bonds formed were C-H and C-O-C stretching (at 920 and 1,129 cm{sup -}1, respectively) in the sucrose skeleton and glycoside bonds among sucrose molecules. The water concentration affected the diffusion coefficient significantly due to its dependence on the physical structure of the food. (Author) 27 refs.

  20. The shift in windpower

    International Nuclear Information System (INIS)

    Gipe, P.

    1992-01-01

    Despite new production records, the near-term market for new windpower projects in the US remains bleak. Congressional incentives and project proposals in the mid-1990s offer promise, but for now most development has shifted to Europe. During 1992 and 1993 the largest wind projects developed by US companies will not be in the US, but in the United Kingdom and Spain. Indeed, most of the US's windpower industry is going abroad, establishing offices overseas. This move toward Europe comes as little surprise. New project development for US firms has faltered at home while the European market has burgeoned. The topics of the article include the move to Europe, a reduction in California's share of producing wind power plants, a rise in Europe's share of producing wind power plants, the future market for wind power in the US, and reawakening California's market

  1. Amygdala hyperactivity and tonotopic shift after salicylate exposure.

    Science.gov (United States)

    Chen, Guang-Di; Manohar, Senthilvelan; Salvi, Richard

    2012-11-16

    The amygdala, important in forming and storing memories of aversive events, is believed to play a major role in debilitating tinnitus and hyperacusis. To explore this hypothesis, we recorded from the lateral amygdala (LA) and auditory cortex (AC) before and after treating rats with a dose of salicylate that induces tinnitus and hyperacusis-like behavior. Salicylate unexpectedly increased the amplitude of the local field potential (LFP) in the LA making it hyperactive to sounds≥60 dB SPL. Frequency receptive fields (FRFs) of multiunit (MU) clusters in the LA were also dramatically altered by salicylate. Neuronal activity at frequencies below 10 kHz and above 20 kHz was depressed at low intensities, but was greatly enhanced for stimuli between 10 and 20 kHz (frequencies near the pitch of the salicylate-induced tinnitus in the rat). These frequency-dependent changes caused the FRF of many LA neurons to migrate towards 10-20 kHz thereby amplifying activity from this region. To determine if salicylate-induced changes restricted to the LA would remotely affect neural activity in the AC, we used a micropipette to infuse salicylate (20 μl, 2.8 mM) into the amygdala. Local delivery of salicylate to the amygdala significantly increased the amplitude of the LFP recorded in the AC and selectively enhanced the neuronal activity of AC neurons at the mid-frequencies (10-20 kHz), frequencies associated with the tinnitus pitch. Taken together, these results indicate that systemic salicylate treatment can induce hyperactivity and tonotopic shift in the amygdala and infusion of salicylate into the amygdala can profoundly enhance sound-evoked activity in AC, changes likely to increase the perception and emotional salience of tinnitus and loud sounds. This article is part of a Special Issue entitled: Tinnitus Neuroscience. Copyright © 2012 Elsevier B.V. All rights reserved.

  2. Amygdala Hyperactivity and Tonotopic Shift after Salicylate Exposure

    Science.gov (United States)

    Chen, Guang-Di; Manohar, Senthilvelan; Salvi, Richard

    2017-01-01

    The amygdala, important in forming and storing memories of aversive events, is believed to play a major role in debilitating tinnitus and hyperacusis. To explore this hypothesis, we recorded from the lateral amygdala (LA) and auditory cortex (AC) before and after treating rats with a dose of salicylate that induces tinnitus and hyperacusis-like behavior. Salicylate unexpectedly increased the amplitude of the local field potential (LFP) in the LA making it hyperactive to sounds ≥60 dB SPL. Frequency receptive fields (FRF) of multiunit (MU) clusters in the LA were also dramatically altered by salicylate. Neuronal activity at frequencies below 10 kHz and above 20 kHz was depressed at low intensities, but was greatly enhanced for stimuli between 10 and 20 kHz (frequencies near the pitch of the salicylate-induced tinnitus in the rat). These frequency-dependent changes caused the FRF of many LA neurons to migrate towards 10-20 kHz thereby amplifying activity from this region. To determine if salicylate-induced changes restricted to the LA would remotely affect neural activity in the AC, we used a micropipette to infuse salicylate (20 µl, 2.8 mM) into the amygdala. Local delivery of salicylate to the amygdala significantly increased the amplitude of the LFP recorded in the AC and selectively enhanced the neuronal activity of AC neurons at the mid-frequencies (10-20 kHz), frequencies associated with the tinnitus pitch. Taken together, these results indicate that systemic salicylate treatment can induce hyperactivity and tonotopic shift in the amygdala and infusion of salicylate into the amygdala can profoundly enhance sound-evoked activity in AC, changes likely to increase the perception and emotional salience of tinnitus and loud sounds. PMID:22464181

  3. Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

    International Nuclear Information System (INIS)

    Fang Minggang; Nie, Yingchao; Theilmann, David A.

    2009-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

  4. ac conductivity of a one-dimensional site-disordered lattice

    International Nuclear Information System (INIS)

    Albers, R.C.; Gubernatis, J.E.

    1978-01-01

    We report the results of a numerical study of the ac conductivity for the Anderson model of a one-dimensional, site-disordered system of 400 atoms. For different degrees of disorder, we directly diagonalized the Anderson Hamiltonian, used the Kubo-Greenwood formula to evaluate the conductivity, and then averaged the conductivity over 12 configurations. We found that the dominant frequency dependence of the conductivity consisted of a single peak which shifted to higher frequency and decreased in overall magnitude as the disorder was increased. The joint density of states and the eigenstate localization were also computed and are discussed in connection with our results

  5. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  6. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    imply not only a shift in language identity but also in the value system of a particular group. However, here it is ... immigrants, continue to use their EMT in a foreign environment. Although there are no specific sets of ... new land (such as the Norwegians in the United States) with other groups who might not always share their ...

  7. Chemical shift imaging: a review

    International Nuclear Information System (INIS)

    Brateman, L.

    1986-01-01

    Chemical shift is the phenomenon that is seen when an isotope possessing a nuclear magnetic dipole moment resonates at a spectrum of resonance frequencies in a given magnetic field. These resonance frequencies, or chemical shifts, depend on the chemical environments of particular nuclei. Mapping the spatial distribution of nuclei associated with a particular chemical shift (e.g., hydrogen nuclei associated with water molecules or with lipid groups) is called chemical shift imaging. Several techniques of proton chemical shift imaging that have been applied in vivo are presented, and their clinical findings are reported and summarized. Acquiring high-resolution spectra for large numbers of volume elements in two or three dimensions may be prohibitive because of time constraints, but other methods of imaging lipid of water distributions (i.e., selective excitation, selective saturation, or variations in conventional magnetic resonance imaging pulse sequences) can provide chemical shift information. These techniques require less time, but they lack spectral information. Since fat deposition seen by chemical shift imaging may not be demonstrated by conventional magnetic resonance imaging, certain applications of chemical shift imaging, such as in the determination of fatty liver disease, have greater diagnostic utility than conventional magnetic resonance imaging. Furthermore, edge artifacts caused by chemical shift effects can be eliminated by certain selective methods of data acquisition employed in chemical shift imaging

  8. Perceived shift. South Africa.

    Science.gov (United States)

    Coovadia, H

    1998-01-01

    This speech challenges the global community to commit to reducing HIV/AIDS in Durban, South Africa, where 1 in 4 adults is infected with the virus. A commitment of resources and energy would show good faith in fairness, generate unstoppable momentum in the prevention and control of HIV/AIDS, provide a genuine renewal in the war against this disease, and set an example for other low income, resource poor, and HIV-epidemic countries. In 2000, the 13th Annual International AIDS Conference will be suitably located in Durban in a region with the highest rates of HIV/AIDS. The 1998 UNAIDS report states that 70% of those infected with HIV (21 million) are in Africa. A shift in program effort and political will would mark a turning point in the war against AIDS. There are four "P's" behind prevention and control of the HIV/AIDS epidemic: politicians, people, private sector, and programs. It is suggested that next year's conference should include political will that will become unshakable. Budgets need to be realistic. People should have unquestionable tolerance, acceptance, and generosity. Community organizations should be strengthened. Discrimination should be stopped. Science needs to be advanced. The private sector's involvement should be meaningful and supportive. Programs should be appropriate, affordable, and accessible. Many gaps need to be bridged and many people need to enlist their aid. The author urges that conference participants remember the afflicted poor and plan for a rebirth and renewal of hope.

  9. Role of quantum-confined stark effect on bias dependent photoluminescence of N-polar GaN/InGaN multi-quantum disk amber light emitting diodes

    Science.gov (United States)

    Tangi, Malleswararao; Mishra, Pawan; Janjua, Bilal; Prabaswara, Aditya; Zhao, Chao; Priante, Davide; Min, Jung-Wook; Ng, Tien Khee; Ooi, Boon S.

    2018-03-01

    We study the impact of quantum-confined stark effect (QCSE) on bias dependent micro-photoluminescence emission of the quantum disk (Q-disk) based nanowires light emitting diodes (NWs-LED) exhibiting the amber colored emission. The NWs are found to be nitrogen polar (N-polar) verified using KOH wet chemical etching and valence band spectrum analysis of high-resolution X-ray photoelectron spectroscopy. The crystal structure and quality of the NWs were investigated by high-angle annular dark field - scanning transmission electron microscopy. The LEDs were fabricated to acquire the bias dependent micro-photoluminescence spectra. We observe a redshift and a blueshift of the μPL peak in the forward and reverse bias conditions, respectively, with reference to zero bias, which is in contrast to the metal-polar InGaN well-based LEDs in the literature. Such opposite shifts of μPL peak emission observed for N-polar NWs-LEDs, in our study, are due to the change in the direction of the internal piezoelectric field. The quenching of PL intensity, under the reverse bias conditions, is ascribed to the reduction of electron-hole overlap. Furthermore, the blueshift of μPL emission with increasing excitation power reveals the suppression of QCSE resulting from the photo-generated carriers. Thereby, our study confirms the presence of QCSE for NWs-LEDs from both bias and power dependent μPL measurements. Thus, this study serves to understand the QCSE in N-polar InGaN Q-disk NWs-LEDs and other related wide-bandgap nitride nanowires, in general.

  10. Role of quantum-confined stark effect on bias dependent photoluminescence of N-polar GaN/InGaN multi-quantum disk amber light emitting diodes

    KAUST Repository

    Tangi, Malleswararao

    2018-03-09

    We study the impact of quantum-confined stark effect (QCSE) on bias dependent micro-photoluminescence emission of the quantum disk (Q-disk) based nanowires light emitting diodes (NWs-LED) exhibiting the amber colored emission. The NWs are found to be nitrogen polar (N-polar) verified using KOH wet chemical etching and valence band spectrum analysis of high-resolution X-ray photoelectron spectroscopy. The crystal structure and quality of the NWs were investigated by high-angle annular dark field - scanning transmission electron microscopy. The LEDs were fabricated to acquire the bias dependent micro-photoluminescence spectra. We observe a redshift and a blueshift of the μPL peak in the forward and reverse bias conditions, respectively, with reference to zero bias, which is in contrast to the metal-polar InGaN well-based LEDs in the literature. Such opposite shifts of μPL peak emission observed for N-polar NWs-LEDs, in our study, are due to the change in the direction of the internal piezoelectric field. The quenching of PL intensity, under the reverse bias conditions, is ascribed to the reduction of electron-hole overlap. Furthermore, the blueshift of μPL emission with increasing excitation power reveals the suppression of QCSE resulting from the photo-generated carriers. Thereby, our study confirms the presence of QCSE for NWs-LEDs from both bias and power dependent μPL measurements. Thus, this study serves to understand the QCSE in N-polar InGaN Q-disk NWs-LEDs and other related wide-bandgap nitride nanowires, in general.

  11. A.c. susceptibility measurements in the presence of d.c. magnetic fields for Nd-Ba-Cu-O superconductors

    International Nuclear Information System (INIS)

    Watahiki, M.; Murakami, M.; Yoo, S.I.

    1997-01-01

    We report the temperature and magnetic field dependence of the complex a.c. susceptibility with bias d.c. magnetic fields for melt-processed Nd-Ba-Cu-O superconductor. The onset temperature (T onset ) of the real part of a.c. susceptibility shifted to a lower temperature with increasing d.c. magnetic field. The superconducting transition temperature (T c ) determined by d.c. magnetization measurements did not shift appreciably to a lower-temperature region with increasing d.c. magnetic field. The distinction between T onset and T c indicates that the a.c. susceptibility measurements detect the energy dissipation generated by the motion of flux lines. We have also measured flux profiles and found that there was no appreciable change in flux penetration below and above the peak field, which suggests that the peak effect in Nd-Ba-Cu-O is not due to the phase transition in the flux line lattice. (author)

  12. Fuzzy efficiency optimization of AC induction motors

    Science.gov (United States)

    Jani, Yashvant; Sousa, Gilberto; Turner, Wayne; Spiegel, Ron; Chappell, Jeff

    1993-01-01

    This paper describes the early states of work to implement a fuzzy logic controller to optimize the efficiency of AC induction motor/adjustable speed drive (ASD) systems running at less than optimal speed and torque conditions. In this paper, the process by which the membership functions of the controller were tuned is discussed and a controller which operates on frequency as well as voltage is proposed. The membership functions for this dual-variable controller are sketched. Additional topics include an approach for fuzzy logic to motor current control which can be used with vector-controlled drives. Incorporation of a fuzzy controller as an application-specific integrated circuit (ASIC) microchip is planned.

  13. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    ) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...... impact are analysed with regard to their visual impact reducing design steps. These are used to form the basis for overhead line system design ideas, which are analysed with regard to application of composite materials and components. Composite materials and components, when applied in EHV systems...

  14. Calibration free method for measurement of the AC magnetization loss

    Energy Technology Data Exchange (ETDEWEB)

    Souc, Jan [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Goemoery, Fedor [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Vojenciak, Michal [Department of Power Electrical Systems, University of Zilina, Vel' ky diel, 010 26 Zilina (Slovakia)

    2005-05-01

    A calibration free measurement method for determination of the magnetization loss of superconducting samples exposed to the external AC magnetic field is presented. The idea is based on the measurement of the part of the power which is supplied by the AC source to the AC magnet generating the magnetic field, in which the sample is located. It uses a coil wound in parallel to the AC field magnet as the measurement coil. To achieve the necessary sensitivity, two identical systems are used, each consisting of an AC magnet and a measurement coil, one of them containing the sample and the other left empty. No measurement and/or calculation of the calibration constant is required. To confirm the suitability of this method, the loss of a Cu sample with known dissipation was measured. The applicability to the AC magnetization loss measurements of superconducting tapes is presented.

  15. Quantized beam shifts in graphene

    Energy Technology Data Exchange (ETDEWEB)

    de Melo Kort-Kamp, Wilton Junior [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Sinitsyn, Nikolai [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Dalvit, Diego Alejandro Roberto [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-10-08

    We predict the existence of quantized Imbert-Fedorov, Goos-Hanchen, and photonic spin Hall shifts for light beams impinging on a graphene-on-substrate system in an external magnetic field. In the quantum Hall regime the Imbert-Fedorov and photonic spin Hall shifts are quantized in integer multiples of the fine structure constant α, while the Goos-Hanchen ones in multiples of α2. We investigate the influence on these shifts of magnetic field, temperature, and material dispersion and dissipation. An experimental demonstration of quantized beam shifts could be achieved at terahertz frequencies for moderate values of the magnetic field.

  16. Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

    Directory of Open Access Journals (Sweden)

    Evi Ploumpidou

    2017-12-01

    Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

  17. Control of high-frequency AC link electronic transformer

    OpenAIRE

    Krishnaswami, H; Ramanarayanan, V

    2005-01-01

    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  18. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  19. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  20. Vortex-antivortex dynamics in mesoscopic symmetric and asymmetric superconducting loops with an applied ac current

    Science.gov (United States)

    Zha, Guo-Qiao; Peeters, F. M.; Zhou, Shi-Ping

    2014-12-01

    In the framework of the time-dependent Ginzburg-Landau formalism, we study the dynamics of vortex-antivortex (V-Av) pairs in mesoscopic symmetric and asymmetric superconducting loops under an applied ac current. In contrast to the case of a constant biasing dc current, the process of the V-Av collision and annihilation is strongly affected by the time-periodic ac signal. As the direction of the applied ac current is reversed, the existed V-Av pair moves backward and then collides with a new created Av-V pair in a symmetric loop. In the presence of an appropriate external magnetic field, a novel sinusoidal-like oscillatory mode of the magnetization curve is observed, and the periodic dynamical process of the V-Av annihilation occurs in both branches of the sample. Moreover, for the asymmetric sample with an off-centered hole the creation point of the V-Av pair shifts away from the center of the sample, and the creation and annihilation dynamics of V-Av pairs turns out to be very different from the symmetric case.

  1. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  2. Work shifts in Emergency Medicine

    Directory of Open Access Journals (Sweden)

    Roberto Recupero

    2007-06-01

    Full Text Available Emergency Medicine is known as a high stress specialty. The adverse effect of constantly rotating shifts is the single most important reason given for premature attrition from the field. In this work problems tied with night shift work will be taken into account and some solutions to reduce the impact of night work on the emergency physicians will be proposed.

  3. A modelling of AC voltage stabilizer based on a hybrid transformer with matrix converter

    Directory of Open Access Journals (Sweden)

    Szcześniak Paweł

    2017-06-01

    Full Text Available This article presents a study of an AC voltage stabilizer based on a three-phase hybrid transformer combined with a matrix converter. The proposed solution is used to control AC voltage amplitude and phase shift. By adjustment of these voltage parameters we can reduce the effects of overvoltage, voltage dips or lamp flicker. Such negative phenomena are very significant, particularly from the perspective of the final consumer and sensitive loads connected to the power network. Often the voltage in the power system can be adjusted using a mechanical or thyristor controlled regulator, which in a stepwise manner switches the taps of the electromagnetic transformer. The method for obtaining continuous control of the voltage magnitude and phase shift with the use of a conventional transformer with two output windings and a matrix converter is presented in this paper. The operating principles, mathematical model and properties of the proposed voltage stabilizers are discussed in this paper. The main part of the article will be devoted to the mathematical model which is based on an averaged equation. Computer simulation results are presented and compared with the results of a mathematical study.

  4. Polaron effects on the dc- and ac-tunneling characteristics of molecular Josephson junctions

    Science.gov (United States)

    Wu, B. H.; Cao, J. C.; Timm, C.

    2012-07-01

    We study the interplay of polaronic effect and superconductivity in transport through molecular Josephson junctions. The tunneling rates of electrons are dominated by vibronic replicas of the superconducting gap, which show up as prominent features in the differential conductance for the dc and ac current. For relatively large molecule-lead coupling, a features that appears when the Josephson frequency matches the vibron frequency can be identified with an over-the-gap structure observed by Marchenkov [Nat. Nanotech. 1748-338710.1038/nnano.2007.2182, 481 (2007)]. However, we are more concerned with the weak-coupling limit, where resonant tunneling through the molecular level dominates. We find that certain features involving both Andreev reflection and vibron emission show an unusual shift of the bias voltage V at their maximum with the gate voltage Vg as V˜(2/3)Vg. Moreover, due to the polaronic effect, the ac Josephson current shows a phase shift of π when the bias eV is increased by one vibronic energy quantum ℏωv. This distinctive even-odd effect is explained in terms of the different sign of the coupling to vibrons of electrons and of Andreev-reflected holes.

  5. Metabolic impact of shift work.

    Science.gov (United States)

    Zimberg, Ioná Zalcman; Fernandes Junior, Silvio A; Crispim, Cibele Aparecida; Tufik, Sergio; de Mello, Marco Tulio

    2012-01-01

    In developing countries, shift work represents a considerable contingent workforce. Recently, studies have shown that overweight and obesity are more prevalent in shift workers than day workers. In addition, shift work has been associated with a higher propensity for the development of many metabolic disorders, such as insulin resistance, diabetes, dislipidemias and metabolic syndrome. Recent data have pointed that decrease of the sleep time, desynchronization of circadian rhythm and alteration of environmental aspects are the main factors related to such problems. Shortened or disturbed sleep is among the most common health-related effects of shift work. The plausible physiological and biological mechanisms are related to the activation of the autonomic nervous system, inflammation, changes in lipid and glucose metabolism, and related changes in the risk for atherosclerosis, metabolic syndrome, and type II diabetes. The present review will discuss the impact of shift work on obesity and metabolic disorders and how disruption of sleep and circadian misalignment may contribute to these metabolic dysfunctions.

  6. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  7. Muc5ac mucin expression during rat skin development

    Directory of Open Access Journals (Sweden)

    V. Ferretti

    2015-02-01

    Full Text Available Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC, Western blotting (WB and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days after birth when the surface epidermis became negative and the reaction was restricted to secreting sebum cells. In coincidence with IHC findings, WB analysis showed a band at approximately 200KDa at the same periods of development. Results were also confirmed by RT-PCR. Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development.Conclusion:  Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development. 

  8. Muc5ac mucin expression during rat skin development.

    Science.gov (United States)

    Ferretti, V; Segal-Eiras, Á; Barbeito, C G; Croce, M V

    2015-02-20

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days after birth when the surface epidermis became negative and the reaction was restricted to secreting sebum cells. In coincidence with IHC findings, WB analysis showed a band at approximately 200KDa at the same periods of development. Results were also confirmed by RT-PCR. Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development.   Muc5ac expression in rat embryonic epidermis suggests that Muc5ac may play a protective role in embryonic skin previous to birth which may be replaced by pile covering. To our knowledge, this is the first report which confirmed Muc5ac expression during skin development.

  9. Low ac loss geometries in YBCO coated conductors

    International Nuclear Information System (INIS)

    Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

  10. Low ac loss geometries in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

    2007-10-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

  11. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  12. AC Electrowetting of Polymer Aqueous Drops on Parallel Electrodes

    Science.gov (United States)

    Zhang, Lu; Chetwani, Nishant; Chang, Hsueh-Chia; Zhu, Yingxi Elaine

    2009-03-01

    We have recently observed the strong field dependence of AC-electrowetting of simple electrolyte aqueous drops on parallel gold electrodes, yet the detailed dynamic process of AC-field induced surface wetting remains unclear. In this work, we use fluorescence labeled DNA aqueous solution as a model system to directly visualize the wetting process of aqueous drops under varied AC electric fields by using combined fluorescence microscopy and contact angle goniometer. The electrowetting behavior of DNA aqueous drops is observed at AC-field frequency greater than the reciprocal of the RC time scale for electrode screening. And the onset of AC electrowetting is accompanied by the observed oscillation in drop contour shape and contact line. In addition, the ejection of nanodrops from the parent aqueous drop is observed when the threshold AC-field amplitude is exceeded. A scaling theory based on electrode interfacial screening is developed to quantify the AC-electrowetting behavior with the dependence of AC-field frequency, strength and medium conductivity.

  13. Low frequency ac conduction and dielectric relaxation in poly (N ...

    Indian Academy of Sciences (India)

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

  14. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...

  15. Wannier–Stark electro-optical effect, quasi-guided and photonic modes in 2D macroporous silicon structures with SiO{sub 2} coatings

    Energy Technology Data Exchange (ETDEWEB)

    Karachevtseva, L., E-mail: lakar@isp.kiev.ua [Ningbo University of Technology, No. 55-155 Cui Bai Road, Ningbo 315016 (China); V. Lashkaryov Institute of Semiconductor Physics NAS of Ukraine, 41 Nauky Pr., 03028 Kyiv (Ukraine); Goltviansky, Yu., E-mail: ecoflam@voliacable.com [V. Lashkaryov Institute of Semiconductor Physics NAS of Ukraine, 41 Nauky Pr., 03028 Kyiv (Ukraine); Sapelnikova, O., E-mail: e_kolesnik84@mail.ru [V. Lashkaryov Institute of Semiconductor Physics NAS of Ukraine, 41 Nauky Pr., 03028 Kyiv (Ukraine); Lytvynenko, O., E-mail: lytvole@gmail.com [V. Lashkaryov Institute of Semiconductor Physics NAS of Ukraine, 41 Nauky Pr., 03028 Kyiv (Ukraine); Stronska, O., E-mail: yaschichek@ukr.net [V. Lashkaryov Institute of Semiconductor Physics NAS of Ukraine, 41 Nauky Pr., 03028 Kyiv (Ukraine); Bo, Wang, E-mail: bo305@hotmail.com [Ningbo University of Technology, No. 55-155 Cui Bai Road, Ningbo 315016 (China); Kartel, M., E-mail: nikar@kartel.kiev.ua [Ningbo University of Technology, No. 55-155 Cui Bai Road, Ningbo 315016 (China)

    2016-12-01

    Highlights: • The IR absorption spectra of oxidized macroporous silicon were studied. • The Wannier–Stark electro-optical effect on Si-SiO{sub 2} boundary was confirmed. • An additional electric field of quasi-guided optical modes was evaluated. • The photonic modes and band gaps were measured as peculiarities in absorption spectra. - Abstract: Opportunities to enhance the properties of structured surfaces were demonstrated on 2D macroporous silicon structures with SiO{sub 2} coatings. We investigated the IR light absorption oscillations in macroporous silicon structures with SiO2 coatings 0–800 nm thick. The Wannier–Stark electro-optical effect due to strong electric field on Si-SiO{sub 2}boundary and an additional electric field of quasi-guided optical modes were taken into account. The photonic modes and band gaps were also considered as peculiarities in absorbance spectra of macroporous silicon structures with a thick SiO{sub 2} coating. The photonic modes do not coincide with the quasi-guided modes in the silicon matrix and do not appear in absorption spectra of 2D macroporous silicon structures with surface nanocrystals.

  16. Cosmic Shear With ACS Pure Parallels

    Science.gov (United States)

    Rhodes, Jason

    2002-07-01

    Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan textiti {F775W} we will measure for the first time: beginlistosetlength sep0cm setlengthemsep0cm setlengthopsep0cm em the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

  17. Ac and dc motor flooding times

    International Nuclear Information System (INIS)

    Crowley, D.A.; Hinton, J.H.

    1988-01-01

    Reactor safety studies, such as the emergency cooling system (ECS) limits analyses and the probabilistic risk assessment, require that the flood-out times be calculated for the ac and dc motors at the -40 foot level. New calculations are needed because dams of an improved design have been installed between the pump room and motor room, and because updated leak rate calculations have shown that the maximum possible leak rate is larger than that which had been previously calculated. The methodology for calculating the motor flood-out times has also been improved. A computer program has been written to calculate flood-out times for various leak rates and sump pump operabilities. For ECS limits analyses, the worst case dc motor flood-out times are 161 and 297 seconds in LKC and P-areas, respectively. These times are for a 135,468 gpm leak that first flows to the motor room and all of the sump pumps are off

  18. Improving Power Quality in AC Supply Grids

    Directory of Open Access Journals (Sweden)

    Piotr Fabijański

    2015-12-01

    Full Text Available This paper describes a digital and actual model of the UPQC (Unified Power Quality Conditioner integrated system for power quality improvement. The UPQC’s design and its connection to an AC supply grid, 1-phase and 3-phase alike, provide effective compensation of unwanted interferences in the waveforms of load supply voltages and non-linear load currents. This article presents an overview of topologies and control strategies. The study of the UPQC confirmed its positive impact on the power quality. The electricity parameters were significantly improved. Total harmonic distortion in supply voltage THDu decreased six-fold to 1.89%, and total harmonic distortion in load current THDi decreased more than ten-fold to 2.38% for a non-linear load (uncontrolled bridge rectifier with load L. Additionally, symmetrisation of supply voltages and reactive power compensation Q of linear load was obtained. The UPQC integrated system for power quality improvement can be used wherever high-quality and PN-EN 50160 standard – compliant electricity is required.

  19. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  20. The use of low frequency AC for offshore wind power

    Energy Technology Data Exchange (ETDEWEB)

    Schuette, T.; Stroem, M.; Gustavsson, Bo [Balfour Beatty Rail AB, Vaesteraas (Sweden)

    2001-07-01

    Low frequency AC, that means AC with a frequency well below the usual frequencies 50 or 60 Hz, has today its main use in single phase AC electrified railways in a number of European countries (16 2/3 Hz), USA (25 Hz) and Costa Rica (20 Hz). Offshore wind power is well suited to 'join the club' as low frequency AC has a number of advantages for that use: Low frequency AC better fits the low revolution frequency of wind power rotors. This can either be used for reduction of pole number for direct generation machines or for a reduction of the gear ratio for conventional machines, resulting in simpler, lighter and more reliable gearboxes. Low frequency AC gives rise to lower charging current/reactive power production, which restricts the maximum cable length for 50 - 60 Hz heavily due to the high specific capacitance of power cables. For low frequency AC, cables longer than 100 km are possible, which is necessary for many future offshore wind power sites. Low frequency AC enables for the use of (air insulated) transmission lines at loads well above their characteristic power, often up to their thermal maximum load. This means that weak 50 or 60 Hz lines between the shore and consumers or stronger parts of a national grid can transfer more power when operated with low frequency AC. On all aspects of low frequency AC, profound knowledge has been accumulated the last century in the railway sector and can be made available for wind power.

  1. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...

  2. AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

    International Nuclear Information System (INIS)

    McCarthy, Christina B.; Theilmann, David A.

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

  3. Explaining (Missing) Regulator Paradigm Shifts

    DEFF Research Database (Denmark)

    Wigger, Angela; Buch-Hansen, Hubert

    2014-01-01

    The global financial and economic crisis has prompted some scholars to suggest that a fundamental regulatory shift away from neoliberalism will take place – both in general and in the field of EU competition regulation. This paper shows that so far no radical break with the neoliberal type...... of competition regulation is heaving into sight. It sets out to explain this from the vantage point of a critical political economy perspective, which identifies the circumstances under which a crisis can result in a regulatory paradigm shift. Contrasting the current situation with the shift in EC/EU competition...... regulation after the crisis in the 1970s, the paper argues that the preconditions for a fundamental shift in this issue area are not present this time around. Several reasons account for this: the current crisis has been construed by economic and political elites as a crisis within and not of neoliberal...

  4. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the grids......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...

  5. Dry-season retreat and dietary shift of the dart-poison frog Dendrobates tinctorius (Anura: Dendrobatidae)

    NARCIS (Netherlands)

    Born, M.; Bongers, F.; Poelman, E.H.; Sterck, F.J.

    2010-01-01

    Dry-season retreat and dietary shift of the dart-poison frog Delldrobates tillCtOrillS (Anura: Dendrobatidae). Seasonal rainfall affects tropical forest dynamics and behavior of species that are part of these ecosystems. TIle positive correlation between amphibian ac tivity pattems and rainfall has

  6. Electron transport through ac driven graphene p-n junctions

    Science.gov (United States)

    Zhang, Zhi-Qiang; Kang, Yan-Zhuo; Ding, Kai-He

    2018-02-01

    We study the electronic transport through ac driven graphene p-n junctions under a perpendicular magnetic field. It is found that subject to the transversely or longitudinally polarized ac field, in the p-n region, the conductance versus the on-site energy of the right electrode exhibits a characteristic structure with a zero value plateau and the followed oscillation peaks, whose widths are greatly suppressed by the ac field. In the n-n region, the conductance plateaus at G = (n + 1 / 2) (4e2 / h) (n is an integer) shrink for the transversely polarized ac field, whereas accompanied with the addition of the new quantized plateaus at G = n (4e2 / h) for the longitudinally polarized ac field. The combined influence of the ac field with the disorder can trigger a change in the mixing of the hole and electron states at the p-n interface, which leads to a destruction of the plateaus structure in the conductance versus the disorder strength with the emergence of new ones. The influence of the elliptically and circularly polarized ac field on the conductance is also shown.

  7. AC loss characteristics of CORC® cable with a Cu former

    Science.gov (United States)

    Terzioğlu, R.; Vojenčiak, M.; Sheng, J.; Gömöry, F.; Çavuş, T. F.; Belenli, İ.

    2017-08-01

    High-temperature superconductors from the REBCO (RE = rare earth) family have attained industrial production and their performance is continuously being enhanced. However, cabling technology for high-current (kA range) cables for magnet technology is still challenging and there are only few cable concepts available (CORC®, Roebel cable, twisted stack cable). Each of them exhibits different characteristics. In this paper we experimentally investigate CORC® cable produced in-house utilizing a copper tube former. Such a former offers a central cooling channel for partial or complete cable cooling by forced flow of coolant. We focus mainly on AC loss due to transporting AC current, an external applied AC magnetic field and their simultaneous action. In the case of transporting AC current we found indications that a large part of the total loss has its origin in eddy currents due to an axial magnetic field. For the investigation of magnetization AC loss, we prepared several samples with different configurations. In this case we found direct evidence for increasing AC loss due to losses in the metallic former. However, we also found that at low field amplitudes the magnetization AC loss of the complete cable is lower than the loss in the bare former. This is caused by shielding of the magnetic field by a superconductor, which was also confirmed by numerical simulations.

  8. Energy Approach to Nuclei and Atoms in a Strong Laser Field: Stark Effect and Multi-photon Resonances

    International Nuclear Information System (INIS)

    Glushkov, A. V.; Khetselius, O. Yu.; Svinarenko, A. A.; Lovett, L.

    2010-01-01

    A consistent energy approach to nuclei and atoms in a strong electromagnetic (laser) field is presented. The photon emission and absorption lines are described by the moments of different orders, which are calculated with the use of the Gell-Mann and Low S-matrix adiabatic formalism. In relativistic version the Gell-Mann and Low formulae expresses an imaginary part of the energy shift ImE through the scattering matrix, including interaction of quantum system as with laser field as with a field of photon vacuum.

  9. dc Arc Fault Effect on Hybrid ac/dc Microgrid

    Science.gov (United States)

    Fatima, Zahra

    The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

  10. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  11. Study on radioimmunoassay of Bt Cry1Ac protein

    International Nuclear Information System (INIS)

    Pan Jiarong; Zhang Wei; Lin Min; Zhang Jie; Qiao Yanhong

    2006-01-01

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125 I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  12. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  13. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2015-01-01

    Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...

  14. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2014-01-01

    Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...

  15. Motion Control and Implementation for an AC Servomotor System

    Directory of Open Access Journals (Sweden)

    L. Canan Dülger

    2007-01-01

    Full Text Available This paper presents a study on trajectory tracking problem for an AC synchronous servomotor. A mathematical model for the system including AC synchronous servomotor, gearbox, and a load is developed to examine the systems dynamic behavior. The system is controlled by a traditional PID (proportional + integral + derivative controller. The required values for the controller settings are found experimentally. Different motion profiles are designed, and trapezoidal ones are implemented. Thus, the experimental validation of the model is achieved using the experimental setup. The simulation and experimental results are presented. The tracking performance of an AC servomotor system is illustrated with proposed PID controller.

  16. SAT in shift manager training

    International Nuclear Information System (INIS)

    Lecuyer, F.

    1995-01-01

    EDF has improved the organization of the operation shift teams with the replacement of shift supervisor in shift manager function. The shift manager is not only responsible for tasks associated to plant operation (production), but he is also responsible for safety of these tasks and for management of shift team members. A job analysis of this new job position has been performed in order to design the training programme. It resulted in a 10-month training programme that includes 8 weeks in safety-related topics and 12 weeks in soft-skills related topics. The safety related training courses are mandatory, the other courses are optional courses depending on individual trainee needs. The training also includes the development of management competencies. During the 10 month period, each trainee develops an individual project that is evaluated by NPP manager. As well, as group project is undertaken by the trainees and overseen by a steering committee. The steering committee participates in the evaluation process and provides operational experience feedback to the trainee groups and to the overall programme

  17. AC impedance technique in PEM fuel cell diagnosis - A review

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, Xiaozi; Wang, Haijiang; Colin Sun, Jian; Zhang, Jiujun [Institute for Fuel Cell Innovation, National Research Council (Canada)

    2007-12-15

    Because the AC impedance technique, also known as electrochemical impedance spectroscopy (EIS), is being utilized by more and more researchers in proton exchange membrane (PEM) fuel cell studies, the technique has developed into a primary tool in such research. In this paper the recent work on PEM fuel cells using the AC impedance technique is reviewed. Both in situ and ex situ impedance measurements are discussed, with primary focus on the in situ measurements. Within the domain of in situ studies, various methods for measuring the impedance of a PEM fuel cell are examined, and typical impedance spectra in several common scenarios are presented. Representative applications of the AC impedance technique in PEM fuel cell research are also discussed. Finally, the necessity of a time domain rapid AC impedance technique is briefly discussed. (author)

  18. Detection of Genetic Modification 'ac2' in Potato Foodstuffs

    Directory of Open Access Journals (Sweden)

    Petr Kralik

    2009-01-01

    Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

  19. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  20. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  1. Determination of {sup 227}Ac by {alpha}-particle spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Martin, P. [Environmental Research Inst. of the Supervising Scientist, Jabiru, NT (Australia); Hancock, G.J. [Commonwealth Scientific and Industrial Research Organization, Canberra, ACT (Australia). Div. of Water Resources; Paulka, S. [Australian Radiation Lab., Yallambie, VIC (Australia); Akber, R.A. [Queensland Univ. of Technology, Brisbane, QLD (Australia)

    1995-10-01

    A method is described for the determination of {sup 227}Ac concentration in environmental samples. Actinium is separated from the sample digest by co-precipitation with lead sulphate, purified using anion and cation exchange techniques, and electrodeposited onto a stainless-steel disc. The chemical yield is monitored by addition of a {sup 229}Th/{sup 225}Ra/{sup 225}Ac tracer before sample dissolution. {sup 225}Ac recovery is determined from an initial count by measurement of its {alpha}-emitting daughter, {sup 217}At. The disc is then stored for 2-3 months and recounted. The {sup 227}Ac activity is obtained by measurement of the ingrown {sup 227}Th and {sup 223}Ra activities in the 5.38-6.10 MeV region. Co-precipitation with lead sulphate enables the convenient determination of actinium, thorium and radium on the same sample digest. (author).

  2. Initial tests of an AC dipole for the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; /Texas U.; Jansson, A.; /Fermilab; Kopp, S.; /Texas U.; Syphers, M.; /Fermilab

    2006-06-01

    The AC dipole is a device to diagnose transverse motions of a beam. It can achieve large-amplitude oscillations without two inevitable problems of conventional kicker/pinger magnets: decoherence and emittance growth. While not the first synchrotron to operate with an AC dipole, the Tevatron can now make use of its recently upgraded BPM system, providing unprecedented resolution for use with an AC dipole, to measure both linear and nonlinear properties of the accelerator. Plans are to provide AC dipole systems for both transverse degrees of freedom. Preliminary tests have been done using an audio power amplifier with an existing vertical pinger magnet, producing oscillation amplitudes up to 2{sigma} at 150 GeV. In this paper, we will present the configuration of this system. We also show the analysis of a first few data sets, including the direct measurement of beta functions at BPM locations.

  3. National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit

    Science.gov (United States)

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...

  4. High-Frequency ac Power-Distribution System

    Science.gov (United States)

    Hansen, Irving G.; Mildice, James

    1987-01-01

    Loads managed automatically under cycle-by-cycle control. 440-V rms, 20-kHz ac power system developed. System flexible, versatile, and "transparent" to user equipment, while maintaining high efficiency and low weight. Electrical source, from dc to 2,200-Hz ac converted to 440-V rms, 20-kHz, single-phase ac. Power distributed through low-inductance cables. Output power either dc or variable ac. Energy transferred per cycle reduced by factor of 50. Number of parts reduced by factor of about 5 and power loss reduced by two-thirds. Factors result in increased reliability and reduced costs. Used in any power-distribution system requiring high efficiency, high reliability, low weight, and flexibility to handle variety of sources and loads.

  5. Determining Attributes Contributing to Success in Army Civil Schooling (ACS)

    National Research Council Canada - National Science Library

    Ottinger, Maurice A

    2006-01-01

    ...) in the Army and Defense Comptrollership Program Classes of 1998-2005 at Syracuse University which represent a specialized aspect of ACS where participants follow substantially the same program and earn the same degrees...

  6. Extension to AC Loss Minimisation in High Temperature Superconductors

    National Research Council Canada - National Science Library

    Campbell, Archie

    2004-01-01

    ...: (a) Measure the AC losses of appropriate Yttrium Barium Copper Oxide (YBCO) samples with strong potential for minimizing losses at high frequencies and magnetic fields with the existing equipment. (b...

  7. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto

    2014-01-01

    Analytical methods of cable performance in EHV AC electrical power are discussed in this comprehensive reference. Descriptions of energization, power quality, cable safety constraints and more, guide readers in cable planning and power network operations.

  8. Impact of water content and temperature on the degradation of Cry1Ac protein in leaves and buds of Bt cotton in the soil.

    Science.gov (United States)

    Zhang, Mei-jun; Feng, Mei-chen; Xiao, Lu-jie; Song, Xiao-yan; Yang, Wu-de; Ding, Guang-wei

    2015-01-01

    Determining the influence of soil environmental factors on degradation of Cry1Ac protein from Bt cotton residues is vital for assessing the ecological risks of this commercialized transgenic crop. In this study, the degradation of Cry1Ac protein in leaves and in buds of Bt cotton in soil was evaluated under different soil water content and temperature settings in the laboratory. An exponential model and a shift-log model were used to fit the degradation dynamics of Cry1Ac protein and estimate the DT50 and DT90 values. The results showed that Cry1Ac protein in the leaves and buds underwent rapid degradation in the early stage (before day 48), followed by a slow decline in the later stage under different soil water content and temperature. Cry1Ac protein degraded the most rapidly in the early stage at 35°C with 70% soil water holding capacity. The DT50 values were 12.29 d and 10.17 d and the DT90 values were 41.06 d and 33.96 d in the leaves and buds, respectively. Our findings indicated that the soil temperature was a major factor influencing the degradation of Cry1Ac protein from Bt cotton residues. Additionally, the relative higher temperature (25°C and 35°C) was found to be more conducive to degradation of Cry1Ac protein in the soil and the greater water content (100%WHC) retarded the process. These findings suggested that under appropriate soil temperature and water content, Cry1Ac protein from Bt cotton residues will not persist and accumulate in soil.

  9. Enhanced AC conductivity and dielectric relaxation properties of polypyrrole nanoparticles irradiated with Ni12+ swift heavy ions

    International Nuclear Information System (INIS)

    Hazarika, J.; Kumar, A.

    2014-01-01

    In this paper, we report the 160 MeV Ni 12+ swift heavy ions (SHIs) irradiation effects on AC conductivity and dielectric relaxation properties of polypyrrole (PPy) nanoparticles in the frequency range of 42 Hz–5 MHz. Four ion fluences of 5 × 10 10 , 1 × 10 11 , 5 × 10 11 and 1 × 10 12 ions/cm 2 have been used for the irradiation purpose. Transport properties in the pristine and irradiated PPy nanoparticles have been investigated with permittivity and modulus formalisms to study the polarization effects and conductivity relaxation. With increasing ion fluence, the relaxation peak in imaginary modulus (M ″ ) plots shifts toward high frequency suggesting long range motion of the charge carriers. The AC conductivity studies suggest correlated barrier hopping as the dominant transport mechanism. The hopping distance (R ω ) of the charge carriers decreases with increasing the ion fluence. Binding energy (W m ) calculations depict that polarons are the dominant charge carriers

  10. Muc5ac Mucin Expression During Rat Skin Development

    OpenAIRE

    Ferretti, V.; Segal-Eiras, A.; Barbeito, C.G.; Croce, M.V.

    2015-01-01

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  11. Comparison of costs and benefits for dc and ac transmission

    Energy Technology Data Exchange (ETDEWEB)

    Stovall, J.P.; Bowles, J.P.; Diemond, C.C.; Eaton, R.A.; Gnadt, P.A.; Heyer, S.V.; Lasseter, R.H.; Lebow, M.A.; Long W.F.; McIver, J.C.

    1987-02-01

    The purpose of the study reported here was to examine generic cost differences between direct current (dc) and alternating current (ac) systems and to identify situations in which dc is clearly advantageous for long distance and bulk power transport. The study was also designed to determine the value of the dc technology when applied to transmission systems. This report presents cost comparisons between ac and dc substations and transmission lines as a function of capacity and voltage. It also presents a comparison of dc versus ac for increasing the capacity of existing corridors. Direct-current link operating stategies for enhancing the performance of the associated ac network are illustrated. Possible opportunities for simplification and cost reduction of dc converter stations are described. Both current and expected future enhancements for ac system operation are also identified to assist in making comparisons between equivalent systems. Information is presented to enable comparisons sufficiently detailed to determine ''cost break-even distance,'' which is the transmission length at which the savings in dc line costs (compared to ac) equals the additional costs of the dc converter stations (compared to ac substations). However, it is emphasized that proper use of the concept requires the inclusion of all costs of implementation of those attributes available in the two technologies which are of sufficient value to the power system to be included in determining equivalent systems. The report attempts to bring together useful cost and performance information on ac and dc power transmission for the use of electric utility system in achieving economic and reliable power system designs when considering system additions, expansions, or modifications.

  12. Response of Magnetic Force Microscopy Probes under AC Magnetic Field

    Science.gov (United States)

    Sungthong, A.; Ruksasakchai, P.; Saengkaew, K.; Cheowanish, I.; Damrongsak, B.

    2017-09-01

    In this paper, magnetic force microscopy (MFM) probes with different coating materials were characterized under AC magnetic field. A perpendicular magnetic write head similar to those used in hard disk drives was employed as the AC magnetic field generator. In order to measure a response of MFM probes to AC magnetic field, a MFM probe under test was scanned, at a scan height of 10 nm, across the surface of the magnetic write head. During MFM imaging, the write head was biased by a sufficient magnitude of AC current, approximately 30 mA. A spectral analysis for a frequency sweep from 1 kHz to 100 MHz was extracted from post-processing MFM images. As expected, a MFM probe coated with hard magnetic alloys, i.e. FePt, has the lowest response to AC magnetic fields. MFM probes coated with soft magnetic alloys, i.e. NiFe and NiCoCr, have a relatively high and flat response across the frequency range. Ni coated MFM probe has the highest response to AC magnetic fields. In addition, CoCr and NiCo coated MFM probes show lower response than NiFe and NiCoCr probes at low frequencies; however, theirs response to AC magnetic field increase for the AC magnetic field with a frequency above 50 kHz. This can be implied that those MFM probes are a good candidate for being used to study the high-frequency performance of perpendicular magnetic write heads. Noting that response of all MFM probes significantly decreased when driven frequencies above 1 MHz due to the limitation of the hardware, i.e. response of quadrant photodiode and op-amp in a pre-amplifier.

  13. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  14. Mixed mobile ion effect on ac conductivity of boroarsenate glasses

    Indian Academy of Sciences (India)

    In this article we report the study of mixed mobile ion effect (MMIE) in boroarsenate glasses. DSC and a.c. electrical conductivity studies have been carried out for MgO–(25−)Li2O–50B2O3–25As2O3 glasses. It is observed that strength of MMIE in a.c. conductivity is less pronounced with increase in temperature and ...

  15. AC Calorimetric Design for Dynamic of Biological Materials

    OpenAIRE

    Shigeo Imaizumi

    2006-01-01

    We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...

  16. shift

    African Journals Online (AJOL)

    during the course of an academic year at the University of Witwatersrand following recent reforms in training and assessment methods Method: All fifth ... Assessment of Psychiatry in medical education at the. University of Witwatersrand ... or two examiners, to assess mainly clinical competence; multiple-choice questions ...

  17. Response shift en retrospectie. / Response shift in retrospect.

    NARCIS (Netherlands)

    Hoogstraten, J.; de Meijer, E.; Sprangers, M.

    1986-01-01

    Discusses the relationship between response shift and the concept of "artifact" with reference to W. K. Hofstee's (1986) arguments. The use of retrospective posttests instead of retrospective pretests is rejected, and some empirical approaches for assessing the impact of social desirability and

  18. Paradigm Shifts in Ophthalmic Diagnostics.

    Science.gov (United States)

    Sebag, J; Sadun, Alfredo A; Pierce, Eric A

    2016-08-01

    Future advances in ophthalmology will see a paradigm shift in diagnostics from a focus on dysfunction and disease to better measures of psychophysical function and health. Practical methods to define genotypes will be increasingly important and non-invasive nanotechnologies are needed to detect molecular changes that predate histopathology. This is not a review nor meant to be comprehensive. Specific topics have been selected to illustrate the principles of important paradigm shifts that will influence the future of ophthalmic diagnostics. It is our impression that future evaluation of vision will go beyond visual acuity to assess ocular health in terms of psychophysical function. The definition of disease will incorporate genotype into what has historically been a phenotype-centric discipline. Non-invasive nanotechnologies will enable a paradigm shift from disease detection on a cellular level to a sub-cellular molecular level. Vision can be evaluated beyond visual acuity by measuring contrast sensitivity, color vision, and macular function, as these provide better insights into the impact of aging and disease. Distortions can be quantified and the psychophysical basis of vision can be better evaluated than in the past by designing tests that assess particular macular cell function(s). Advances in our understanding of the genetic basis of eye diseases will enable better characterization of ocular health and disease. Non-invasive nanotechnologies can assess molecular changes in the lens, vitreous, and macula that predate visible pathology. Oxygen metabolism and circulatory physiology are measurable indices of ocular health that can detect variations of physiology and early disease. This overview of paradigm shifts in ophthalmology suggests that the future will see significant improvements in ophthalmic diagnostics. The selected topics illustrate the principles of these paradigm shifts and should serve as a guide to further research and development. Indeed

  19. GATA-4/-6 and HNF-1/-4 families of transcription factors control the transcriptional regulation of the murine Muc5ac mucin during stomach development and in epithelial cancer cells.

    Science.gov (United States)

    Jonckheere, Nicolas; Vincent, Audrey; Franquet-Ansart, Hélène; Witte-Bouma, Janneke; Korteland-van Male, Anita; Leteurtre, Emmanuelle; Renes, Ingrid B; Van Seuningen, Isabelle

    2012-08-01

    During human embryonic and fetal development of the gastrointestinal tract, the gene encoding the MUC5AC mucin has a spatio-temporal pattern of expression restricted to the stomach. In order to better understand the molecular mechanisms responsible for this restricted pattern of expression, we have studied Muc5ac expression in the developing stomach of the mouse and correlated it to that of transcription factors known to be involved in cell differentiation programs during development. Our results indicate that GATA-6 and HNF-4α expression increased concomitantly with the induction of Muc5ac expression in embryonic stomach. We then studied Muc5ac transcriptional regulation by these transcription factors and showed that they all transactivate Muc5ac promoter. We also identified several active GATA-4/-5/-6 and HNF-1/-4 cis-elements using gel shift assays, chromatin immunoprecipitation and site-directed mutagenesis. Among all Muc5ac regulators, only GATA-6 and HNF-4a expression was concomitant to that of Muc5ac in the developing stomach. This is thus in favor of an important role for these two transcription factors as regulators of expression of the Muc5ac mucin during stomach development and in epithelial cancer cells. Copyright © 2012 Elsevier B.V. All rights reserved.

  20. Diagnostics of the Fermilab Tevatron using an AC dipole

    Science.gov (United States)

    Miyamoto, Ryoichi

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f˜20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  1. VP Anaphors and Object Shift

    DEFF Research Database (Denmark)

    Ørsnes, Bjarne

    2013-01-01

    The article discusses the placement of the VP anaphor det ‘it’ as a complement of verbs selecting VP complements in Danish. With verbs that only allow a VP complement, the VP anaphor must be in SpecCP regardless of its information structure properties. If SpecCP is occupied by an operator, the an...... be in situ. The article argues that a shifted pronominal in Danish must be categorially licensed by the verb and extends this analysis to shifting locatives. An Optimality Theory analysis is proposed that accounts for the observed facts....

  2. AC quantum voltmeter for the industry; AC-Quantenvoltmeter fuer die Industrie

    Energy Technology Data Exchange (ETDEWEB)

    Behr, Ralf [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe 2.63 ' ' Josephson-Effekt, Spannung' ' ; Smandek, Bernhard [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe Q.33 ' ' Technologietransfer' '

    2016-09-15

    In a first part difficulties and challenges of the novel operation principle, the ''differential scanning system'' are discussed and explained, how with highest metrological precision the proof of principle succeeded. By common research with other national metrology institutes the concept was consolidated and improved. In a second part it was exemplarically illuminated, how by an efficient dovetailing of European and national promotion programs with different application neighbourhood consolidated knowledge of basic metrological research could be transferred to economy and especially small and medium companies. With an AC quantum voltmeter up to 10 V and 1 kHz already a unique commercial device is available. How the development foreseeable goes on illuminates the final part of the article.

  3. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  4. Does the ARFIMA really shift?

    DEFF Research Database (Denmark)

    Monache, Davide Delle; Grassi, Stefano; Santucci de Magistris, Paolo

    Short memory models contaminated by level shifts have long-memory features similar to those associated to processes generated under fractional integration. In this paper, we propose a robust testing procedure, based on an encompassing parametric specification, that allows to disentangle the level...

  5. Shift Work: Improving Daytime Sleep

    Science.gov (United States)

    ... Good daytime sleep is possible, though, if shift work is a necessary part of your work life. To promote better sleep during the day: ... Take naps. Napping late in the day before work might help you make up your sleep debt. ...

  6. Leadership Shifts in Changing Field

    Science.gov (United States)

    Zubrzycki, Jaclyn

    2013-01-01

    As groups representing local and state education players struggle to remain relevant in a policy conversation often dominated by foundations, think tanks, new advocacy groups, and political and business figures, a shift in leadership has been under way at major associations. Most of the changes have come as part of the natural churn; former…

  7. Shift register neutron coincidence module

    International Nuclear Information System (INIS)

    Stephens, M.M.; Swansen, J.E.; East, L.V.

    1975-11-01

    A neutron coincidence module was designed using multistage shift registers to produce the coincidence gates and a crystal controlled oscillator with variable clock outputs to change the gate lengths. The advantage of this system over the conventional, thermal-neutron coincidence gates is a decrease in deadtime by more than an order of magnitude

  8. The Shift Needed for Sustainability

    Science.gov (United States)

    Smith, Peter A. C.; Sharicz, Carol

    2011-01-01

    Purpose: The purpose of this action research is to begin to assess to what extent organizations have in practice begun to make the shift towards triple bottom line (TBL) sustainability. Design/methodology/approach: A definition of TBL sustainability is provided, and key elements of TBL sustainability considered necessary to success are identified…

  9. Environmental Protection: a shifting focus

    NARCIS (Netherlands)

    Dr. ir. Jan Venselaar

    2004-01-01

    The last two decades have seen a fundamental change in the way chemistry handles environmental issues. A shift in focus has occurred from 'end-of-pipe' to prevention and process integration. Presently an even more fundamental change is brought about by the need for sustainable development. It is

  10. Inconsistent Effects of Parietal α-tACS on Pseudoneglect across Two Experiments: A Failed Internal Replication

    Directory of Open Access Journals (Sweden)

    Domenica Veniero

    2017-06-01

    Full Text Available Transcranial electrical stimulation (tES is being investigated as an experimental and clinical interventional technique in human participants. While promising, important limitations have been identified, including weak effect sizes and high inter- and intra-individual variability of outcomes. Here, we compared two “inhibitory” tES-techniques with supposedly different mechanisms of action as to their effects on performance in a visuospatial attention task, and report on a direct replication attempt. In two experiments, 2 × 20 healthy participants underwent tES in three separate sessions testing different protocols (10 min stimulation each with a montage targeting right parietal cortex (right parietal–left frontal, electrode-sizes: 3cm × 3cm–7 cm × 5 cm, while performing a perceptual line bisection (landmark task. The tES-protocols were compared as to their ability to modulate pseudoneglect (thought to be under right hemispheric control. In experiment 1, sham-tES was compared to transcranial alternating current stimulation at alpha frequency (10 Hz; α-tACS (expected to entrain “inhibitory” alpha oscillations and to cathodal transcranial direct current stimulation (c-tDCS (shown to suppress neuronal spiking activity. In experiment 2, we attempted to replicate the findings of experiment 1, and establish frequency-specificity by adding a 45 Hz-tACS condition to α-tACS and sham. In experiment 1, right parietal α-tACS led to the expected changes in spatial attention bias, namely a rightward shift in subjective midpoint estimation (relative to sham. However, this was not confirmed in experiment 2 and in the complete sample. Right parietal c-tDCS and 45 Hz-tACS had no effect. These results highlight the importance of replication studies, adequate statistical power and optimizing tES-interventions for establishing the robustness and reliability of electrical stimulation effects, and best practice.

  11. Zig-zag arrangement of four electrodes for ac electro-osmotic micropumps.

    Science.gov (United States)

    Hrdlička, J; Cervenka, P; Přibyl, M; Snita, D

    2011-07-01

    This paper deals with the mathematical modeling of traveling-wave ac electro-osmotic micropumps with a zig-zag arrangement of microelectrodes. A mathematical model based on the Poisson-Nernst-Planck-Navier-Stokes description is used in this study within the physically relevant ranges of the model parameters. We present an extensive set of parametrical studies concerning the dependence of the net velocity on a variety of parameters. We also demonstrate limits of the validity of the commonly used Capacitor-Resistor-Capacitor model. In order to achieve high net velocities, we found that there are the optimal values of the electrode length, the shift between the top and bottom electrode arrays, and the signal frequency. Performance of the zig-zag micropumps is evaluated by the means of back-pressure loads. The suggested zig-zag design brings two main benefits: (i) it allows an easier construction of four-phase traveling-wave micropumps without the need of spatially complicated electrode connections, and (ii) the zig-zag pumps can provide higher flow rates than those with single-sided coplanar arrangements. Another robust feature of the proposed zig-zag system is that a single flow reversal is observed at the ac frequency approximately six times higher than the reciprocal resistor-capacitor time even in low-amplitude regimes.

  12. Performance of the adaptive collision source (ACS) method for discrete ordinates in parallel environments

    International Nuclear Information System (INIS)

    Walters, W.J.; Haghighat, A.

    2013-01-01

    A new collision source method has been developed to solve the Linear Boltzmann Equation (LBE) more efficiently by adaptation of the angular quadrature order. The angular adaptation method is unique in that the flux from each scattering source iteration is obtained separately, with potentially a different quadrature order. This allows for an optimal use of processing power, by using a high order quadrature for the first few iterations that need it, before shifting to lower order quadratures for the remaining iterations. This is essentially an extension of the first collision source method, and we call it the adaptive collision source method (ACS). The ACS methodology has been implemented in the TITAN discrete ordinates code, and has shown a speedup of 2-3 on a test problem, with very little loss of accuracy (within a provided adaptive tolerance). Further, the code has been extended to work in parallel environments by angular decomposition. Although the method requires increased parallel communication, tests have shown excellent scale adaptation, with parallel fractions of up to 99%. (authors)

  13. AC susceptibility as a characterization tool for coated conductor tapes

    Science.gov (United States)

    Gömöry, F.; Vojenčiak, M.; Solovyov, M.; Frolek, L.; Šouc, J.; Seiler, E.; Bauer, M.; Falter, M.

    2017-11-01

    The measurement and analysis of magnetic AC susceptibility is a useful tool in the study of superconductor (SC) materials. Exposure of a sample to a magnetic field changing in time generates loops of electrical currents that are detectable in a contactless way with the help of a suitable pick-up system. In this paper the applicability of this technique in the characterization and quality control of coated conductor (CC) tapes is evaluated. First we recollect the essential results of the analytical theory derived for thin SC strips and their extrapolation to strips with finite thickness. From the analytical expressions one can see how the properties of CC tape that are important for application in electric power devices, namely its critical current and AC loss, can be deduced from AC susceptibility data in straightforward way. The main focus of our study is to investigate the influence that various cases of non-uniformities in SC layer exhibit on the magnetic properties examined in an AC regime. Numerical computations were used to explore the consequences of lateral variation in the critical current density. Predictions derived for some model cases were compared with experimental findings. A dedicated experiment was also carried out to demonstrate that a transverse scratch that would be detrimental for DC transport could sneak unobserved through the AC magnetic experiment on a long sample. Our study shows that the analysis of both parts of the complex magnetic susceptibility in place of a mere AC loss determination in a common AC magnetization experiment is worth the additional effort.

  14. AC power flow importance measures considering multi-element failures

    International Nuclear Information System (INIS)

    Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

    2017-01-01

    Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

  15. Effect of holding period prior to storage on the chemical attributes of Starking Delicious apples during refrigerated storage Efeito do período que antecede o armazenamento nos atributos químicos de maças Starking Delicious durante o armazenamento refrigerado

    Directory of Open Access Journals (Sweden)

    Aynur Batkan

    2012-06-01

    Full Text Available In this research, the effects of three different holding periods (6, 12 and 24 hours prior to storage on the quality attributes of Starking Delicious apples were investigated during storage of 8 months at 0.5 ± 1.0 ºC. Changes in weight loss, flesh firmness, pH values, soluble dry matter amount, titratable acidity values, ascorbic acid contents, and total and reducing sugar content were determined. According to the results, the holding period showed statistically significant changes in the quality attributes of the apples (p Neste trabalho, os efeitos de três diferentes tempos de espera (6, 12 e 24 horas antes do armazenamento sobre os atributos de qualidade de maçãs tipo Starking Delicious foram investigados durante o armazenamento de 8 meses a 0,5 ± 1,0 ºC. Alterações na perda de peso, firmeza da polpa, valores de pH, quantidade de matéria seca solúvel, valores de acidez titulável, teor de ácido ascórbico e teor de açúcar redutor e total das amostras foram determinadas. De acordo com os resultados da análise, o tempo de espera causou alterações estatisticamente significativas sobre as nos atributos de qualidade das maçãs (p < 0,05.

  16. A novel five-level optimized carrier multilevel PWM quad-inverter six-phase AC drive

    DEFF Research Database (Denmark)

    Sanjeevikumar, P.; Blaabjerg, F.; Wheeler, Pat

    2016-01-01

    to space vector modulation approaches for real time implementation. The total electric power shared among the four dc buses and quadruples the power capability of VSIs. Complete ac drive modules are developed numerically using simulation in MATLAB/PLECS software. Observed set of results are depicted...... modifications, i.e. one additional bi-direction switch (MOSFET/IGBT) in each phase and a link to neutral with two capacitors to generate increased output levels. Furthermore, original optimal single carrier zero-shifted five-level modulation (SCZSFM) algorithm is developed for each VSI to behave as equivalent...

  17. Accounting for Readout Dark in ACS/WFC Superbiases

    Science.gov (United States)

    Ryon, J. E.; Grogin, N. A.; Coe, D.

    2017-12-01

    We investigate the properties of excess dark current accumulated during the 100-second full-frame readout of the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) detectors. This excess dark current, called "readout dark", gives rise to ambient background gradients and hot columns in each ACS/WFC image. We present an analysis of simulated readout dark images developed in ACS ISR 2014-02, and find that the results from the simulated data cannot be fully reconciled with the results from observed bias images. We develop a new method to estimate the readout dark noise properties in ACS/WFC observations instead of using simulated images. While readout dark signal is removed from science images during the bias correction step in CALACS, the additional noise from the readout dark is currently not taken into account. We will update the ERR extensions of superbias images to include the appropriate noise from the ambient readout dark gradient and stable hot columns. We will also flag unstable hot columns in the DQ extensions of the superbiases. A new reference file pipeline for ACS/WFC that will implement these changes is currently under construction.

  18. Aragonite coating solutions (ACS) based on artificial seawater

    Science.gov (United States)

    Tas, A. Cuneyt

    2015-03-01

    Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  19. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  20. Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

    Energy Technology Data Exchange (ETDEWEB)

    Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

    2008-07-01

    Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

  1. Analytical Comparison of Dual-Input Isolated dc-dc Converter with an ac or dc Inductor for Renewable Energy Systems

    DEFF Research Database (Denmark)

    Zhang, Zhe; Mira Albert, Maria del Carmen; Andersen, Michael A. E.

    2017-01-01

    with an ac inductor as a power interfacing element or phase-shift softswitching converter with an output dc inductor. Both converters are controlled by a pulse-width modulation and phase-shift hybrid modulation scheme. The two converter topologies are, even though quite similar from the topological...... and control perspective, distinct in operation principles, voltage/power transfer functions, loss distributions, soft-switching constraints, and power efficiency under the same operating conditions. Moreover, the inductor design differs greatly between these two cases. In this paper, a comprehensive...

  2. Special training of shift personnel

    International Nuclear Information System (INIS)

    Martin, H.D.

    1981-01-01

    The first step of on-the-job training is practical observation phase in an operating Nuclear Plant, where the participants are assigned to shift work. The simulator training for operating personnel, for key personnel and, to some extent, also for maintenance personnel and specialists give the practical feeling for Nuclear Power Plant behaviour during normal and abnormal conditions. During the commissioning phase of the own Nuclear Power Plant, which is the most important practical training, the participants are integrated into the commissioning staff and assisted during their process of practical learning by special instructors. The preparation for the licensing exams is vitally important for shift personnel and special courses are provided after the first non-nuclear trial operation of the plant. Personnel training also includes performance of programmes and material for retraining, training of instructors and assistance in building up special training programmes and material as well as training centers. (orig./RW)

  3. The Negative Impact of Stark Law Exemptions on Graduate Medical Education and Health Care Costs: The Example of Radiation Oncology

    International Nuclear Information System (INIS)

    Anscher, Mitchell S.; Anscher, Barbara M.; Bradley, Cathy J.

    2010-01-01

    Purpose: To survey radiation oncology training programs to determine the impact of ownership of radiation oncology facilities by non-radiation oncologists on these training programs and to place these findings in a health policy context based on data from the literature. Methods and Materials: A survey was designed and e-mailed to directors of all 81 U.S. radiation oncology training programs in this country. Also, the medical and health economic literature was reviewed to determine the impact that ownership of radiation oncology facilities by non-radiation oncologists may have on patient care and health care costs. Prostate cancer treatment is used to illustrate the primary findings. Results: Seventy-three percent of the surveyed programs responded. Ownership of radiation oncology facilities by non-radiation oncologists is a widespread phenomenon. More than 50% of survey respondents reported the existence of these arrangements in their communities, with a resultant reduction in patient volumes 87% of the time. Twenty-seven percent of programs in communities with these business arrangements reported a negative impact on residency training as a result of decreased referrals to their centers. Furthermore, the literature suggests that ownership of radiation oncology facilities by non-radiation oncologists is associated with both increased utilization and increased costs but is not associated with increased access to services in traditionally underserved areas. Conclusions: Ownership of radiation oncology facilities by non-radiation oncologists appears to have a negative impact on residency training by shifting patients away from training programs and into community practices. In addition, the literature supports the conclusion that self-referral results in overutilization of expensive services without benefit to patients. As a result of these findings, recommendations are made to study further how physician ownership of radiation oncology facilities influence graduate

  4. Debt Shifting and Ownership Structure

    OpenAIRE

    Dirk Schindler; Guttorm Schjelderup

    2011-01-01

    Previous theoretical studies on the debt shifting behavior of multinationals have assumed affiliates of multinationals to be wholly owned. We develop a model that allows a multinational firm to determine both the leverage and ownership structure in affiliates endogenously. A main finding is that affiliates with minority owners have less debt than wholly owned affiliates and therefore a less tax efficient financing structure. This is due to an externality that arises endogenously in our model,...

  5. Into the Era of shifts

    DEFF Research Database (Denmark)

    Dencik, Lars

    2005-01-01

    Globalization and new communication technologies shape new increasingly unpredictable living conditions. Societies as individuals face a world og growing predictive impotence. Traditions loose their power as guides for maneuvering - where traditions was reflection will be. At the same time people......, life styles, experiences and sexuality. Even thougts and feelings.In the era of shifts we shall be living with ever more design in an ever less designed world....

  6. Hadronic shift in pionic hydrogen

    Energy Technology Data Exchange (ETDEWEB)

    Hennebach, M.; Gotta, D. [Forschungszentrum Juelich, Institut fuer Kernphysik, Juelich (Germany); Anagnostopoulos, D.F. [University of Ioannina, Department of Materials Science and Engineering, Ioannina (Greece); Dax, A.; Liu, Y.W.; Markushin, V.E.; Simons, L.M. [Paul Scherrer Institut, Laboratory for Particle Physics, Villigen (Switzerland); Fuhrmann, H.; Gruber, A.; Hirtl, A.; Zmeskal, J. [Austrian Academy of Sciences, Stefan Meyer Institute for Subatomic Physics, Vienna (Austria); Indelicato, P. [UPMC Univ. Paris 06, Laboratoire Kastler Brossel, Sorbonne Universites, Paris (France); CNRS, Laboratoire Kastler Brossel, Paris (France); Departement de Physique de l' Ecole Normale Superieure, Laboratoire Kastler Brossel, Paris (France); Manil, B. [UPMC Univ. Paris 06, Laboratoire Kastler Brossel, Sorbonne Universites, Paris (France); Rusi el Hassani, A.J. [Universite Abdelmalek Essaadi, Faculte des Sciences et Techniques, Tanger (Morocco); Trassinelli, M. [Sorbonne Universites, Institut des NanoSciences de Paris, Paris (France); CNRS, Institut des NanoSciences de Paris, Paris (France)

    2014-12-01

    The hadronic shift in pionic hydrogen has been redetermined to be ε {sub 1s} = 7.086 ± 0.007(stat) ± 0.006(sys) eV by X-ray spectroscopy of ground-state transitions applying various energy calibration schemes. The experiment was performed at the high-intensity low-energy pion beam of the Paul Scherrer Institut by using the cyclotron trap and an ultimate-resolution Bragg spectrometer with bent crystals. (orig.)

  7. Multicolor Holography With Phase Shifting

    Science.gov (United States)

    Vikram, Chandra S.

    1996-01-01

    Prototype apparatus constructed to test feasibility of two-color holographic interferometric scheme in which data for reconstructing holographic wavefront obtained with help of phase-shifting technique. Provides two sets of data needed to solve equations for effects of temperature and concentration. Concept extended to holography at three or more wavelengths to measure three or more phenomena associated with significant variations in index of refraction

  8. Shift Work and Endocrine Disorders

    Directory of Open Access Journals (Sweden)

    M. A. Ulhôa

    2015-01-01

    Full Text Available The objective of this review was to investigate the impact of shift and night work on metabolic processes and the role of alterations in the sleep-wake cycle and feeding times and environmental changes in the occurrence of metabolic disorders. The literature review was performed by searching three electronic databases for relevant studies published in the last 10 years. The methodological quality of each study was assessed, and best-evidence synthesis was applied to draw conclusions. The literature has shown changes in concentrations of melatonin, cortisol, ghrelin, and leptin among shift workers. Melatonin has been implicated for its role in the synthesis and action of insulin. The action of this hormone also regulates the expression of transporter glucose type 4 or triggers phosphorylation of the insulin receptor. Therefore, a reduction in melatonin can be associated with an increase in insulin resistance and a propensity for the development of diabetes. Moreover, shift work can negatively affect sleep and contribute to sedentarism, unhealthy eating habits, and stress. Recent studies on metabolic processes have increasingly revealed their complexity. Physiological changes induced in workers who invert their activity-rest cycle to fulfill work hours include disruptions in metabolic processes.

  9. Superconducting shielded core reactor with reduced AC losses

    Science.gov (United States)

    Cha, Yung S.; Hull, John R.

    2006-04-04

    A superconducting shielded core reactor (SSCR) operates as a passive device for limiting excessive AC current in a circuit operating at a high power level under a fault condition such as shorting. The SSCR includes a ferromagnetic core which may be either closed or open (with an air gap) and extends into and through a superconducting tube or superconducting rings arranged in a stacked array. First and second series connected copper coils each disposed about a portion of the iron core are connected to the circuit to be protected and are respectively wound inside and outside of the superconducting tube or rings. A large impedance is inserted into the circuit by the core when the shielding capability of the superconducting arrangement is exceeded by the applied magnetic field generated by the two coils under a fault condition to limit the AC current in the circuit. The proposed SSCR also affords reduced AC loss compared to conventional SSCRs under continuous normal operation.

  10. AC Application of HTS Conductors in Highly Dynamic Electric Motors

    International Nuclear Information System (INIS)

    Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K

    2006-01-01

    Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit

  11. Reliability of emergency ac power systems at nuclear power plants

    Energy Technology Data Exchange (ETDEWEB)

    Battle, R E; Campbell, D J

    1983-07-01

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project.

  12. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  13. Objectives and status of development of AC600

    International Nuclear Information System (INIS)

    Zhao Chengkun

    1997-01-01

    AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600

  14. Recurrent Security Gaps In 802.11ac Routers

    Directory of Open Access Journals (Sweden)

    Mohammed Farik

    2015-08-01

    Full Text Available Abstract In comparison to earlier IEEE 802.11 standard abgn routers todays popular 802.11ac standard routers have enhanced security. However 802.11ac router still has major security vulnerabilities. The novelty of this paper is that we not only highlight multiple security vulnerabilities in 802.11ac router technologies that still have not been secured since the earlier standards but also present some new ideas with solutions. We believe that our line of thoughts on security vulnerabilities gaps and on new solutions will provide network security researchers router manufacturers and network administrators with new disclosures to redesign even better security mechanisms in routers to counter attacks on networks via routers.

  15. DC and AC conductivity properties of bovine dentine hydroxyapatite (BDHA)

    Science.gov (United States)

    Dumludag, F.; Gunduz, O.; Kılıc, O.; Ekren, N.; Kalkandelen, C.; Ozbek, B.; Oktar, F. N.

    2017-12-01

    Bovine dentine bio-waste may be used as a potential natural source of hydroxyapatite (BDHA), thus extraction of bovine dentin hydroxyapatite (BDHA) from bio-waste is significantly important to fabricate in a simple, economically and environmentally preferable. DC and AC conductivity properties of BDHA were investigated depending on sintering temperature (1000ºC - 1300°C) in air and vacuum (<10-2 mbar) ambient at room temperature. DC conductivity measurements performed between -1 and 1 V. AC conductivity measurements performed in the frequency range of 40 Hz – 100 kHz. DC conductivity results showed that dc conductivity values of the BDHA decrease with increasing sintering temperature in air ambient. It is not observed remarkable/systematic behavior for ac conductivity depending on sintering temperature.

  16. Hybrid AC-High Voltage DC Grid Stability and Controls

    Science.gov (United States)

    Yu, Jicheng

    The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

  17. Active Power Regulation based on Droop for AC Microgrid

    DEFF Research Database (Denmark)

    Li, Chendan; Coelho, Ernane A. A.; Firoozabadi, Mehdi Savaghebi

    2015-01-01

    In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed to succes......In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed...

  18. EXT-II: a second generation advanced ac propulsion system

    Energy Technology Data Exchange (ETDEWEB)

    Bates, B.; Patil, P.B.; Ciccarelli, M.F.

    1986-01-01

    This paper discusses the characteristics of the concept and includes discussion of the system constraints, including traction battery constraints, and brief descriptions of the major subsystems being developed. The components discussed include: the system controller, dc to ac inverter, an internal permanent magnet ac motor and a two-speed automatic transmission with an integral final drive and differential. The motor and transmission are on a common axis and are integrated into one compact unit that is integral with the rear axle of the vehicle.

  19. Productos «Celotex» para acondicionamientos Acústicos

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-02-01

    Full Text Available Not availableBajo la denominación general «Celotex», que es un nombre registrado, la Casa Americana The Celotex Corporation, cuyo domicilio social es 120 South, La Salle Street, Chicago J. lllinois, fabrica diversos materiales para fines de acondicionamiento acústico elaborados, según los tipos de que se trate, con fibra de caña de azúcar, lanas minerales, acero, amianto, etc., perforados o no y de acuerdo con el efecto estético y acústico que se desee obtener.

  20. Patient Adviser What to Do About AC Joint Injuries.

    Science.gov (United States)

    Johnson, R J

    2001-11-01

    The muscles, joints, and bones of the shoulders form a base of support that allows your arms to swing, lift, or throw (figure 1). One of these bones, the collarbone, is also called the clavicle. Above your arm is an extension of the shoulder blade called the acromion. Where these two bones meet at the top of the shoulder is the acromioclavicular (AC) joint. The AC joint is not the shoulder joint. The shoulder joint is where the bone of the upper arm (humerus) meets a shallow socket that is also part of the shoulder blade.

  1. The minimization of ac phase noise in interferometric systems

    DEFF Research Database (Denmark)

    Filinski, Ignacy; Gordon, R A

    1994-01-01

    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using...

  2. Programmable Power Supply for AC Switching Magnet of Proton Accelerator

    CERN Document Server

    Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung

    2005-01-01

    The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.

  3. Temas de Física para Ingeniería: Acústica

    OpenAIRE

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  4. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  5. Incoherent and coherent tune shifts

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, S.Y. [Brookhaven National Lab., Upton, NY (United States). AGS Dept.

    1995-12-31

    The longitudinal and transverse microwave instabilities are the two important limiting factors for the performance of an accelerator. Comparing with the fairly unified approach for the longitudinal microwave instabilities, different approaches have been used to define the transverse microwave instabilities. One reason of this is related to the role played by the space charge incoherent and coherent tune shifts. In this article, the transverse microwave instabilities will be discussed by defining separately the roles of the space charge incoherent and coherent tunes, which are represented by the space charge transverse impedances. Preliminary results for the AGS as proton driver are presented by using this approach.

  6. Steady State Shift Damage Localization

    DEFF Research Database (Denmark)

    Sekjær, Claus; Bull, Thomas; Markvart, Morten Kusk

    2017-01-01

    The steady state shift damage localization (S3DL) method localizes structural deterioration, manifested as either a mass or stiffness perturbation, by interrogating the damage-induced change in the steady state vibration response with damage patterns cast from a theoretical model. Damage is, thus...... the required accuracy when examining complex structures, an extensive amount of degrees of freedom (DOF) must often be utilized. Since the interrogation matrix for each damage pattern depends on the size of the system matrices constituting the FE-model, the computational time quickly becomes of first...

  7. Electric field determination in the plasma-antenna boundary of a lower-hybrid wave launcher in Tore Supra through dynamic Stark-effect spectroscopy

    Science.gov (United States)

    Martin, E. H.; Goniche, M.; Klepper, C. C.; Hillairet, J.; Isler, R. C.; Bottereau, C.; Colas, L.; Ekedahl, A.; Panayotis, S.; Pegourie, B.; Lotte, Ph; Colledani, G.; Caughman, J. B.; Harris, J. H.; Hillis, D. L.; Shannon, S. C.; Clairet, F.; Litaudon, X.

    2015-06-01

    Interaction of radio-frequency (RF) waves with the plasma in the near-field of a high-power wave launcher is now seen to be an important topic, both in understanding the channeling of these waves through the plasma boundary and in avoiding power losses in the edge. In a recent Letter, a direct non-intrusive measurement of a near antenna RF electric field in the range of lower hybrid (LH) frequencies (ELH) was announced (2013 Phys. Rev. Lett. 110 215005). This measurement was achieved through the fitting of Balmer series deuterium spectral lines utilizing a time dependent (dynamic) Stark effect model. In this article, the analysis of the spectral data is discussed in detail and applied to a larger range of measurements and the accuracy and limitations of the experimental technique are investigated. It was found through an analysis of numerous Tore Supra discharges that good quantitative agreement exists between the measured and full-wave modeled ELH when the launched power exceeds 0.5 MW. For low power the measurement becomes inaccurate utilizing the implemented passive spectroscopic technique because the spectral noise overwhelms the effect of the RF electric field on the line profile. Additionally, effects of the ponderomotive force are suspected at sufficiently high power.

  8. Vibrational Stark Effect of the Electric-Field Reporter 4-Mercaptobenzonitrile as a Tool for Investigating Electrostatics at Electrode/SAM/Solution Interfaces

    Directory of Open Access Journals (Sweden)

    Peter Hildebrandt

    2012-06-01

    Full Text Available 4-mercaptobenzonitrile (MBN in self-assembled monolayers (SAMs on Au and Ag electrodes was studied by surface enhanced infrared absorption and Raman spectroscopy, to correlate the nitrile stretching frequency with the local electric field exploiting the vibrational Stark effect (VSE. Using MBN SAMs in different metal/SAM interfaces, we sorted out the main factors controlling the nitrile stretching frequency, which comprise, in addition to external electric fields, the metal-MBN bond, the surface potential, and hydrogen bond interactions. On the basis of the linear relationships between the nitrile stretching and the electrode potential, an electrostatic description of the interfacial potential distribution is presented that allows for determining the electric field strengths on the SAM surface, as well as the effective potential of zero-charge of the SAM-coated metal. Comparing this latter quantity with calculated values derived from literature data, we note a very good agreement for Au/MBN but distinct deviations for Ag/MBN which may reflect either the approximations and simplifications of the model or the uncertainty in reported structural parameters for Ag/MBN. The present electrostatic model consistently explains the electric field strengths for MBN SAMs on Ag and Au as well as for thiophenol and mercaptohexanoic acid SAMs with MBN incorporated as a VSE reporter.

  9. Laser Stark spectroscopy of the 2ν 62-ν 6 band of CH 3Br: determination of A0, D K0 and H K0

    Science.gov (United States)

    Sakai, Jun; Katayama, Mikio

    1988-11-01

    About 140 resonances due to the 2ν 62-ν 6 hot band were assigned in the Stark spectra of CH 3Br taken using CO 2 and N 2O laser lines as IR sources. From these data, combined with the high-resolution data of the 2ν 62 overtone band reported by Najib (J. Mol. Spectrosc., 114 (1985) 321) and the spectroscopic constants for the ν 6 fundamental band, the following values were determined for the axial rotational constants in the ground state: A0 = 5.180632(21) and 5.180615(11) cm -1, D K0 = 8.47(4) × 10 -5 and 8.48(2) × 10 -5 cm -1 and H K0 = 4.1(20) × 10 -9 and 4.6(11) × 10 -9 cm -1 for CH 793 Br and CH 381Br, respectively. The numbers in parentheses are 2.5 times the standard deviations in the least-squares fit.

  10. Rabi oscillations and rapid-passage effects in the molecular-beam CO2-laser Stark spectroscopy of CH3F

    International Nuclear Information System (INIS)

    Adam, A.G.; Gough, T.E.; Isenor, N.R.; Scoles, G.

    1985-01-01

    sub-Doppler molecular-beam laser Stark spectroscopy has been employed to produce high-contrast Rabi oscillations in the ν 3 band of CH 3 F. By varying the intensity of the cw CO 2 laser, up to five complete oscillations were observed before the phenomenon was washed out by rapid-passage effects and damping mechanisms. Besides being useful in clarifying key features of coherent ir molecular-beam spectroscopy, the observation of Rabi oscillations provides one of the most accurate means of directly measuring transition dipole moments. Analysis of the present data on three rovibrational transitions, Q(1,1) -1reverse arrow0, P(1,0) 0reverse arrow0, and R(1,1) 0reverse arrow1, has yielded a rotationless transition dipole moment of 0.21 +- 0.01 D for the ν 3 = 1reverse arrow0 vibration. This result is in agreement with values estimated from both band-intensity and absorption-coefficient data in the literature

  11. Electric-dipole moment of CaF by molecular-beam, laser-rf, double-resonance study of Stark splittings

    International Nuclear Information System (INIS)

    Childs, W.J.; Goodman, L.S.; Nielsen, U.; Pfeufer, V.

    1984-01-01

    The electronic structure of diatomic molecules is much more complex for open-shell sytems (radicals) than for the normal closed-shell systems, and the development of an adequate theoretical understanding will require a substantial upgrading of experimental knowledge in both quality and quantity. The alkaline-earth monohalide family of radicals, with only a single electron outside closed-shell cores, would appear to be a logical starting point for such studies, and there has been a great increase in work in this area in the last few years in spite of the special difficulties of working with free radicals. As the work of measuring the vibrational and rotational structure of the electronic states has become more complete, attention has turned to study of the much weaker spin-rotation and hyperfine interactions. Within the last three years, these interactions have been studied systematically at high precision in the calcium monohalide family with the molecular-beam, laser-rf double-resonance technique. The same method has now been modified and extended to make possible measurement of the electric-dipole moments of these molecules through observation of the Stark splittings of radiofrequency transitions. It is hoped that when considered together, the several types of data will make it possible to understand the ground-state electronic wave functions of these molecules at least qualitatively. 2 figures

  12. AC loss characteristics of Bi-2223 HTS tapes under bending

    International Nuclear Information System (INIS)

    Kim, Hae-Joon; Kim, J.H.; Cho, J.W.; Sim, K.D.; Kim, S.; Oh, S.S.; Kwag, D.S.; Kim, H.J.; Bae, J.H.; Seong, K.C.

    2006-01-01

    Superconductor is developed for applications in high-power devices such as power-transmission cables, transformers, motors and generators. In such applications, HTS tapes are subjected to various kinds of stress or strain. AC loss is also important consideration for many large-scale superconducting devices. In the fabrication of the devices, the critical current (I c ) of the high temperature superconductor degrades due to many reasons including the tension applied by bending and thermal contraction. These mechanical loads reduce the I c of superconducting wire and the I c degradation affects the AC loss of the wire. The I c degradation and AC loss of Bi-2223 HTS tape were measured under tension and bending conditions at 77 K and self-field. Moreover, the frequency characteristics of AC loss was measured at the 30-480 Hz. As a result, self-field penetrates the deeper into the conductor at the lower frequency, which means higher self-field losses per cycle

  13. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    increased with temperature for all the biopolymers which corresponds to high polarization effect in these biopoly- mers. The AC impedance parameters for papain, gum aca- cia, gum tragacanth and gum guar are given for four different temperatures in table 1 for comparison. The conductivity of papain increases from 1·65× ...

  14. Parameter Sensitivity In Vector Controlled Ac Motor Drives

    Science.gov (United States)

    Krishnan, R.; Pillay, P.

    1987-10-01

    The relatively recent development of the theory of vector control has enabled ac machines to be transformed, performance wise, into equivalent separately excited dc machines while retaining the many advantages that ac machines have over dc. The ac machines used include the induction and permanent magnet synchronous motors. A precise knowledge of the machine parameters is needed in order to implement indirect vector control on induction motor drive systems where the position of the rotor flux is not measured. If the machine parameters change relative to the preset values in the vector controller, then the decoupling of the torque and flux channels, which is the object of vector control, is lost. Low frequency torque and speed oscillations can result with a consequent degradation in the drive performance. The PMSM drive system is also parameter sensitive although not depending on the same parameters as the induction motor drive. It is well known that machine parameters change with temperature, saturation and on the frequency of operation. An assessment of the overall performance of an ac motor drive must therefore include a study of its parameter sensitivity. In this paper, a detailed steady state study of parameter sensitivity for both the induction and permanent magnet machines is done. Comparisons are also made based on the results of this investigation.

  15. Self-field AC losses in Bi-2223 superconducting tapes

    International Nuclear Information System (INIS)

    Mueller, K. H.; Leslie, K.E.

    1996-01-01

    Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed

  16. Structural and frequency dependencies of a.c. and dielectric ...

    Indian Academy of Sciences (India)

    Abstract. In this work, heterojunction of InSb/InP was grown by liquid phase epitaxy (LPE). Surface morphology and crystalline structure of the heterojunction were characterized by scanning electron microscopy (SEM) and. X-ray diffraction (XRD). The frequency and temperature dependences of a.c. conductivity and ...

  17. Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

    Indian Academy of Sciences (India)

    A series of ammonia treated Mo/Activated Carbon (AC) catalysts were synthesized by wet impregnation method by nominal incorporation of 5, 10 and 15 wt% of molybdenum. The calcined catalysts (500◦C, 4 h, N₂ flow) were subjected to a stepwise ammonia treatment at temperatures from 25 up to 700◦C. This work ...

  18. Electrostatic suppression of the Leidenfrost state using AC electric fields

    Science.gov (United States)

    Ozkan, Onur; Shahriari, Arjang; Bahadur, Vaibhav

    2017-10-01

    The formation of a vapor layer at the solid-liquid interface at high temperatures (Leidenfrost phenomenon) degrades heat transfer substantially. Application of an electric field in this vapor layer can fundamentally eliminate the Leidenfrost state by electrostatically attracting liquid towards the surface. This study analyzes the influence of AC electric fields on electrostatic suppression of the Leidenfrost state; previous studies have only utilized DC electric fields. In particular, the influence of the frequency of the AC waveform on Leidenfrost state suppression is analyzed using high speed visualization of liquid-vapor instabilities and heat transfer measurements of evaporating droplets. It is seen that the extent of suppression is reduced with increasing AC frequency. At sufficiently high frequencies, the influence of an applied voltage is completely negated, and electrostatic suppression of the Leidenfrost state can be completely eliminated. A first-order electromechanical model is used to explain the frequency-dependent reduction in the electrostatic attraction force on the Leidenfrost droplet. Overall, this work highlights the importance of AC frequency as a tool to control the extent of suppression and the boiling heat transfer rate.

  19. Evaluation of ac conductivity behaviour of graphite filled ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 27; Issue 3. Evaluation of a.c. conductivity behaviour of graphite filled polysulphide modified epoxy composites ... Author Affiliations. Navin Chand1 Deepak Jain1. Regional Research Laboratory, Hoshangabad Road, Habibganj Naka, Bhopal 462 026, India ...

  20. Rethinking Rectification: AC-DC Power Supply in Package

    DEFF Research Database (Denmark)

    Pejtersen, Jens; Knott, Arnold; Jørgensen, Ivan Harald Holger

    Rectification of AC mains voltage is almost exclusively implemented with passive diode bridge rectifiers for power applications below 100 W. The diode bridge rectifier is reliable, cost effective and easy to use. But it is also lossy, nonlinear and passive. Thus reducing the power conversion effi...

  1. Evaluation of ac conductivity behaviour of graphite filled

    Indian Academy of Sciences (India)

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled ...

  2. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    are stretched exponential character of dielectric relaxation, power-law power spectral density, and anomalous dependence of ac conduction coefficient on frequency. We propose a self-consistent model of dielectric relaxation in which the relaxations are described by a stretched exponential decay function...

  3. A THREE-PHASE BOOST DC-AC CONVERTER

    African Journals Online (AJOL)

    - strate the feasibility of the proposed three-phase inverter. The inverter is intended to be used in three-phase electric drives and uninterruptible power supply (UPS) systems. Keywords: Boost converter, three-phase dc-ac converter, sliding ...

  4. The Shortest Competition Judgment Ever : AC-Treuhand II

    NARCIS (Netherlands)

    Vedder, Hans; Busscher, Rick Johannes; Herz, Martin

    2015-01-01

    Competition law judgments are notorious for their length. An extreme example is the 5134 paragraph judgment in Cement. In most cases the appeal judgment is significantly shorter, as with the 391 paragraphs in the appeal in Cement. AC-Treuhand is no exception to that rule, but it takes it to the

  5. AC loss in a high-temperature superconducting coil

    NARCIS (Netherlands)

    Chevtchenko, O.A.; Rabbers, J.J.; Godeke, A.; ten Haken, Bernard; ten Kate, Herman H.J.

    1998-01-01

    In a typical superconducting coil made of BSCCO/Ag tape, both amplitude and direction of the magnetic field determine the critical current, resistive voltage and AC loss. The distribution of the magnetic field along and across the superconducting tape in a coil is rather complex. This gives rise to

  6. Efficient method for AC transmission network expansion planning

    Energy Technology Data Exchange (ETDEWEB)

    Rahmani, M. [Electrical Engineering Department, Shahid Bahonar University of Kerman, Kerman (Iran); Faculdade de Engenharia de Ilha Solteira, UNESP - Univ Estadual Paulista, Departamento de Engenharia Eletrica, Ilha Solteira, SP (Brazil); Rashidinejad, M. [Electrical Engineering Department, Shahid Bahonar University of Kerman, Kerman (Iran); Carreno, E.M. [Centro de Engenharia, Universidade Estadual do Oeste de Parana, UNIOESTE, Foz do Iguacu - PR (Brazil); Romero, R. [Faculdade de Engenharia de Ilha Solteira, UNESP - Univ Estadual Paulista, Departamento de Engenharia Eletrica, Ilha Solteira, SP (Brazil)

    2010-09-15

    A combinatorial mathematical model in tandem with a metaheuristic technique for solving transmission network expansion planning (TNEP) using an AC model associated with reactive power planning (RPP) is presented in this paper. AC-TNEP is handled through a prior DC model while additional lines as well as VAr-plants are used as reinforcements to cope with real network requirements. The solution of the reinforcement stage can be obtained by assuming all reactive demands are supplied locally to achieve a solution for AC-TNEP and by neglecting the local reactive sources, a reactive power planning (RPP) will be managed to find the minimum required reactive power sources. Binary GA as well as a real genetic algorithm (RGA) are employed as metaheuristic optimization techniques for solving this combinatorial TNEP as well as the RPP problem. High quality results related with lower investment costs through case studies on test systems show the usefulness of the proposal when working directly with the AC model in transmission network expansion planning, instead of relaxed models. (author)

  7. AC conductivity of a quantum Hall line junction

    International Nuclear Information System (INIS)

    Agarwal, Amit; Sen, Diptiman

    2009-01-01

    We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.

  8. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

  9. Dielectric relaxation and ac conductivity of sodium tungsten ...

    Indian Academy of Sciences (India)

    Abstract. Studies of dielectric relaxation and ac conductivity have been made on three samples of sodium tungsten phosphate glasses over a temperature range of 77–420 K. Complex relative permit- tivity data have been analyzed using dielectric modulus approach. Conductivity relaxation frequency increases with the ...

  10. AC impedance and dielectric spectroscopic studies of Mg ion ...

    Indian Academy of Sciences (India)

    Mater. Sci., Vol. 34, No. 5, August 2011, pp. 1063–1067. c Indian Academy of Sciences. AC impedance and dielectric spectroscopic studies of Mg. 2+ ion conducting PVA–PEG blended polymer electrolytes. ANJI REDDY POLU. ∗ and RANVEER KUMAR. Department of Physics, Dr H S Gour University, Sagar 470 003, India.

  11. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    Time-reversal symmetry breaking by ac field: Effect of commensurability in the frequency domain. V E KRAVTSOV. Present address: The Abdus Salam International Centre for Theoretical Physics, P.O. Box 586, 34100. Trieste, Italy. Landau Institute for Theoretical Physics, 2 Kosygina Street, 117940 Moscow, Russia.

  12. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... will transfer to AWN all remaining tangible and intangible assets owned, leased or held by ACS Wireless...'') agreed to form a joint venture in which each would contribute substantially all the assets used in its... transport assets to a newly formed limited liability company, The Alaska Wireless Network, LLC (``AWN...

  13. Calculation of AC losses in large HTS stacks and coils

    DEFF Research Database (Denmark)

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad

    2012-01-01

    In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting and su...

  14. Investigations on gradient a.c. conductivity characteristics of bamboo ...

    Indian Academy of Sciences (India)

    Unknown

    Electrical measurements were carried out in the temperature range 24–120°C and in the frequency range 4–100 kHz. It was observed that the a.c. conductivity increased initially and then decreased with increase of temperature and frequencies. The increase of distance from outer surface to the inner surface side increased ...

  15. Trends in the development of ehv ac tower lines

    Energy Technology Data Exchange (ETDEWEB)

    McMurtrie, N.J.

    1966-01-01

    Some of the more important current trends in the development of EHV ac tower lines are outlined. The emphasis is primarily on the design and construction aspects of such items as towers, foundations, conductors, insulators and hardware, and the growing integration of the new designs with construction methods. Particular attention is given to the role played by Canadian utilities, manufacturers and engineers.

  16. Cortisol shifts financial risk preferences.

    Science.gov (United States)

    Kandasamy, Narayanan; Hardy, Ben; Page, Lionel; Schaffner, Markus; Graggaber, Johann; Powlson, Andrew S; Fletcher, Paul C; Gurnell, Mark; Coates, John

    2014-03-04

    Risk taking is central to human activity. Consequently, it lies at the focal point of behavioral sciences such as neuroscience, economics, and finance. Many influential models from these sciences assume that financial risk preferences form a stable trait. Is this assumption justified and, if not, what causes the appetite for risk to fluctuate? We have previously found that traders experience a sustained increase in the stress hormone cortisol when the amount of uncertainty, in the form of market volatility, increases. Here we ask whether these elevated cortisol levels shift risk preferences. Using a double-blind, placebo-controlled, cross-over protocol we raised cortisol levels in volunteers over 8 d to the same extent previously observed in traders. We then tested for the utility and probability weighting functions underlying their risk taking and found that participants became more risk-averse. We also observed that the weighting of probabilities became more distorted among men relative to women. These results suggest that risk preferences are highly dynamic. Specifically, the stress response calibrates risk taking to our circumstances, reducing it in times of prolonged uncertainty, such as a financial crisis. Physiology-induced shifts in risk preferences may thus be an underappreciated cause of market instability.

  17. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.

    2017-07-21

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.

  18. Reorganization of microfilament structure induced by ac electric fields

    Energy Technology Data Exchange (ETDEWEB)

    Cho, M.R.; Thatte, H.S.; Golan, D.E. [Harvard Medical School, Boston, MA (United States); Lee, R.C. [Univ. of Chicago, IL (United States)

    1996-11-01

    AC electric fields induce redistribution of integral membrane proteins. Cell-surface receptor redistribution does not consistently follow electric field lines and depends critically on the frequency of the applied ac electric fields, suggesting that mechanisms other than electroosmosis are involved. We hypothesized that cytoskeletal reorganization is responsible for electric field-induced cell-surface receptor redistribution, and used fluorescence video microscopy to study the reorganization of microfilaments in human hepatoma (Hep3B) cells exposed to low-frequency electric fields ranging in strength from 25 mV/cm to 20 V/cm (peak to peak). The frequency of the applied electric field was varied from 1 to 120 Hz and the field exposure duration from 1 to 60 min. In control cells, cytoplasmic microfilaments were aligned in the form of continuous parallel cables along the longitudinal axis of the cell. Exposure of cells to ac electric fields induced alterations in microfilament structure in a manner that depended on the frequency of the applied field. A 1 or 10 Hz ac field caused microfilament reorganization from continuous, aligned cable structures to discontinuous globular patches. In contrast, the structure of microfilaments in cells exposed to 20-120 Hz electric fields did not offer from that in control cells. The extent of microfilament reorganization increased nonlinearly with the electric field strength. The characteristic time for microfilament reorganization in cells exposed to a 1 Hz, 20 V/cm electric field was {approx} 5 min. Applied ac electric fields could initiate signal transduction cascades, which in turn cause reorganization of cytoskeletal structures. 39 refs., 5 figs., 1 tab.

  19. Aragonite coating solutions (ACS) based on artificial seawater

    Energy Technology Data Exchange (ETDEWEB)

    Tas, A. Cuneyt, E-mail: c_tas@hotmail.com

    2015-03-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  20. Aragonite coating solutions (ACS) based on artificial seawater

    International Nuclear Information System (INIS)

    Tas, A. Cuneyt

    2015-01-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry

  1. Individual differences in shift work tolerance

    NARCIS (Netherlands)

    Lammers-van der Holst, H.M.

    2016-01-01

    Shift work is a key feature of our contemporary 24/7 society, employing several successive work teams to sustain around-the-clock operations. However, numerous studies imply that frequently shifting the periods of sleep and wakefulness poses a serious threat to the shift worker’s physical, mental

  2. Shifting Cultivation : Promoting Innovative Policy and Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Shifting Cultivation : Promoting Innovative Policy and Development Options in the Eastern Himalayas. Shifting ... pressure and market forces. The idea is to share good policies and practices related to shifting cultivation and alternative options through regional exchange. ... Les chaînes de valeur comme leviers stratégiques.

  3. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  4. Tilt shift determinations with spatial-carrier phase-shift method in temporal phase-shift interferometry

    International Nuclear Information System (INIS)

    Liu, Qian; Wang, Yang; He, Jianguo; Ji, Fang; Wang, Baorui

    2014-01-01

    An algorithm is proposed to deal with tilt-shift errors in temporal phase-shift interferometry (PSI). In the algorithm, the tilt shifts are detected with the spatial-carrier phase-shift (SCPS) method and then the tilt shifts are applied as priori information to the least-squares fittings of phase retrieval. The algorithm combines the best features of the SCPS and the temporal PSI. The algorithm could be applied to interferograms of arbitrary aperture without data extrapolation for the Fourier transform is not involved. Simulations and experiments demonstrate the effectiveness of the algorithm. The statistics of simulation results show a satisfied accuracy in detecting tilt-shift errors. Comparisons of the measurements with and without environmental vibration show that the proposed algorithm could compensate tilt-shift errors and retrieve wavefront phase accurately. The algorithm provides an approach to retrieve wavefront phase for the temporal PSI in vibrating environment. (paper)

  5. Dynamics and computation in functional shifts

    Science.gov (United States)

    Namikawa, Jun; Hashimoto, Takashi

    2004-07-01

    We introduce a new type of shift dynamics as an extended model of symbolic dynamics, and investigate the characteristics of shift spaces from the viewpoints of both dynamics and computation. This shift dynamics is called a functional shift, which is defined by a set of bi-infinite sequences of some functions on a set of symbols. To analyse the complexity of functional shifts, we measure them in terms of topological entropy, and locate their languages in the Chomsky hierarchy. Through this study, we argue that considering functional shifts from the viewpoints of both dynamics and computation gives us opposite results about the complexity of systems. We also describe a new class of shift spaces whose languages are not recursively enumerable.

  6. Does workplace health promotion reach shift workers?

    DEFF Research Database (Denmark)

    Nabe-Nielsen, Kirsten; Garde, Anne Helene; Clausen, Thomas

    2015-01-01

    OBJECTIVES: One reason for health disparities between shift and day workers may be that workplace health promotion does not reach shift workers to the same extent as it reaches day workers. This study aimed to investigate the association between shift work and the availability of and participatio...... could not confirm that shift workers in general report a lower availability of and participation in workplace health promotion.......OBJECTIVES: One reason for health disparities between shift and day workers may be that workplace health promotion does not reach shift workers to the same extent as it reaches day workers. This study aimed to investigate the association between shift work and the availability of and participation...... in workplace health promotion. METHODS: We used cross-sectional questionnaire data from a large representative sample of all employed people in Denmark. We obtained information on the availability of and participation in six types of workplace health promotion. We also obtained information on working hours, ie...

  7. Marginal flow and gap flow in strongly staggered cascades of slightly convex profiles; Rand- und Spaltstroemungen in stark gestaffelten Verdichtergittern aus schwach gewoelbten Profilen

    Energy Technology Data Exchange (ETDEWEB)

    Sasongko, H. [Technische Univ. Braunschweig (Germany). Inst. fuer Stroemungsmechanik

    1997-09-01

    Teilungsverhaeltnis von t/l=1,0 und einem Staffelungswinkel von {lambda}=50 . Bei einer Reynoldszahl von Re{sub 1}=3,5 x 10{sup 5} und bei Spaltweiten von s/l=0,0; 0,01 und 0,03 wurden Zu- und Nachlaufmessungen und Druckverteilungsmessungen durchgefuehrt sowie Anstrichbilder angefertigt. Die Auswertung der Messungen wurde als Massenmittelung sowie mit Hilfe der Impulsmethode vorgenommen. Zusaetzlich zu den Mittelschnittergebnissen einer Standarduntersuchung enthaelt die Arbeit umfangreiche Ergebnisse zum 3D-Stroemungsgeschehen an den Schaufelenden und auf der Seitenwand in Abhaengigkeit vom Anstellwinkel der Schaufeln und der Spaltweite zwischen den Schaufeln und der Seitenwand. Die Rand- und Spaltstroemungen hoch gestaffelter Verdichtergitter aus schwach gewoelbten Profilen wurden nach Kenntnis des Verfassers nie zuvor im Gitterwindkanal untersucht. Die im Rahmen dieser Arbeit gefundenen Ergebnisse, die stark abweichen von den entsprechenden Ergebnissen frueherer Untersuchungen an niedrig gestaffelten Verdichtergittern aus stark gewoelbten Profilen, sind dementsprechend neu. Ein Vergleich dieser Ergebnisse mit entsprechenden Ergebnissen aus Verdichteruntersuchungen wurde durchgefuehrt mit dem Ergebnis einer qualitativ sehr guten Uebereinstimmung. (orig.)

  8. Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

    Directory of Open Access Journals (Sweden)

    Vinod Kumar Singh

    2016-09-01

    Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

  9. "In situ" extraction of essential oils by use of Dean-Stark glassware and a Vigreux column inside a microwave oven: a procedure for teaching green analytical chemistry.

    Science.gov (United States)

    Chemat, Farid; Perino-Issartier, Sandrine; Petitcolas, Emmanuel; Fernandez, Xavier

    2012-08-01

    One of the principal objectives of sustainable and green processing development remains the dissemination and teaching of green chemistry in colleges, high schools, and academic laboratories. This paper describes simple glassware that illustrates the phenomenon of extraction in a conventional microwave oven as energy source and a process for green analytical chemistry. Simple glassware comprising a Dean-Stark apparatus (for extraction of aromatic plant material and recovery of essential oils and distilled water) and a Vigreux column (as an air-cooled condenser inside the microwave oven) was designed as an in-situ extraction vessel inside a microwave oven. The efficiency of this experiment was validated for extraction of essential oils from 30 g fresh orange peel, a by-product in the production of orange juice. Every laboratory throughout the world can use this equipment. The microwave power is 100 W and the irradiation time 15 min. The method is performed at atmospheric pressure without added solvent or water and furnishes essential oils similar to those obtained by conventional hydro or steam distillation. By use of GC-MS, 22 compounds in orange peel were separated and identified; the main compounds were limonene (72.1%), β-pinene (8.4%), and γ-terpinene (6.9%). This procedure is appropriate for the teaching laboratory, does not require any special microwave equipment, and enables the students to learn the skills of extraction, and chromatographic and spectroscopic analysis. They are also exposed to a dramatic visual example of rapid, sustainable, and green extraction of an essential oil, and are introduced to successful sustainable and green analytical chemistry.

  10. On the determination of plasma electron number density from Stark broadened hydrogen Balmer series lines in Laser-Induced Breakdown Spectroscopy experiments

    Energy Technology Data Exchange (ETDEWEB)

    Pardini, L., E-mail: loren.pard@gmail.com [Istituto di Chimica dei Composti Organometallici del CNR, Area della Ricerca del CNR di Pisa, Via G. Moruzzi 1, 56124 Pisa (Italy); Legnaioli, S.; Lorenzetti, G.; Palleschi, V. [Istituto di Chimica dei Composti Organometallici del CNR, Area della Ricerca del CNR di Pisa, Via G. Moruzzi 1, 56124 Pisa (Italy); Gaudiuso, R.; De Giacomo, A. [Dipartimento di Chimica, Università di Bari, Via Orabona 4, 70126 Bari (Italy); Diaz Pace, D.M. [Instituto de Física ‘Arroyo Seco’, Facultad de Ciencias Exactas, Paraje Arroyo Seco, B7000GHG Tandil (Argentina); Anabitarte Garcia, F. [Photonic Engineering Group, Universidad de Cantabria, Edificio I+D+iTelecomunicación, Dpto. TEISA, 39005 Santander (Spain); Holanda Cavalcanti, G. de [Institute of Physics, Universidade Federal Fluminense, UFF, Campus da Praia Vermelha, Av. Gal Milton Tavares de Souza, Gragoatá, 24310 240 Niterói, RJ (Brazil); Parigger, C. [University of Tennessee Space Institute, 411 B. H. Goethert Parkway, Tullahoma, TN 37388-9700 (United States)

    2013-10-01

    In this work, different theories for the determination of the electron density in Laser-Induced Breakdown Spectroscopy (LIBS) utilizing the emission lines belonging to the hydrogen Balmer series have been investigated. The plasmas were generated by a Nd:Yag laser (1064 nm) pulsed irradiation of pure hydrogen gas at a pressure of 2 · 10{sup 4} Pa. H{sub α}, Η{sub β}, Η{sub γ}, Η{sub δ}, and H{sub ε} Balmer lines were recorded at different delay times after the laser pulse. The plasma electron density was evaluated through the measurement of the Stark broadenings and the experimental results were compared with the predictions of three theories (the Standard Theory as developed by Kepple and Griem, the Advanced Generalized Theory by Oks et al., and the method discussed by Gigosos et al.) that are commonly employed for plasma diagnostics and that describe LIBS plasmas at different levels of approximations. A simple formula for pure hydrogen plasma in thermal equilibrium was also proposed to infer plasma electron density using the H{sub α} line. The results obtained showed that at high hydrogen concentration, the H{sub α} line is affected by considerable self-absorption. In this case, it is preferable to use the H{sub β} line for a reliable calculation of the electron density. - Highlights: • We evaluated the electron density in LIPs utilizing the hydrogen Balmer series. • Plasmas were generated by a Nd:Yag laser (1064 nm) on pure hydrogen gas. • We show that at high hydrogen concentration, H{sub b}eta line is preferable than H{sub a}lpha. • We propose a formula to derive the plasma electron density using the H{sub a}lpha line.

  11. Decay of coherent acoustic phonons generated by femtosecond pulsed optical excitation and injected in a Wannier-Stark superlattice (Conference Presentation)

    Science.gov (United States)

    Kent, Anthony J.; Poyser, Caroline L.; Akimov, Andrey V.; York, William; Henini, Mohamed; Campion, Richard P.

    2017-02-01

    In the past decade, sound amplification by the stimulated emission of (acoustic phonon) radiation (saser) devices for generating coherent terahertz (THz) acoustic waves have been demonstrated [1 - 3]. The devices exploit the electron-phonon interactions in periodic semiconductor nanostructures known as superlattices (SLs) to amplify acoustic phonons. In addition, the particular acoustic properties of SLs can be exploited to make mirrors and cavities for THz phonons. Thus SLs can provide the two essential elements of a saser: the acoustic gain medium and the acoustic cavity. In this presentation I will describe experimental studies of the THz phonon dynamics in a weakly-coupled GaAs/AlAs saser SL, which is DC electrically biased into the Wannier-Stark regime. Picoseconds-duration pulses of coherent THz acoustic phonons were generated using pump light pulses from a femtosecond laser and injected into the SL device. These phonon pulses seeded the saser cavity modes at about 220 and 440 GHz, which were amplified within the device. The phonons were detected using two methods: reflection of femtosecond probe light pulses, in a conventional pump-probe arrangement, and through the transient electrical response of the device itself. When the DC bias conditions for saser were achieved in the device, the amplitude and lifetime of the seeded modes were both increased, analogous to the threshold and spectral line narrowing effects seen in laser devices. [1] R P Beardsley et al., Phys. Rev. Lett. 104, 085501 (2010). [2] W Maryam et al., Nature Communications 4:2184 (2013). [3] K Shinokita et al., Phys. Rev. Lett. 116, 075504 (2016).

  12. Measured losses in superconductor magnets for 60-Hertz ac operation.

    Science.gov (United States)

    Hamlet, I. L.; Kilgore, R. A.

    1971-01-01

    Results of an experimental study of electrical losses in superconductor magnets. Preliminary 60-Hz ac loss data are presented for coils constructed of Nb3Sn ribbon, Nb-Ti cable, and multifilament Nb-Ti. Losses have been measured for different size coils up to approximately 20 cm in diameter. Of the conductor types tested, Nb3Sn ribbon has the lowest losses for ac operation. In Nb3Sn-ribbon coils of different sizes, the loss per unit length of conductor is shown to decrease with a decrease in the rate of change of current and to increase, in general, with increase in coil size. An important aspect of the study is the high degree of repeatability of the data.

  13. Fiber Materials AC Impedance Characteristics and Principium Analysis

    Science.gov (United States)

    Wang, Jianjun; Li, Xiaofeng

    With an invariable amplitude and variable frequency inspiriting, impedance of fiber materials rapidly decrease at first and then increase speedy followed with increasing of signal frequency. For the impedance curve of frequency is section of bathtub, this phenomenon is defined as alternating current electric conductive bathtub effect of fiber material. With analysis tools,of circuit theory and medium polarization theory, the phenomenon can be deeply detected that in AC electric field there are four different kind of currents in fiber material: absorbing current, conductance current, charging current and superficial current. With more analyzing it's discovered this phenomenon can be explained by medium polarize theory. Make using of fiber AC electric conductivity bathtub effect, fast testing equipment on fiber moisture regain can be invent, and disadvantages of conventional impedance technique, such as greatness test error and electrode polarization easily. This paper affords directions to design novel speediness fiber moisture test equipments in theory.

  14. Development of AC-DC power system simulator

    International Nuclear Information System (INIS)

    Ichikawa, Tatsumi; Ueda, Kiyotaka; Inoue, Toshio

    1984-01-01

    A modeling and realization technique is described for realtime plant dynamics simulation of nuclear power generating unit in AC-DC power system simulator. Dynamic behavior of reactor system and steam system is important for investigation a further adequate unit control and protection system to system faults in AC and DC power system. Each unit of two nuclear power generating unit in the power system simulator consists of micro generator, DC motors, flywheels and process computer. The DC motor and flywheel simulates dynamic characteristics of steam turbine, and process computer simulates plant dynamics by digital simulation. We have realized real-time plant dynamics simulation by utilizing a high speed process I/O and a high speed digital differential analyzing processor (DDA) in which we builted a newly developed simple plant model. (author)

  15. On-Chip AC self-test controller

    Science.gov (United States)

    Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY

    2009-09-29

    A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

  16. ac power control in the Core Flow Test Loop

    International Nuclear Information System (INIS)

    McDonald, D.W.

    1980-01-01

    This work represents a status report on a development effort to design an ac power controller for the Core Flow Test Loop. The Core Flow Test Loop will be an engineering test facility which will simulate the thermal environment of a gas-cooled fast-breeder reactor. The problems and limitations of using sinusoidal ac power to simulate the power generated within a nuclear reactor are addressed. The transformer-thyristor configuration chosen for the Core Flow Test Loop power supply is presented. The initial considerations, design, and analysis of a closed-loop controller prototype are detailed. The design is then analyzed for improved performance possibilities and failure modes are investigated at length. A summary of the work completed to date and a proposed outline for continued development completes the report

  17. Indoor Air Pollution in Non Ac Passenger Bus

    Science.gov (United States)

    El Husna, Iksiroh; Unzilatirrizqi, Rizal D. Yan El; Karyanto, Yudi; Sunoko, Henna R.

    2018-02-01

    Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR). The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR) on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.

  18. Indoor Air Pollution in Non Ac Passenger Bus

    Directory of Open Access Journals (Sweden)

    El Husna Iksiroh

    2018-01-01

    Full Text Available Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR. The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.

  19. SNL software manual for the ACS Data Analytics Project.

    Energy Technology Data Exchange (ETDEWEB)

    Stearley, Jon R.; McLendon, William Clarence, III; Rodrigues, Arun F.; Williams, Aaron S.; Hooper, Russell Warren; Robinson, David Gerald; Stickland, Michael G.

    2011-10-01

    In the ACS Data Analytics Project (also known as 'YumYum'), a supercomputer is modeled as a graph of components and dependencies, jobs and faults are simulated, and component fault rates are estimated using the graph structure and job pass/fail outcomes. This report documents the successful completion of all SNL deliverables and tasks, describes the software written by SNL for the project, and presents the data it generates. Readers should understand what the software tools are, how they fit together, and how to use them to reproduce the presented data and additional experiments as desired. The SNL YumYum tools provide the novel simulation and inference capabilities desired by ACS. SNL also developed and implemented a new algorithm, which provides faster estimates, at finer component granularity, on arbitrary directed acyclic graphs.

  20. Ac magnetic susceptibility study of in vivo nanoparticle biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez, L; Veintemillas-Verdaguer, S; Serna, C J; Morales, M P [Instituto de Ciencia de Materiales de Madrid, ICMM-CSIC, Sor Juana Ines de la Cruz 3, Cantoblanco 28049, Madrid (Spain); MejIas, R; Barber, D F [Centro Nacional de BiotecnologIa, CNB-CSIC, Darwin 3, Cantoblanco 28049, Madrid (Spain); Lazaro, F J, E-mail: lucia@icmm.csic.es [Departamento de Ciencia y Tecnologia de Materiales y Fluidos, Universidad de Zaragoza, Maria de Luna 3, 50018, Zaragoza (Spain)

    2011-06-29

    We analysed magnetic nanoparticle biodistribution, before and after cytokine conjugation, in a mouse model by ac susceptibility measurements of the corresponding resected tissues. Mice received repeated intravenous injections of nanoparticle suspension for two weeks and they were euthanized 1 h after the last injection. In general, only 10% of the total injected nanoparticles after multiple exposures were found in tissues. The rest of the particles may probably be metabolized or excreted by the organism. Our findings indicate that the adsorption of interferon to DMSA-coated magnetic nanoparticles changes their biodistribution, reducing the presence of nanoparticles in lungs and therefore their possible toxicity. The specific targeting of the particles to tumour tissues by the use of an external magnetic field has also been studied. Magnetic nanoparticles were observed by transmission electron microscopy in the targeted tissue and quantified by ac magnetic susceptibility.

  1. Lamin A/C and polymeric actin in genome organization

    Czech Academy of Sciences Publication Activity Database

    Ondřej, V.; Lukášová, Emilie; Kroupová, Jana; Matula, P.; Kozubek, Stanislav

    2008-01-01

    Roč. 26, č. 4 (2008), s. 356-361 ISSN 1016-8478 R&D Projects: GA AV ČR(CZ) 1QS500040508; GA MŠk(CZ) LC535 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : lamin A/C * polymeric actin * chromosome territories Subject RIV: BO - Biophysics Impact factor: 2.023, year: 2008

  2. Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis

    Science.gov (United States)

    Hossan, Mohammad Robiul; Dillon, Robert; Dutta, Prashanta

    2014-08-01

    Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface-immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices.

  3. Pancreatectomy risk calculator: an ACS-NSQIP resource

    Science.gov (United States)

    Parikh, Purvi; Shiloach, Mira; Cohen, Mark E; Bilimoria, Karl Y; Ko, Clifford Y; Hall, Bruce L; Pitt, Henry A

    2010-01-01

    Background The morbidity of pancreatoduodenectomy remains high and the mortality may be significantly increased in high-risk patients. However, a method to predict post-operative adverse outcomes based on readily available clinical data has not been available. Therefore, the objective was to create a ‘Pancreatectomy Risk Calculator’ using the American College of Surgeons-National Surgical Quality Improvement Program (ACS-NSQIP) database. Methods The 2005–2008 ACS-NSQIP data on 7571 patients undergoing proximal (n =4621), distal (n =2552) or total pancreatectomy (n =177) as well as enucleation (n =221) were analysed. Pre-operative variables (n =31) were assessed for prediction of post-operative mortality, serious morbidity and overall morbidity using a logistic regression model. Statistically significant variables were ranked and weighted to create a common set of predictors for risk models for all three outcomes. Results Twenty pre-operative variables were statistically significant predictors of post-operative mortality (2.5%), serious morbidity (21%) or overall morbidity (32%). Ten out of 20 significant pre-operative variables were employed to produce the three mortality and morbidity risk models. The risk factors included age, gender, obesity, sepsis, functional status, American Society of Anesthesiologists (ASA) class, coronary heart disease, dyspnoea, bleeding disorder and extent of surgery. Conclusion The ACS-NSQIP ‘Pancreatectomy Risk Calculator’ employs 10 easily assessable clinical parameters to assist patients and surgeons in making an informed decision regarding the risks and benefits of undergoing pancreatic resection. A risk calculator based on this prototype will become available in the future as on online ACS-NSQIP resource. PMID:20815858

  4. Effective AC needleless and collectorless electrospinning for yarn production.

    Science.gov (United States)

    Pokorny, P; Kostakova, E; Sanetrnik, F; Mikes, P; Chvojka, J; Kalous, T; Bilek, M; Pejchar, K; Valtera, J; Lukas, D

    2014-12-28

    Nanofibrous materials are essential components for a wide range of applications, particularly in the fields of medicine and material engineering. These include protective materials, sensors, cosmetics, hygiene, filtration and energy storage. The most widely used and researched technology in these fields is electrospinning. This method for producing fibers yields highly promising results thanks to its versatility and simplicity. Electrospinning is employed in multiple forms, among which needle and needleless direct current (DC) variants are the most distinctive. The former is based on the generation of just one single jet from a nozzle; hence this fabrication process is not very productive. The latter uses the destabilization of free liquid surfaces by means of an electric field, which enhances the throughput since it produces numerous jets, emitted from the surfaces of rollers, spheres, strings and spirals. However, although some progress in total producibility has been achieved, the efficiency of the DC method still remains relatively low. A further drawback of DC electrospinning is that both variants need a collector, which makes it difficult to combine DC electrospinning easily with other technologies due to the presence of the high field strength within the entire spinning zone. This paper describes our experiments with AC electrospinning. We show that alternating current (AC) electrospinning based on a needleless spinning-electrode provides a highly productive smoke-like aerogel composed of nanofibers. This aerogel rises rapidly from the electrode like a thin plume of smoke, without any need for a collector. Our work shows that AC needleless electrospinning gains its efficiency and collector-less feature thanks to the creation of a perpetually charge-changing virtual counter-electrode composed of the nanofibers emitted. High-speed camera recordings demonstrate the formation mechanism of the nanofibrous plume, which is wafted by an electric wind. This wind

  5. DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-05-01

    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  6. MD 349: Impedance Localization with AC-dipole

    CERN Document Server

    Biancacci, Nicolo; Metral, Elias; Salvant, Benoit; Papotti, Giulia; Persson, Tobias Hakan Bjorn; Tomas Garcia, Rogelio; CERN. Geneva. ATS Department

    2016-01-01

    The purpose of this MD is to measure the distribution of the transverse impedance of the LHC by observing the phase advance variation with intensity between the machine BPMs. Four injected bunches with different intensities are excited with an AC dipole and the turn by turn data is acquired from the BPM system. Through post-processing analysis the phase variation along the machine is depicted and, from this information, first conclusions of the impedance distribution can be drawn.

  7. The ACS-NUCL Division 50th Anniversary: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-01-10

    The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.

  8. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan

    2014-09-22

    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  9. AC-600 passive containment cooling system performance research

    International Nuclear Information System (INIS)

    Jia Baoshan; Yu Jiyang; Shi Junying

    1997-01-01

    a code named PCCSAC which is able to predict both the evaporating film on the outside surface of the vessel and the condensed film on its inside is developed successfully. It is a special software tool to analyze the passive containment cooling system (PCCS) performance in the design of AC-600. The author includes the establishment of physical models, selection of numerical methods, debugging and verification of the code and application of the code in the AC-600 PCCS. In physical models, the fundamental conservation equations about various areas and heat conduction equations are established. In order to make the equations to meet the closed form of solution, a lot of structure formulae are complemented. After repeated selection and demonstration of the numerical methods, the backward difference method Gear which is generally used for stiff problem is chosen for the solution of ordinary differential equations derived from the physical models. The results of standard example calculated by the PCCSAC code and the COMMIX code which is used to analyze westinghouse AP-600 are same in the main. The reliability and validity are verified from the calculations. The PCCSAC code is applied in the calculations of two important LOCA used in the containment safety analyses. The sensitivity of main parameters in the system based on LOCA are studied. All the results are reasonable and in agreement with the theoretical analyses. It can be concluded that the PCCSAC code is able to be used for the analyses of AC-600 PCCS performance

  10. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-04-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

  11. Simulation of the AC corona phenomenon with experimental validation

    Science.gov (United States)

    Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R.

    2017-11-01

    The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach.

  12. Simulation of the AC corona phenomenon with experimental validation

    International Nuclear Information System (INIS)

    Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R

    2017-01-01

    The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)

  13. A new on-chip all-digital three-phase full-bridge dc/ac power inverter with feedforward and frequency control techniques.

    Science.gov (United States)

    Chen, Jiann-Jong; Kung, Che-Min

    2010-09-01

    The communication speed between components is far from satisfactory. To achieve high speed, simple control system configuration, and low cost, a new on-chip all-digital three-phase dc/ac power inverter using feedforward and frequency control techniques is proposed. The controller of the proposed power inverter, called the shift register, consists of six-stage D-latch flip-flops with a goal of achieving low-power consumption and area efficiency. Variable frequency is achieved by controlling the clocks of the shift register. One advantage regarding the data signal (D) and the common clock (CK) is that, regardless of the phase difference between the two, all of the D-latch flip-flops are capable of delaying data by one CK period. To ensure stability, the frequency of CK must be six times higher than that of D. The operation frequency of the proposed power inverter ranges from 10 Hz to 2 MHz, and the maximum output loading current is 0.8 A. The prototype of the proposed circuit has been fabricated with TSMC 0.35 μm 2P4M CMOS processes. The total chip area is 2.333 x 1.698 mm2. The three-phase dc/ac power inverter is applicable in uninterrupted power supplies, cold cathode fluorescent lamps, and motors, because of its ability to convert the dc supply voltage into the three-phase ac power sources.

  14. Blackbody radiation shift, multipole polarizabilities, oscillator strengths, lifetimes, hyperfine constants, and excitation energies in Hg+

    International Nuclear Information System (INIS)

    Simmons, M.; Safronova, M. S.; Safronova, U. I.

    2011-01-01

    Excitation energies of the [Xe]4f 14 5d 10 ns, [Xe]4f 14 5d 10 np j , [Xe]4f 14 5d 10 nd j , [Xe]4f 14 5d 10 n ' f j , and [Xe]4f 14 5d 10 n ' g j states in Hg + are evaluated (n≤10, n ' ≤9, and [Xe]=1s 2 2s 2 2p 6 3s 2 3p 6 3d 10 4s 2 4p 6 4d 10 5s 2 5p 6 ). First-, second-, third-, and all-order Coulomb energies and first- and second-order Coulomb-Breit energies are calculated. Reduced matrix elements, oscillator strengths, and transition rates are determined for electric-dipole transitions, including the ns (n=6-11), np (n=6-10), nd (n=6-10), nf (n=5-9), and ng (n=5-9) states. Lifetime values are determined for all above-mentioned states. The ground state E1, E2, and E3 polarizabilities are evaluated. The hyperfine structure in 199 Hg + and 201 Hg + ions is investigated. The hyperfine A and B values are determined for the first low-lying levels up to n = 7. The quadratic Stark effect on hyperfine structure levels of 199 Hg + and 201 Hg + ground states is investigated. The calculated shift for the 199 Hg + (F = 1, M = 0) ↔ (F = 0, M = 0) transition is -0.0597(2) Hz/(kV/cm) 2 , in agreement with previous theoretical result -0.060(3) Hz/(kV/cm) 2 . These calculations provide a theoretical benchmark for comparison with experiment and theory and provide values of blackbody radiation shifts for microwave frequency standards with 199 Hg + and 201 Hg + ions.

  15. UARS PEM Level 2 VMAG AC V001 (UARPE2VMAGAC) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  16. Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Rudy Ariyanto

    2017-11-01

    Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

  17. Microwave quantum logic spectroscopy and control of molecular ions

    DEFF Research Database (Denmark)

    Shi, M.; F. Herskind, P.; Drewsen, M.

    2013-01-01

    A general method for rotational microwave spectroscopy and control of polar molecular ions via direct microwave addressing is considered. Our method makes use of spatially varying AC Stark shifts, induced by far off-resonant, focused laser beams to achieve an effective coupling between...

  18. Functional validation of cadherin as a receptor of Bt toxin Cry1Ac in Helicoverpa armigera utilizing the CRISPR/Cas9 system.

    Science.gov (United States)

    Wang, Jing; Zhang, Haonan; Wang, Huidong; Zhao, Shan; Zuo, Yayun; Yang, Yihua; Wu, Yidong

    2016-09-01

    Cadherins have been identified as receptors of Bacillus thuringiensis (Bt) Cry1A toxins in several lepidopteran insects including the cotton bollworm, Helicoverpa armigera. Disruption of the cadherin gene HaCad has been genetically linked to resistance to Bt toxin Cry1Ac in H. armigera. By using the CRISPR/Cas9 genome editing system (Clustered Regularly Interspaced Short Palindromic Repeats/CRISPR-associated protein 9), HaCad from the Cry1Ac-susceptible SCD strain of H. armigera was successfully knocked out. A single positive CRISPR event with a frame shift deletion of 4 nucleotides was identified and made homozygous to create a knockout line named SCD-Cad. Western blotting confirmed that HaCad was no longer expressed in the SCD-Cad line while an intact HaCad of 210 kDa was present in the parental SCD strain. Insecticide bioassays were used to show that SCD-Cad exhibited 549-fold resistance to Cry1Ac compared with SCD, but no significant change in susceptibility to Cry2Ab. Our results not only provide strong reverse genetics evidence for HaCad as a functional receptor of Cry1Ac, but also demonstrate that the CRISPR/Cas9 technique can act as a powerful and efficient genome editing tool to study gene function in a global agricultural pest, H. armigera. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Plastic changes along auditory pathway during salicylate-induced ototoxicity: Hyperactivity and CF shifts.

    Science.gov (United States)

    Jiang, Chen; Luo, Bin; Manohar, Senthilvelan; Chen, Guang-Di; Salvi, Richard

    2017-04-01

    High dose of salicylate, the active ingredient in aspirin, has long been known to induce transient hearing loss, tinnitus and hyperacusis making it a powerful experimental tool. These salicylate-induced perceptual disturbances are associated with a massive reduction in the neural output of the cochlea. Paradoxically, the diminished neural output of the cochlea is accompanied by a dramatic increase in sound-evoked activity in the auditory cortex (AC) and several other parts of the central nervous system. Exactly where the increase in neural activity begins and builds up along the central auditory pathway are not fully understood. To address this issue, we measured sound-evoked neural activity in the cochlea, cochlear nucleus (CN), inferior colliculus (IC), and AC before and after administering a high dose of sodium salicylate (SS, 300 mg/kg). The SS-treatment abolished low-level sound-evoked responses along the auditory pathway resulting in a 20-30 dB threshold shift. While the neural output of the cochlea was substantially reduced at high intensities, the neural responses in the CN were only slightly reduced; those in the IC were nearly normal or slightly enhanced while those in the AC considerably enhanced, indicative of a progress increase in central gain. The SS-induced increase in central response in the IC and AC was frequency-dependent with the greatest increase occurring in the mid-frequency range the putative pitch of SS-induced tinnitus. This frequency-dependent hyperactivity appeared to result from shifts in the frequency receptive fields (FRF) such that the response areas of many FRF shifted/expanded toward the mid-frequencies. Our results suggest that the SS-induced threshold shift originates in the cochlea. In contrast, enhanced central gain is not localized to one region, but progressively builds up at successively higher stage of the auditory pathway either through a loss of inhibition and/or increased excitation. Copyright © 2016. Published by

  20. Shift work-related health problems in

    Directory of Open Access Journals (Sweden)

    S. Khavaji

    2010-04-01

    Full Text Available Background and aimsShift work is a major feature of working life that affects diverse aspects of human life. The main purposes of this study were to investigate shift work-related health problems and their risk factors among workers of "12-hour shift" schedule.MethodsThis cross-sectional study was carried out at 8 petrochemical industries in Asalooyeh area. Study population consisted of 1203 workers including 549 shift worker (46% and 654 day worker (54%. Data on personal details, shift schedule and adverse effects of shift work werecollected by anonymous questionnaire. Statistical analyses were performed using SPSS, version 11.5. The level of significance was set at 5%.ResultsAlthough, the results showed that health problems among shift workers was more prevalent than day workers, but the differences were just significant in gastrointestinal and musculoskeletal disorders (p<0.05. Multiple linear regressions indicated that in addition to shift working, other variants such as long work hours, type of employment, second job, number of children and job title were associated with health problems.ConclusionPrevalence rates of gastrointestinal and musculoskeletal problems among shift workers were significantly higher than that of day workers. Although, working in shift system was the main significant factor associated with the reported problems, but other demographic andwork variables were also found to have association.

  1. Core shift effect in blazars

    Science.gov (United States)

    Agarwal, A.; Mohan, P.; Gupta, Alok C.; Mangalam, A.; Volvach, A. E.; Aller, M. F.; Aller, H. D.; Gu, M. F.; Lähteenmäki, A.; Tornikoski, M.; Volvach, L. N.

    2017-07-01

    We studied the pc-scale core shift effect using radio light curves for three blazars, S5 0716+714, 3C 279 and BL Lacertae, which were monitored at five frequencies (ν) between 4.8 and 36.8 GHz using the University of Michigan Radio Astronomical Observatory (UMRAO), the Crimean Astrophysical Observatory (CrAO) and Metsähovi Radio Observatory for over 40 yr. Flares were Gaussian fitted to derive time delays between observed frequencies for each flare (Δt), peak amplitude (A) and their half width. Using A ∝ να, we infer α in the range of -16.67-2.41 and using Δ t ∝ ν ^{1/k_r}, we infer kr ∼ 1, employed in the context of equipartition between magnetic and kinetic energy density for parameter estimation. From the estimated core position offset (Ωrν) and the core radius (rcore), we infer that opacity model may not be valid in all cases. The mean magnetic field strengths at 1 pc (B1) and at the core (Bcore) are in agreement with previous estimates. We apply the magnetically arrested disc model to estimate black hole spins in the range of 0.15-0.9 for these blazars, indicating that the model is consistent with expected accretion mode in such sources. The power-law-shaped power spectral density has slopes -1.3 to -2.3 and is interpreted in terms of multiple shocks or magnetic instabilities.

  2. Empirical isotropic chemical shift surfaces

    International Nuclear Information System (INIS)

    Czinki, Eszter; Csaszar, Attila G.

    2007-01-01

    A list of proteins is given for which spatial structures, with a resolution better than 2.5 A, are known from entries in the Protein Data Bank (PDB) and isotropic chemical shift (ICS) values are known from the RefDB database related to the Biological Magnetic Resonance Bank (BMRB) database. The structures chosen provide, with unknown uncertainties, dihedral angles φ and ψ characterizing the backbone structure of the residues. The joint use of experimental ICSs of the same residues within the proteins, again with mostly unknown uncertainties, and ab initio ICS(φ,ψ) surfaces obtained for the model peptides For-(l-Ala) n -NH 2 , with n = 1, 3, and 5, resulted in so-called empirical ICS(φ,ψ) surfaces for all major nuclei of the 20 naturally occurring α-amino acids. Out of the many empirical surfaces determined, it is the 13C α ICS(φ,ψ) surface which seems to be most promising for identifying major secondary structure types, α-helix, β-strand, left-handed helix (α D ), and polyproline-II. Detailed tests suggest that Ala is a good model for many naturally occurring α-amino acids. Two-dimensional empirical 13C α - 1 H α ICS(φ,ψ) correlation plots, obtained so far only from computations on small peptide models, suggest the utility of the experimental information contained therein and thus they should provide useful constraints for structure determinations of proteins

  3. Investigation and comparison of AC losses on stabilizer-free and copper stabilizer HTS tapes

    Science.gov (United States)

    Shen, Boyang; Li, Jing; Geng, Jianzhao; Fu, Lin; Zhang, Xiuchang; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Coombs, T. A.

    2017-10-01

    This paper presents the measurement and simulation of Alternating Current (AC) losses on the Stabilizer-free and Copper Stabilizer High Temperature Superconducting (HTS) Tapes: SuperPower SF12100 and SCS12050. The AC loss measurement utilised electrical method to obtain overall losses with AC transport currents. The 2D H-formulation by COMSOL Multiphysics has been used to simulate the real geometry and multi-layer HTS tapes. Ferromagnetic AC losses of substrate have been assumed to be ignored as the substrates of SF12100 and SCS12050 are non-magnetic. Hysteresis AC losses in the superconducting layer, and eddy-current AC losses in copper stabilizer, silver overlayer and substrate were concerned in this investigation. The measured AC losses were compared to the AC losses from simulation, with 3 cases of different AC frequency 10, 100, and 1000 Hz. The eddy-current AC losses of copper stabilizer at frequency 1000 Hz were determined from both experiment and simulation. The estimation of AC losses with frequency at 10,000 Hz was also carried out using simulation method. Finally, the frequency dependence of AC losses from Stabilizer-free Tape and Copper Stabilizer Tape were compared and analysed.

  4. A direct power conversion topology for grid integrations of hybrid AC/DC resources

    DEFF Research Database (Denmark)

    Liu, Xiong; Loh, Poh Chiang; Wang, Peng

    2012-01-01

    and modulation schemes are proposed to extract the commanded current from the input ac/dc sources to the grid and guarantee high quality ac/dc inputs and ac output current waveforms with unity power factors. The proposed modulation scheme for sinusoidal outputs of the VMC is mathematically proved...

  5. Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly

    International Nuclear Information System (INIS)

    Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production

  6. Challenges and solutions in medically managed ACS in the Asia-Pacific region: expert recommendations from the Asia-Pacific ACS Medical Management Working Group.

    Science.gov (United States)

    Huo, Yong; Thompson, Peter; Buddhari, Wacin; Ge, Junbo; Harding, Scott; Ramanathan, Letchuman; Reyes, Eugenio; Santoso, Anwar; Tam, Li-Wah; Vijayaraghavan, Govindan; Yeh, Hung-I

    2015-03-15

    Acute coronary syndromes (ACS) remain a leading cause of mortality and morbidity in the Asia-Pacific (APAC) region. International guidelines advocate invasive procedures in all but low-risk ACS patients; however, a high proportion of ACS patients in the APAC region receive solely medical management due to a combination of unique geographical, socioeconomic, and population-specific barriers. The APAC ACS Medical Management Working Group recently convened to discuss the ACS medical management landscape in the APAC region. Local and international ACS guidelines and the global and APAC clinical evidence-base for medical management of ACS were reviewed. Challenges in the provision of optimal care for these patients were identified and broadly categorized into issues related to (1) accessibility/systems of care, (2) risk stratification, (3) education, (4) optimization of pharmacotherapy, and (5) cost/affordability. While ACS guidelines clearly represent a valuable standard of care, the group concluded that these challenges can be best met by establishing cardiac networks and individual hospital models/clinical pathways taking into account local risk factors (including socioeconomic status), affordability and availability of pharmacotherapies/invasive facilities, and the nature of local healthcare systems. Potential solutions central to the optimization of ACS medical management in the APAC region are outlined with specific recommendations. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  7. FLOODPLAIN MAPPING, Starke COUNTY, IN

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...

  8. Pneumatic, PLC Controlled, Automotive Gear Shifting Mechanism

    OpenAIRE

    Muntaser Momani

    2010-01-01

    In this study, a gear shifting mechanism was designed and applied to make the shifting process faster and less destructible for the driver. The new device must be reliable, has a small dimensions, low construction and maintenance cost. This paper aims to improve gear shifting process using devices as: a manual four speed gear box, four pneumatic double acting cylinders, four pneumatic two position five ways directional control valves, Programmable Logic Controller (PLC) LOGO unit, an electric...

  9. Gas transmission : a paradigm shift

    International Nuclear Information System (INIS)

    Cornelson, D.W.

    1997-01-01

    The evolution of energy markets in North America was discussed. The investment opportunities that are possible in a deregulated energy market, be it in production or in the generation of energy commodities, in the development of midstream infrastructure, or in the provision of energy services, were outlined. Deregulation of crude oil, natural gas and electricity has resulted in significant changes in the structure of energy markets and the way in which customers are served. One of the advantages of competition regarding power generation is that it has turned energy into a commodity which has resulted in greater customer choice and efficiency. As one example of midstream infrastructure development, the Alliance Pipeline project was described. This project was conceived as a means to enhance the value of western Canadian natural gas. The 1,900 mile pipeline will run from British Columbia, through Alberta into Chicago where it will interconnect with the North American gas transmission grid. The pipeline is an efficient means of transporting energy from Western Canada to North American markets, and Alliance, as a lowest cost transporter, will continue to put pressure on the traditional infrastructure to become even more competitive at the margin. As such, Alliance represents a paradigm shift in energy transportation, and serves as an excellent example of the type of investment opportunity that a deregulated market can provide. It was suggested that innovation and competition in a deregulated North American energy market will continue to increase. As electricity is deregulated, the energy market will respond more quickly to changes in supply and demand than it did in the past, in an effort to satisfy the needs of investors and customers. This will provide increased opportunities for restructuring and further competition

  10. Shifting currents: Progress, setbacks, and shifts in policy and practice

    Science.gov (United States)

    ,; Dunning, Charles; Robertson, Dale M.

    2016-01-01

    clean water future. More than a decade has passed since our first statewide WOW conversation and the report that captured recommendations from its participants: Waters of Wisconsin: The Future of Our Aquatic Ecosystems and Resources. Drawing from a diverse and growing set of stakeholders from across the state, the Wisconsin Academy initiated a new conversation in 2012 (known as WOW II) to assess progress in regard to our 2003 recommendations. We also sought to review the status of waters in Wisconsin today. The result of this renewed conversation is Shifting Currents: Progress, Setbacks, and Shifts in Policy and Practice. The new report assesses progress in brief, and explores in greater depth the continuing and emerging challenges to water quality, supply, and aquatic ecosystems in Wisconsin.In this report, we first review the context and frameworks for public decision-making about water and then examine some of the root causes—or “drivers”—and ecological stressors that underlie many of the symptoms we see in the form of pollution or ecosystem degradation in Wisconsin. This is followed by a summary of current water issues, many of which had been identified in the 2003 report and remain relevant today. We examine progress since 2003 but also setbacks, and discuss issues that we are likely to continue to face in the coming decades, including controlling agricultural runoff, mitigating climate change and grappling with its effects on the state’s waters, protecting groundwater from bacterial contamination and other pollutants, and preventing groundwater depletion. We also attempt to anticipate issues on the horizon. We offer a deeper look at some particular challenges, such as phosphorus pollution and groundwater contamination. We then consider the current decision-making framework and how it is shaping our capacity to respond to water challenges in Wisconsin. Finally, we offer recommendations and identify opportunities to safeguard Wisconsin’s waters in the

  11. Phase-shifted response of plasmonic nanostructures

    DEFF Research Database (Denmark)

    Nerkararyan, Khachatur V.; Yezekyan, Torgom S.; Bozhevolnyi, Sergey I.

    2017-01-01

    We analyze the dynamics of a quantum dipole emitter (QDE) illuminated by a resonant electromagnetic field and placed close to a metal nanostructure, whose response to the incident field is phase shifted by 3π/2 (-π/2). It is found that, due to the phase shift in a field scattered by the nanostruc......We analyze the dynamics of a quantum dipole emitter (QDE) illuminated by a resonant electromagnetic field and placed close to a metal nanostructure, whose response to the incident field is phase shifted by 3π/2 (-π/2). It is found that, due to the phase shift in a field scattered...

  12. EXAFS Energy Shift and Structural Parameters

    International Nuclear Information System (INIS)

    Kelly, Shelly D.; Ravel, Bruce

    2007-01-01

    In EXAFS analysis, the energy shift parameter is used to align the theoretical calculated spectrum to the energy grid of the measured spectrum. Unrealistically large energy shift values, sometimes in excess of 20 eV, are at times published in research articles. We therefore see the need for a concise discussion of the EXAFS energy shift parameter. This paper is intended as a learning tool for the proper alignment of theory to measured EXAFS spectra and proper interpretation of the energy shift parameter

  13. Established and potential physiological roles of bicarbonatesensing soluble adenylyl cyclase (sAC) in aquatic animals

    OpenAIRE

    Tresguerres, M; Barott, KL; Barron, ME; Roa, JN

    2014-01-01

    Soluble adenylyl cyclase (sAC) is a recently recognized source of the signaling molecule cyclic AMP (cAMP) that is genetically and biochemically distinct from the classic G-protein-regulated transmembrane adenylyl cyclases (tmACs). Mammalian sAC is distributed throughout the cytoplasm and it may be present in the nucleus and inside mitochondria. sAC activity is directly stimulated by HCO 3 - , and sAC has been confirmed to be a HCO 3 - sensor in a variety of mammalian cell types. In addition...

  14. Working with the American Community Survey in R a guide to using the acs package

    CERN Document Server

    Glenn, Ezra Haber

    2016-01-01

    This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

  15. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  16. Method and apparatus for pulse width modulation control of an AC induction motor

    Science.gov (United States)

    Geppert, Steven (Inventor); Slicker, James M. (Inventor)

    1984-01-01

    An inverter is connected between a source of DC power and a three-phase AC induction motor, and a micro-processor-based circuit controls the inverter using pulse width modulation techniques. In the disclosed method of pulse width modulation, both edges of each pulse of a carrier pulse train are equally modulated by a time proportional to sin .THETA., where .THETA. is the angular displacement of the pulse center at the motor stator frequency from a fixed reference point on the carrier waveform. The carrier waveform frequency is a multiple of the motor stator frequency. The modulated pulse train is then applied to each of the motor phase inputs with respective phase shifts of 120.degree. at the stator frequency. Switching control commands of electronic switches in the inverter are stored in a random access memory (RAM) and the locations of the RAM are successively read out in a cyclic manner, each bit of a given RAM location controlling a respective phase input of the motor. The DC power source preferably comprises rechargeable batteries and all but one of the electronic switches in the inverter can be disabled, the remaining electronic switch being part of a flyback DC-DC converter circuit for recharging the battery.

  17. Method and apparatus for pulse width modulation control of an AC induction motor

    Science.gov (United States)

    Geppert, Steven; Slicker, James M.

    1984-01-01

    An inverter is connected between a source of DC power and a three-phase AC induction motor, and a micro-processor-based circuit controls the inverter using pulse width modulation techniques. In the disclosed method of pulse width modulation, both edges of each pulse of a carrier pulse train are equally modulated by a time proportional to sin .THETA., where .THETA. is the angular displacement of the pulse center at the motor stator frequency from a fixed reference point on the carrier waveform. The carrier waveform frequency is a multiple of the motor stator frequency. The modulated pulse train is then applied to each of the motor phase inputs with respective phase shifts of 120.degree. at the stator frequency. Switching control commands of electronic switches in the inverter are stored in a random access memory (RAM) and the locations of the RAM are successively read out in a cyclic manner, each bit of a given RAM location controlling a respective phase input of the motor. The DC power source preferably comprises rechargeable batteries and all but one of the electronic switches in the inverter can be disabled, the remaining electronic switch being part of a "flyback" DC-DC converter circuit for recharging the battery.

  18. Effects of extended work shifts and shift work on patient safety, productivity, and employee health.

    Science.gov (United States)

    Keller, Simone M

    2009-12-01

    It is estimated 1.3 million health care errors occur each year and of those errors 48,000 to 98,000 result in the deaths of patients (Barger et al., 2006). Errors occur for a variety of reasons, including the effects of extended work hours and shift work. The need for around-the-clock staff coverage has resulted in creative ways to maintain quality patient care, keep health care errors or adverse events to a minimum, and still meet the needs of the organization. One way organizations have attempted to alleviate staff shortages is to create extended work shifts. Instead of the standard 8-hour shift, workers are now working 10, 12, 16, or more hours to provide continuous patient care. Although literature does support these staffing patterns, it cannot be denied that shifts beyond the traditional 8 hours increase staff fatigue, health care errors, and adverse events and outcomes and decrease alertness and productivity. This article includes a review of current literature on shift work, the definition of shift work, error rates and adverse outcomes related to shift work, health effects on shift workers, shift work effects on older workers, recommended optimal shift length, positive and negative effects of shift work on the shift worker, hazards associated with driving after extended shifts, and implications for occupational health nurses. Copyright 2009, SLACK Incorporated.

  19. Residential Proximity to Major Roadways Is Associated With Increased Levels of AC133+ Circulating Angiogenic Cells.

    Science.gov (United States)

    DeJarnett, Natasha; Yeager, Ray; Conklin, Daniel J; Lee, Jongmin; O'Toole, Timothy E; McCracken, James; Abplanalp, Wes; Srivastava, Sanjay; Riggs, Daniel W; Hamzeh, Ihab; Wagner, Stephen; Chugh, Atul; DeFilippis, Andrew; Ciszewski, Tiffany; Wyatt, Brad; Becher, Carrie; Higdon, Deirdre; Ramos, Kenneth S; Tollerud, David J; Myers, John A; Rai, Shesh N; Shah, Jasmit; Zafar, Nagma; Krishnasamy, Sathya S; Prabhu, Sumanth D; Bhatnagar, Aruni

    2015-11-01

    Previous studies have shown that residential proximity to a roadway is associated with increased cardiovascular disease risk. Yet, the nature of this association remains unclear, and its effect on individual cardiovascular disease risk factors has not been assessed. The objective of this study was to determine whether residential proximity to roadways influences systemic inflammation and the levels of circulating angiogenic cells. In a cross-sectional study, cardiovascular disease risk factors, blood levels of C-reactive protein, and 15 antigenically defined circulating angiogenic cell populations were measured in participants (n=316) with moderate-to-high cardiovascular disease risk. Attributes of roadways surrounding residential locations were assessed using geographic information systems. Associations between road proximity and cardiovascular indices were analyzed using generalized linear models. Close proximity (proximity to a major roadway (CD31(+)/AC133(+), AC133(+), CD34(+)/AC133(+), and CD34(+)/45(dim)/AC133(+) cells) and positively associated with road segment distance (CD31(+)/AC133(+), AC133(+), and CD34(+)/AC133(+) cells), traffic intensity (CD31(+)/AC133(+) and AC133(+) cells), and distance-weighted traffic intensity (CD31(+)/34(+)/45(+)/AC133(+) cells). Living close to a major roadway is associated with elevated levels of circulating cells positive for the early stem marker AC133(+). This may reflect an increased need for vascular repair. Levels of these cells in peripheral blood may be a sensitive index of cardiovascular injury because of residential proximity to roadways. © 2015 American Heart Association, Inc.

  20. AC Power Local Network with Multiple Power Routers

    Directory of Open Access Journals (Sweden)

    Ryo Takahashi

    2013-12-01

    Full Text Available Controlling power flow and achieving appropriate matching between power sources and loads according to the quality of energy is expected to be one of the approaches to reduce wasted energy consumption. A power router, proposed recently, has the capability of realizing circuit switching in a power distribution network. This study focuses on the feasibility of an AC power routing network system composed of multiple power routers. To evaluate the feasibility, we experimentally confirm the circuit switching operation of the parallel and series configurations of the power routers, so that the network system can be designed by the combination of parallel and series configurations.