International Nuclear Information System (INIS)
Yoon, Tai Hyun
2007-01-01
We study analytically the dynamic cancellation of ac Stark shift in the recently proposed pulsed electromagnetically-induced-transparency (EIT-)Raman optical lattice clock based on the wave-function formalism. An explicit expression for the time evolution operator corresponding to the effective two-level interaction Hamiltonian has been obtained in order to explain the atomic phase shift cancellation due to the ac Stark shift induced by the time-separated laser pulses. We present how to determine an optimum value of the common detuning of the driving fields at which the atomic phase shift cancels completely with the parameters for the practical realization of the EIT-Raman optical lattice clock with alkaline-earth-metal atoms
International Nuclear Information System (INIS)
Bjorkholm, J.E.; Liao, P.F.H.
1977-01-01
Improved atomic beam deflection and improved isotope separation, even in vapors, is proposed by substituting the A.C. Stark effect for the baseband chirp of the pushing beam in the prior proposal by I. Nebenzahl et al., Applied Physics Letters, Vol. 25, page 327 (September 1974). The efficiency inherent in re-using the photons as in the Nebenzahl et al proposal is retained; but the external frequency chirpers are avoided. The entire process is performed by two pulses of monochromatic coherent light, thereby avoiding the complication of amplifying frequency-modulated light pulses. The A.C. Stark effect is provided by the second beam of coherent monochromatic light, which is sufficiently intense to chirp the energy levels of the atoms or isotopes of the atomic beam or vapor. Although, in general, the A.C. Stark effect will alter the isotope shift somewhat, it is not eliminated. In fact, the appropriate choice of frequencies of the pushing and chirping beams may even relax the requirements with respect to the isotope absorption line shift for effective separation. That is, it may make the isotope absorption lines more easily resolvable
Faraday-Shielded dc Stark-Shift-Free Optical Lattice Clock
Beloy, K.; Zhang, X.; McGrew, W. F.; Hinkley, N.; Yoon, T. H.; Nicolodi, D.; Fasano, R. J.; Schäffer, S. A.; Brown, R. C.; Ludlow, A. D.
2018-05-01
We demonstrate the absence of a dc Stark shift in an ytterbium optical lattice clock. Stray electric fields are suppressed through the introduction of an in-vacuum Faraday shield. Still, the effectiveness of the shielding must be experimentally assessed. Such diagnostics are accomplished by applying high voltage to six electrodes, which are grounded in normal operation to form part of the Faraday shield. Our measurements place a constraint on the dc Stark shift at the 10-20 level, in units of the clock frequency. Moreover, we discuss a potential source of error in strategies to precisely measure or cancel nonzero dc Stark shifts, attributed to field gradients coupled with the finite spatial extent of the lattice-trapped atoms. With this consideration, we find that Faraday shielding, complemented with experimental validation, provides both a practically appealing and effective solution to the problem of dc Stark shifts in optical lattice clocks.
Stark shift and g-factor tuning in nanowires with Rashba effect
International Nuclear Information System (INIS)
Alhaddad, Iman; Habanjar, Khulud; Sakr, M.R.
2015-01-01
We report on the Stark shift of the energy subbands and the possibility of tuning the g-factor of electrons in nanowires subjected to external magnetic field. The electric field is applied along the direction of quantum confinement. Our analysis is based on numerical and perturbation calculations in the weak Rashba regime. For in-plane magnetic fields, the Stark shift is rigid and depends on the square of the electric field. Such rigid shift results in a field independent g-factor. Perpendicular magnetic fields induce a similar Stark shift accompanied by a lateral displacement of the energy spectra that is linear in the electric field. In this case, the g-factor shows square dependence on weak electric fields that varies with the subband index. However, in strong electric fields, the g-factor becomes subband independent and varies linearly with the field. - Highlights: • Energy spectra of electrons in nanowires are calculated in the weak Rashba regime. • For in-plane magnetic field, the Stark shift is rigid and the g-factor cannot be tuned. • Perpendicular magnetic fields add lateral displacement to the Stark shift. • The g-factor can be tuned by external electric field in this case. • The tuning of the g-factor is linear and unique for all subbands at high fields
Stark shift and g-factor tuning in nanowires with Rashba effect
Energy Technology Data Exchange (ETDEWEB)
Alhaddad, Iman; Habanjar, Khulud [Department of Physics, Faculty of Science, Beirut Arab University, P.O. Box 11, 5020 Riad El Solh, 11072809 - Beirut (Lebanon); Sakr, M.R., E-mail: msakr@alexu.edu.eg [Department of Physics, Faculty of Science, Beirut Arab University, P.O. Box 11, 5020 Riad El Solh, 11072809 - Beirut (Lebanon); Department of Physics, Faculty of Science, Alexandria University, Moharram Bek, Alexandria 21511 (Egypt)
2015-10-15
We report on the Stark shift of the energy subbands and the possibility of tuning the g-factor of electrons in nanowires subjected to external magnetic field. The electric field is applied along the direction of quantum confinement. Our analysis is based on numerical and perturbation calculations in the weak Rashba regime. For in-plane magnetic fields, the Stark shift is rigid and depends on the square of the electric field. Such rigid shift results in a field independent g-factor. Perpendicular magnetic fields induce a similar Stark shift accompanied by a lateral displacement of the energy spectra that is linear in the electric field. In this case, the g-factor shows square dependence on weak electric fields that varies with the subband index. However, in strong electric fields, the g-factor becomes subband independent and varies linearly with the field. - Highlights: • Energy spectra of electrons in nanowires are calculated in the weak Rashba regime. • For in-plane magnetic field, the Stark shift is rigid and the g-factor cannot be tuned. • Perpendicular magnetic fields add lateral displacement to the Stark shift. • The g-factor can be tuned by external electric field in this case. • The tuning of the g-factor is linear and unique for all subbands at high fields.
Dynamic Stark shift and alignment-to-orientation conversion
International Nuclear Information System (INIS)
Kuntz, Matthew C.; Hilborn, Robert C.; Spencer, Alison M.
2002-01-01
We have observed alignment-to-orientation conversion in the (5d6p) 1 P state of atomic barium due to the combined effects of a static Zeeman shift and a dynamic Stark shift associated with the electric field of a pulsed laser beam. The measurements yield a value for the frequency-dependent tensor polarizability of the state in reasonable agreement with a simple perturbation theory calculation. With a tunable laser producing the dynamic Stark shift, we can both enhance the magnitude of the effect by tuning close to a resonance and reverse the sign of the orientation by tuning above or below the resonance. This method of producing an oriented atomic state is quite general, and with easily available field strengths can produce large orientations
Stark shift measurements of Xe II and Xe III spectral lines
International Nuclear Information System (INIS)
Cirisan, M; Pelaez, R J; Djurovic, S; Aparicio, J A; Mar, S
2007-01-01
Stark shift measurements of singly and doubly ionized Xe spectral lines are presented in this paper. Shifts of 110 Xe II lines and 42 Xe III lines are reported, including a significant number of new results. A low-pressure-pulsed arc with 95% of He and 5% of Xe was used as a plasma source. All measurements were performed under the following plasma conditions: electron density (0.2-1.4) x 10 23 m -3 and electron temperature 18 000-23 000 K. The measured Stark shifts are compared with other experimental and theoretical data
Modified dynamic Stark shift and depopulation rate of an atom inside a Kerr nonlinear blackbody
International Nuclear Information System (INIS)
Yin Miao; Cheng Ze
2009-01-01
We investigate the dynamic Stark shift and atomic depopulation rate induced by real photons in a Kerr nonlinear blackbody. We found that the dynamic Stark shift and atomic depopulation rate are equally modified by a nonlinear contribution factor and a linear contribution factor under a transition temperature T c . The nonlinear contribution factor depends on the Kerr nonlinear coefficient as well as the absolute temperature. Below T c , the absolute values of the dynamic Stark shift and depopulation rate of a single atomic state (not the ground state) are correspondingly larger than those in a normal blackbody whose interior is filled with a nonabsorbing linear medium. Above T c , the dynamic Stark shift and atomic depopulation rate are correspondingly equal to those in a normal blackbody with a nonabsorbing linear medium in its interior.
Stark-shift induced resonances in multiphoton ionization
International Nuclear Information System (INIS)
Potvliege, R M; Vuci, Svetlana
2006-01-01
The resonance enhancements marking the ATI spectrum of argon are discussed in the light of a recently compiled map of the quasienergies of this atom. Many of the dressed excited states of interest shift nonponderomotively in complicated ways, but keep an ionization width narrow enough to produce sharp substructures of both low and high ATI peaks through Stark-shift induced resonances. The most prominent enhancement observed in the high-order ATI peaks originates from ionization from the dressed ground state perturbed by the influence of neighbouring resonant dressed states
Dimitrijevic, M. S.; Tankosic, D.
1998-04-01
In order to find out if regularities and systematic trends found to be apparent among experimental Stark line shifts allow the accurate interpolation of new data and critical evaluation of experimental results, the exceptions to the established regularities are analysed on the basis of critical reviews of experimental data, and reasons for such exceptions are discussed. We found that such exceptions are mostly due to the situations when: (i) the energy gap between atomic energy levels within a supermultiplet is equal or comparable to the energy gap to the nearest perturbing levels; (ii) the most important perturbing level is embedded between the energy levels of the supermultiplet; (iii) the forbidden transitions have influence on Stark line shifts.
Guo, Zhi; Lin, Su; Woodbury, Neal W
2013-09-26
In photosynthetic reaction centers, the electric field generated by light-induced charge separation produces electrochromic shifts in the transitions of reaction center pigments. The extent of this Stark shift indirectly reflects the effective field strength at a particular cofactor in the complex. The dynamics of the effective field strength near the two monomeric bacteriochlorophylls (BA and BB) in purple photosynthetic bacterial reaction centers has been explored near physiological temperature by monitoring the time-dependent Stark shift during charge separation (dynamic Stark shift). This dynamic Stark shift was determined through analysis of femtosecond time-resolved absorbance change spectra recorded in wild type reaction centers and in four mutants at position M210. In both wild type and the mutants, the kinetics of the dynamic Stark shift differ from those of electron transfer, though not in the same way. In wild type, the initial electron transfer and the increase in the effective field strength near the active-side monomer bacteriochlorophyll (BA) occur in synchrony, but the two signals diverge on the time scale of electron transfer to the quinone. In contrast, when tyrosine is replaced by aspartic acid at M210, the kinetics of the BA Stark shift and the initial electron transfer differ, but transfer to the quinone coincides with the decay of the Stark shift. This is interpreted in terms of differences in the dynamics of the local dielectric environment between the mutants and the wild type. In wild type, comparison of the Stark shifts associated with BA and BB on the two quasi-symmetric halves of the reaction center structure confirm that the effective dielectric constants near these cofactors are quite different when the reaction center is in the state P(+)QA(-), as previously determined by Steffen et al. at 1.5 K (Steffen, M. A.; et al. Science 1994, 264, 810-816). However, it is not possible to determine from static, low-temperature measurments if the
Properties of Linear Entropy in k-Photon Jaynes-Cummings Model with Stark Shift and Kerr-Like Medium
International Nuclear Information System (INIS)
Liao Qinghong; Wang Yueyuan; Liu Shutian; Ahmad, Muhammad Ashfaq
2010-01-01
The time evolution of the linear entropy of an atom in k-photon Jaynes-Cummings model is investigated taking into consideration Stark shift and Kerr-like medium. The effect of both the Stark shift and Kerr-like medium on the linear entropy is analyzed using a numerical technique for the field initially in coherent state and in even coherent state. The results show that the presence of the Kerr-like medium and Stark shift has an important effect on the properties of the entropy and entanglement. It is also shown that the setting of the initial state plays a significant role in the evolution of the linear entropy and entanglement. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
The AC Stark Effect, Time-Dependent Born-Oppenheimer Approximation, and Franck-Condon Factors
Hagedorn, G A; Jilcott, S W
2005-01-01
We study the quantum mechanics of a simple molecular system that is subject to a laser pulse. We model the laser pulse by a classical oscillatory electric field, and we employ the Born--Oppenheimer approximation for the molecule. We compute transition amplitudes to leading order in the laser strength. These amplitudes contain Franck--Condon factors that we compute explicitly to leading order in the Born--Oppenheimer parameter. We also correct an erroneous calculation in the mathematical literature on the AC Stark effect for molecular systems.
Influence of the ac Stark effect on stimulated hyper-Raman profiles in sodium vapor
International Nuclear Information System (INIS)
Moore, M.A.; Garrett, W.R.; Payne, M.G.
1988-08-01
When pumping near the two-photon 3d resonance in pure sodium vapor and observing the backward hyper-Raman emission to the 3p substates, an asymmetry in ratios of 3p/sub 1/2/, 3p/sub 3/2/ associated emissions was observed dependent upon the direction of the initial laser detuning from the resonance. It has been determined that this asymmetry can be attributed to the ac Stark effect induced by the hyper-Raman emission itself. 3 refs., 3 figs
Shi, L.; Yan, Z. W.
2018-04-01
Within the framework of the effective-mass approximation and by using a variational method, the Stark shift of on-center and off-center donor impurity binding energies and photoionization cross section under a z-direction electric field in a prolate (oblate) core/shell ellipsoidal quantum dot has been studied. We have calculated the Stark shift as a function of the core and shell sizes and shapes, electric field, and impurity position. We also discuss the photoionization cross section as a function of photon energy with different core and shell sizes and shapes, electric field strengths, and impurity positions. The results show that the Stark shift depends strongly on the impurity position, it could be positive or negative. The core and shell sizes and shapes also have a pronounce influence on the Stark shift, and the Stark shift changes with them is non-monotonic, especially when the impurity is located at the -z-axis, the situation will become complicated. In addition, the core and shell sizes and shapes, impurity position, and electric field also have an important influence on the photoionization cross section. In particular, the photoionization cross section will vanish when the impurity is located at center of spherical core with spherical or prolate shell case at zero field.
Wang, Xianwei; Zhang, John Z H; He, Xiao
2015-11-14
Recent advance in biophysics has made it possible to directly measure site-specific electric field at internal sites of proteins using molecular probes with C = O or C≡N groups in the context of vibrational Stark effect. These measurements directly probe changes of electric field at specific protein sites due to, e.g., mutation and are very useful in protein design. Computational simulation of the Stark effect based on force fields such as AMBER and OPLS, while providing good insight, shows large errors in comparison to experimental measurement due to inherent difficulties associated with point charge based representation of force fields. In this study, quantum mechanical calculation of protein's internal electrostatic properties and vibrational Stark shifts was carried out by using electrostatically embedded generalized molecular fractionation with conjugate caps method. Quantum calculated change of mutation-induced electric field and vibrational Stark shift is reported at the internal probing site of enzyme human aldose reductase. The quantum result is in much better agreement with experimental data than those predicted by force fields, underscoring the deficiency of traditional point charge models describing intra-protein electrostatic properties.
Energy Technology Data Exchange (ETDEWEB)
Wang, Xianwei [Center for Optics and Optoelectronics Research, College of Science, Zhejiang University of Technology, Hangzhou, Zhejiang 310023 (China); State Key Laboratory of Precision Spectroscopy, Institute of Theoretical and Computational Science, East China Normal University, Shanghai 200062 (China); Zhang, John Z. H.; He, Xiao, E-mail: xiaohe@phy.ecnu.edu.cn [State Key Laboratory of Precision Spectroscopy, Institute of Theoretical and Computational Science, East China Normal University, Shanghai 200062 (China); NYU-ECNU Center for Computational Chemistry at NYU Shanghai, Shanghai 200062 (China)
2015-11-14
Recent advance in biophysics has made it possible to directly measure site-specific electric field at internal sites of proteins using molecular probes with C = O or C≡N groups in the context of vibrational Stark effect. These measurements directly probe changes of electric field at specific protein sites due to, e.g., mutation and are very useful in protein design. Computational simulation of the Stark effect based on force fields such as AMBER and OPLS, while providing good insight, shows large errors in comparison to experimental measurement due to inherent difficulties associated with point charge based representation of force fields. In this study, quantum mechanical calculation of protein’s internal electrostatic properties and vibrational Stark shifts was carried out by using electrostatically embedded generalized molecular fractionation with conjugate caps method. Quantum calculated change of mutation-induced electric field and vibrational Stark shift is reported at the internal probing site of enzyme human aldose reductase. The quantum result is in much better agreement with experimental data than those predicted by force fields, underscoring the deficiency of traditional point charge models describing intra-protein electrostatic properties.
Quantum logic gates using Stark-shifted Raman transitions in a cavity
International Nuclear Information System (INIS)
Biswas, Asoka; Agarwal, G.S.
2004-01-01
We present a scheme to realize the basic two-qubit logic gates such as the quantum phase gate and the controlled-NOT gate using a detuned optical cavity interacting with a three-level Raman system. We discuss the role of Stark shifts, which are as important as the terms leading to the two-photon transition. The operation of the proposed logic gates involves metastable states of the atom and hence is not affected by spontaneous emission. These ideas can be extended to produce multiparticle entanglement
A study of the ac Stark effect in doped photonic crystals
Energy Technology Data Exchange (ETDEWEB)
Haque, I; Singh, Mahi R [Department of Physics and Astronomy, University of Western Ontario, London, ON, N6A 3K7 (Canada)
2007-04-16
In this paper we present calculations of level populations and susceptibility for an ensemble of five-level atoms doped in a photonic crystal, using the master equation method. The atoms in the ensemble interact with the crystal which acts as a reservoir and are coupled with two strong pump fields and a weak probe field. It is found that, by manipulating the resonance energy associated with one of the decay channels of the atom, the system can be switched between an inverted and a non-inverted state. We have also observed the ac Stark effect in these atoms and have shown that due to the role played by the band structure of the photonic crystal, it is possible to switch between an absorption state and a non-absorption state of the atomic system. This is a very important finding as techniques of rendering material systems transparent to resonant laser radiation are very desirable in the fabrication of novel optical and photonic devices.
Valley-selective optical Stark effect probed by Kerr rotation
LaMountain, Trevor; Bergeron, Hadallia; Balla, Itamar; Stanev, Teodor K.; Hersam, Mark C.; Stern, Nathaniel P.
2018-01-01
The ability to monitor and control distinct states is at the heart of emerging quantum technologies. The valley pseudospin in transition metal dichalcogenide (TMDC) monolayers is a promising degree of freedom for such control, with the optical Stark effect allowing for valley-selective manipulation of energy levels in WS2 and WSe2 using ultrafast optical pulses. Despite these advances, understanding of valley-sensitive optical Stark shifts in TMDCs has been limited by reflectance-based detection methods where the signal is small and prone to background effects. More sensitive polarization-based spectroscopy is required to better probe ultrafast Stark shifts for all-optical manipulation of valley energy levels. Here, we show time-resolved Kerr rotation to be a more sensitive probe of the valley-selective optical Stark effect in monolayer TMDCs. Compared to the established time-resolved reflectance methods, Kerr rotation is less sensitive to background effects. Kerr rotation provides a fivefold improvement in the signal-to-noise ratio of the Stark effect optical signal and a more precise estimate of the energy shift. This increased sensitivity allows for observation of an optical Stark shift in monolayer MoS2 that exhibits both valley and energy selectivity, demonstrating the promise of this method for investigating this effect in other layered materials and heterostructures.
Stark shifting two-electron quantum dot
International Nuclear Information System (INIS)
Dineykhan, M.; Zhaugasheva, S.A.; Duysebaeva, K.S.
2003-01-01
Advances in modern technology make it possible to create semiconducting nano-structures (quantum dot) in which a finite number of electrons are 'captured' in a bounded volume. A quantum dot is associated with a quantum well formed at the interface, between two finite-size semiconductors owing to different positions of the forbidden gaps on the energy scale in these semiconductors. The possibility of monitoring and controlling the properties of quantum dots attracts considerable attention to these objects, as a new elemental basis for future generations of computers. The quantum-mechanical effects and image potential play a significant role in the description of the formation mechanism quantum dot, and determined the confinement potential in a two-electron quantum dot only for the spherical symmetric case. In the present talk, we considered the formation dynamics of two-electron quantum dot with violation of spherical symmetry. So, we have standard Stark potential. The energy spectrum two-electron quantum dot were calculated. Usually Stark interactions determined the tunneling phenomena between quantum dots
Stark shift of impurity doped quantum dots: Role of noise
Arif, Sk. Md.; Bera, Aindrila; Ghosh, Anuja; Ghosh, Manas
2018-02-01
Present study makes a punctilious investigation of the profiles of Stark shift (SS) of doped GaAs quantum dot (QD) under the supervision of Gaussian white noise. A few physical parameters have been varied and the consequent variations in the SS profiles have been monitored. The said physical parameters comprise of magnetic field, confinement potential, dopant location, dopant potential, noise strength, aluminium concentration (only for AlxGa1-x As alloy QD), position-dependent effective mass (PDEM), position-dependent dielectric screening function (PDDSF), anisotropy, hydrostatic pressure (HP) and temperature. The SS profiles unfurl interesting features that heavily depend upon the particular physical quantity concerned, presence/absence of noise and the manner (additive/multiplicative) noise enters the system. The study highlights feasible means of maximizing SS of doped QD in presence of noise by suitable adjustment of several control parameters. The study deems importance in view of technological applications of QD devices where noise plays some prominent role.
The stark effect in intense field. 2
International Nuclear Information System (INIS)
Popov, V.S.; Mur, V.D.; Sergeev, A.V.; Weinberg, V.M.
1987-01-01
The problem of hydrogen atom in homogeneous electric field is considered. The Stark shifts and widths of atomic levels are computed by summation of divergent perturbation series and by 1/n-expansion - up to E values comparable with the field on the electron orbit. The results of the calculations are presented for the following sequences of states: |n 1 ,0,0>, |0,n 2 ,0>, |n 1 ,n 1 ,0>, as well as for all states with n=2 and 3 (n is the principal quantum number). The Stark shifts and widths of Rydberg states (with n=15-30) in electric field which exceeds the classical ionization threshold are computed. The results of our calculations agree with experiment
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
Electroreflectance investigations of quantum confined Stark effect in GaN quantum wells
International Nuclear Information System (INIS)
Drabinska, A; Pakula, K; Baranowski, J M; Wysmolek, A
2010-01-01
In this paper we present room temperature electroreflectance studies of GaN quantum wells (QWs) with different well width. The electroreflectance measurements were performed with external voltage applied to the structure therefore it was possible to tune the electric field inside QW up to its completely screening and furthermore even reversing it. The analysis of QW spectral lines showed the Stark shift dependence on applied voltage and well width reaching about 35 meV for highest voltage and widest well width. It was possible to obtain the condition of zero electric field in QW. Both broadening and amplitude of QW lines are minimal for zero electric field and increases for increasing electric field in QW. The energy transition is maximum for zero electric field and for increasing electric field it decreases due to Stark effect. Neither amplitude and broadening parameter nor energy transition does not depend on the direction of electric field. Only parameter that depends on the direction of electric field in QW is phase of the signal. The analysis of Franz-Keldysh oscillations (FKOs) from AlGaN barriers allowed to calculate the real electric field dependence on applied voltage and therefore to obtain the Stark shift dependence on electric field. The Stark shift reached from -12 meV to -35 meV for 450 kV/cm depending on the well width. This conditions were established for highest forward voltages therefore this is the value of electric field and Stark shift caused only by the intrinsic polarization of nitrides.
Slocum, Joshua D; First, Jeremy T; Webb, Lauren J
2017-07-20
Measurement of the magnitude, direction, and functional importance of electric fields in biomolecules has been a long-standing experimental challenge. pK a shifts of titratable residues have been the most widely implemented measurements of the local electrostatic environment around the labile proton, and experimental data sets of pK a shifts in a variety of systems have been used to test and refine computational prediction capabilities of protein electrostatic fields. A more direct and increasingly popular technique to measure electric fields in proteins is Stark effect spectroscopy, where the change in absorption energy of a chromophore relative to a reference state is related to the change in electric field felt by the chromophore. While there are merits to both of these methods and they are both reporters of local electrostatic environment, they are fundamentally different measurements, and to our knowledge there has been no direct comparison of these two approaches in a single protein. We have recently demonstrated that green fluorescent protein (GFP) is an ideal model system for measuring changes in electric fields in a protein interior caused by amino acid mutations using both electronic and vibrational Stark effect chromophores. Here we report the changes in pK a of the GFP fluorophore in response to the same mutations and show that they are in excellent agreement with Stark effect measurements. This agreement in the results of orthogonal experiments reinforces our confidence in the experimental results of both Stark effect and pK a measurements and provides an excellent target data set to benchmark diverse protein electrostatics calculations. We used this experimental data set to test the pK a prediction ability of the adaptive Poisson-Boltzmann solver (APBS) and found that a simple continuum dielectric model of the GFP interior is insufficient to accurately capture the measured pK a and Stark effect shifts. We discuss some of the limitations of this
Institute of Scientific and Technical Information of China (English)
S.Abdel-Khalek; M.M.A.Ahmed; A-S F.Obada
2011-01-01
We present an effective two-level system in interaction through two-photon processes with a single mode quantized electromagnetic field,initially prepared in a coherent state.Field entropy squeezing as an indicator of the entanglement in a mixed state system is suggested.The temporal evolution of the negativity,Wehrl entropy,Wehrl phase distribution and field entropy squeezing are investigated.The results highlight the important roles played by both the Stark shift parameters and the mixed state setting in the dynamics of the Wehrl entropy,Wehrl phase distribution and field entropy squeezing.%We present an effective two-level system in interaction through two-photon processes with a single mode quantized electromagnetic Reid, initially prepared in a coherent state. Field entropy squeezing as an indicator of the entanglement in a mixed state system is suggested. The temporal evolution of the negativity, Wehrl entropy, Wehrl phase distribution and field entropy squeezing are investigated. The results highlight the important roles played by both the Stark shift parameters and the mixed state setting in the dynamics of the Wehrl entropy, Wehrl phase distribution and field entropy squeezing.
International Nuclear Information System (INIS)
List, Nanna Holmgaard; Jensen, Hans Jørgen Aagaard; Kongsted, Jacob; Beerepoot, Maarten T. P.; Gao, Bin; Ruud, Kenneth; Olsen, Jógvan Magnus Haugaard
2015-01-01
We present an implementation of analytical quantum mechanical molecular gradients within the polarizable embedding (PE) model to allow for efficient geometry optimizations and vibrational analysis of molecules embedded in large, geometrically frozen environments. We consider a variational ansatz for the quantum region, covering (multiconfigurational) self-consistent-field and Kohn–Sham density functional theory. As the first application of the implementation, we consider the internal vibrational Stark effect of the C=O group of acetophenone in different solvents and derive its vibrational linear Stark tuning rate using harmonic frequencies calculated from analytical gradients and computed local electric fields. Comparisons to PE calculations employing an enlarged quantum region as well as to a non-polarizable embedding scheme show that the inclusion of mutual polarization between acetophenone and water is essential in order to capture the structural modifications and the associated frequency shifts observed in water. For more apolar solvents, a proper description of dispersion and exchange–repulsion becomes increasingly important, and the quality of the optimized structures relies to a larger extent on the quality of the Lennard-Jones parameters
Energy Technology Data Exchange (ETDEWEB)
List, Nanna Holmgaard, E-mail: nhl@sdu.dk; Jensen, Hans Jørgen Aagaard; Kongsted, Jacob [Department of Physics, Chemistry and Pharmacy, University of Southern Denmark, Campusvej 55, Odense M, Odense DK-5230 Denmark (Denmark); Beerepoot, Maarten T. P.; Gao, Bin; Ruud, Kenneth [Centre for Theoretical and Computational Chemistry, Department of Chemistry, University of Tromsø–The Arctic University of Norway, N-9037 Tromsø (Norway); Olsen, Jógvan Magnus Haugaard [Department of Physics, Chemistry and Pharmacy, University of Southern Denmark, Campusvej 55, Odense M, Odense DK-5230 Denmark (Denmark); Laboratory of Computational Chemistry and Biochemistry, Ecole Polytechnique Fédérale de Lausanne, CH-1015 Lausanne (Switzerland)
2015-01-21
We present an implementation of analytical quantum mechanical molecular gradients within the polarizable embedding (PE) model to allow for efficient geometry optimizations and vibrational analysis of molecules embedded in large, geometrically frozen environments. We consider a variational ansatz for the quantum region, covering (multiconfigurational) self-consistent-field and Kohn–Sham density functional theory. As the first application of the implementation, we consider the internal vibrational Stark effect of the C=O group of acetophenone in different solvents and derive its vibrational linear Stark tuning rate using harmonic frequencies calculated from analytical gradients and computed local electric fields. Comparisons to PE calculations employing an enlarged quantum region as well as to a non-polarizable embedding scheme show that the inclusion of mutual polarization between acetophenone and water is essential in order to capture the structural modifications and the associated frequency shifts observed in water. For more apolar solvents, a proper description of dispersion and exchange–repulsion becomes increasingly important, and the quality of the optimized structures relies to a larger extent on the quality of the Lennard-Jones parameters.
Stark shifts and widths of a hydrogen atom in Debye plasmas
International Nuclear Information System (INIS)
Yu, A.C.H.; Ho, Y.K.
2005-01-01
A computational scheme has been developed and used to investigate the influence of the plasma environments on modified atomic autoionization for isolated atoms/ions by using the complex coordinate rotation method which is proved to be a very simple and powerful tool to analyze the position and the width of a resonance. The Debye screening potential is employed to describe the effects of the plasma environments. Stark shifts and widths on the ground state of hydrogen are reported for field strength up to F=0.12 a.u. Slater-type basis wave functions are used to describe the system and angular-momentum states up to L=11 are included when the external electric field is turned on. Converged results are obtained by using different maximum angular-momentum states. The modified autoionization for various Debye lengths ranging from infinite to a small value of 0.86 are reported. It has been observed that for a given temperature and under the influence of a given external electric field, the resonance energy and the autoionization width increase for increasing electron density in the plasma. A discussion on the physical implication of our results is made
Stark broadening of hydrogen (1961); Sur l'effet stark dans les plasmas d'hydrogene (1961)
Energy Technology Data Exchange (ETDEWEB)
Fidone, I [Association Euratom-CEA Cadarache, 13 - Saint-Paul-lez-Durance (France)
1961-07-01
The effect of electron impacts on the Stark broadening of hydrogen atoms has been considered using a Debye-Huckel potential instead of a cut-off limit for the integrals giving the shift and the half-width. A slight difference results which in a typical case is of the order of 12 - 15 per cent. The simple adiabatic impact approximation has been used. (author) [French] L'effet des chocs electroniques sur l'elargissement Stark des raies d'hydrogene est calcule avec le potentiel de Debye-Huckel au lieu de l'emploi du cut-off pour les integrales qui donnent le deplacement et l'elargissement de la raie. On obtient une faible difference qui, dans un cas typique, est de l'ordre de grandeur de 12 - 15 pour cent. L'approximation adiabatique a ete employee pour decrire les chocs. (auteur)
Stark effect in finite-barrier quantum wells, wires, and dots
International Nuclear Information System (INIS)
Pedersen, Thomas Garm
2017-01-01
The properties of confined carriers in low-dimensional nanostructures can be controlled by external electric fields and an important manifestation is the Stark shift of quantized energy levels. Here, a unifying analytic theory for the Stark effect in arbitrary dimensional nanostructures is presented. The crucial role of finite potential barriers is stressed, in particular, for three-dimensional confinement. Applying the theory to CdSe quantum dots, finite barriers are shown to improve significantly the agreement with experiments. (paper)
International Nuclear Information System (INIS)
Dietrich, H.; Mueller-Dethlefs, K.; Baranov, L.Y.
1996-01-01
For the first time fractional Stark state selective electric field ionization of very high-n (n approx-gt 250) molecular Rydberg states is observed. An open-quote open-quote offset close-quote close-quote electric pulse selectively ionizes the more fragile open-quote open-quote red close-quote close-quote (down shifted in energy) Stark states. The more resilient open-quote open-quote bluer close-quote close-quote, or up-shifted, ones survive and are shifted down in energy upon application of a second (open-quote open-quote probe close-quote close-quote) pulse of opposite direction (diabatic Stark states close-quote inversion). Hence, even for smaller probe than offset fields ionization is observed. The offset/probe ratio allows one to control spectral peak shapes in zero-kinetic-energy photoelectron spectroscopy. copyright 1995 The American Physical Society
Stark effect and polarizability of graphene quantum dots
DEFF Research Database (Denmark)
Pedersen, Thomas Garm
2017-01-01
The properties of graphene quantum dots can be manipulated via lateral electric fields. Treating electrons in such structures as confined massless Dirac fermions, we derive an analytical expression for the quadratic Stark shift valid for arbitrary angular momentum and quantum dot size. Moreover, we...
Regularities And Irregularities Of The Stark Parameters For Single Ionized Noble Gases
Peláez, R. J.; Djurovic, S.; Cirišan, M.; Aparicio, J. A.; Mar S.
2010-07-01
Spectroscopy of ionized noble gases has a great importance for the laboratory and astrophysical plasmas. Generally, spectra of inert gases are important for many physics areas, for example laser physics, fusion diagnostics, photoelectron spectroscopy, collision physics, astrophysics etc. Stark halfwidths as well as shifts of spectral lines are usually employed for plasma diagnostic purposes. For example atomic data of argon krypton and xenon will be useful for the spectral diagnostic of ITER. In addition, the software used for stellar atmosphere simulation like TMAP, and SMART require a large amount of atomic and spectroscopic data. Availability of these parameters will be useful for a further development of stellar atmosphere and evolution models. Stark parameters data of spectral lines can also be useful for verification of theoretical calculations and investigation of regularities and systematic trends of these parameters within a multiplet, supermultiplet or transition array. In the last years, different trends and regularities of Stark parameters (halwidths and shifts of spectral lines) have been analyzed. The conditions related with atomic structure of the element as well as plasma conditions are responsible for regular or irregular behaviors of the Stark parameters. The absence of very close perturbing levels makes Ne II as a good candidate for analysis of the regularities. Other two considered elements Kr II and Xe II with complex spectra present strong perturbations and in some cases an irregularities in Stark parameters appear. In this work we analyze the influence of the perturbations to Stark parameters within the multiplets.
Implementing Deutsch-Jozsa algorithm using light shifts and atomic ensembles
International Nuclear Information System (INIS)
Dasgupta, Shubhrangshu; Biswas, Asoka; Agarwal, G.S.
2005-01-01
We present an optical scheme to implement the Deutsch-Jozsa algorithm using ac Stark shifts. The scheme uses an atomic ensemble consisting of four-level atoms interacting dispersively with a field. This leads to a Hamiltonian in the atom-field basis which is quite suitable for quantum computation. We show how one can implement the algorithm by performing proper one- and two-qubit operations. We emphasize that in our model the decoherence is expected to be minimal due to our usage of atomic ground states and freely propagating photon
Sahal-Bréchot, S.; Dimitrijević, M. S.; Moreau, N.; Ben Nessib, N.
2015-05-01
Accurate spectroscopic diagnostics and modeling require the knowledge of numerous collisional line profiles. Access to such data via an online database has become indispensable. The STARK-B database is aimed at meeting these needs for widths and shifts of isolated lines of neutral and ionized elements due to electron and ion impacts. This database of the Paris Observatory is a result of scientific cooperation between S Sahal-Bréchot (LERMA) and M S Dimitrijević (AOB). Access to it is free, and it was opened online at the end of 2008. STARK-B is a node of the Virtual Atomic and Molecular Data Centre (VAMDC) and thus complies with VAMDC and Virtual Observatory standards. VAMDC is a European Union-funded collaboration among groups involved in the generation and use of interoperable atomic and molecular data. STARK-B now contains all our semiclassical-perturbation (SCP) calculated data for more than 123 neutral or ionized elements as published in international refereed journals. It is devoted to modeling and spectroscopic diagnostics of stellar atmospheres and envelopes, laboratory plasmas, laser equipment, and technological plasmas. Hence, the range of temperatures and densities covered by the tables is broad and depends on the ionization degree of the radiating atom. The modified semiempirical (MSE) results of calculations have begun to be implemented. In this paper, we highlight the key points of the method and the assumptions used in the calculations, which have lately been revisited. Then we present the database and its recent developments, as well as our ongoing work and our plans for the future.
International Nuclear Information System (INIS)
Sahal-Bréchot, S; Moreau, N; Dimitrijević, M S; Nessib, N Ben
2015-01-01
Accurate spectroscopic diagnostics and modeling require the knowledge of numerous collisional line profiles. Access to such data via an online database has become indispensable. The STARK-B database is aimed at meeting these needs for widths and shifts of isolated lines of neutral and ionized elements due to electron and ion impacts. This database of the Paris Observatory is a result of scientific cooperation between S Sahal-Bréchot (LERMA) and M S Dimitrijević (AOB). Access to it is free, and it was opened online at the end of 2008. STARK-B is a node of the Virtual Atomic and Molecular Data Centre (VAMDC) and thus complies with VAMDC and Virtual Observatory standards. VAMDC is a European Union-funded collaboration among groups involved in the generation and use of interoperable atomic and molecular data. STARK-B now contains all our semiclassical-perturbation (SCP) calculated data for more than 123 neutral or ionized elements as published in international refereed journals. It is devoted to modeling and spectroscopic diagnostics of stellar atmospheres and envelopes, laboratory plasmas, laser equipment, and technological plasmas. Hence, the range of temperatures and densities covered by the tables is broad and depends on the ionization degree of the radiating atom. The modified semiempirical (MSE) results of calculations have begun to be implemented. In this paper, we highlight the key points of the method and the assumptions used in the calculations, which have lately been revisited. Then we present the database and its recent developments, as well as our ongoing work and our plans for the future. (paper)
Rydberg State Stark Spectroscopy and Applications to Plasma Diagnostics
1990-03-01
Bayfield47 provides an excellent review of the AC Stark effect, in which the primary effect is Rabi splitting. Several authors48 , 49, 50 have...purity of the spectrum indicates that the field present is dominantly anisotropic . 53 n:26NEON LINE n=35 0 n= 40 p.- n=45 IL 0 31975 31950 31925 31900...applied (axial) electric field which is anisotropic , so pure polarization spectra can be recorded. The intensity profile of the Am = 0 polarization is
DEFF Research Database (Denmark)
List, Nanna Holmgaard; Beerepoot, Maarten; Olsen, Jógvan Magnus Haugaard
2015-01-01
for the quantum region, covering (multiconfigurational) self-consistent-field and Kohn–Sham density functional theory. As the first application of the implementation, we consider the internal vibrational Stark effect of the C=O group of acetophenone in different solvents and derive its vibrational linear Stark...
Quantum-Confined Stark Effect in Ensemble of Colloidal Semiconductor Quantum Dots
International Nuclear Information System (INIS)
Zhi-Bing, Wang; Hui-Chao, Zhang; Jia-Yu, Zhang; Su, Huaipeng; Wang, Y. Andrew
2010-01-01
The presence of a strong, changing, randomly-oriented, local electric field, which is induced by the photo-ionization that occurs universally in colloidal semiconductor quantum dots (QDs), makes it difficult to observe the quantum-confined Stark effect in ensemble of colloidal QDs. We propose a way to inhibit such a random electric field, and a clear quantum-confined Stark shift is observed directly in close-packed colloidal QDs. Besides the applications in optical switches and modulators, our experimental results indicate how the oscillator strengths of the optical transitions are changed under external electric fields. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
AC system stabilization via phase shift transformer with thyristor commutation
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Jose Carlos de; Guimaraes, Geraldo Caixeta; Moraes, Adelio Jose [Uberlandia Univ., MG (Brazil); Abreu, Jose Policarpo G. de [Escola Federal de Engenharia de Itajuba, MG (Brazil); Oliveira, Edimar Jose de [Juiz de Fora Univ., MG (Brazil)
1994-12-31
This article aims to present initially the constructive and operative forms of a phase-shift autotransformer which provides both magnitude and phase angle change through thyristor commutation, including a technic to reduce the number of thyristors. Following, it is proposed a control system to make such equipment an efficient AC system stabilizing tool. It is presented some simulation results to show the operation of this transformer in an electrical system. (author) 3 refs., 11 figs., 3 tabs.
Oscillator strength and quantum-confined Stark effect of excitons in a thin PbS quantum disk
Oukerroum, A.; El-Yadri, M.; El Aouami, A.; Feddi, E.; Dujardin, F.; Duque, C. A.; Sadoqi, M.; Long, G.
2018-01-01
In this paper, we report a study of the effect of a lateral electric field on a quantum-confined exciton in a thin PbS quantum disk. Our approach was performed in the framework of the effective mass theory and adiabatic approximation. The ground state energy and the stark shift were determined by using a variational method with an adequate trial wavefunction, by investigating a 2D oscillator strength under simultaneous consideration of the geometrical confinement and the electric field strength. Our results showed a strong dependence of the exciton binding and the Stark shift on the disk dimensions in both axial and longitudinal directions. On the other hand, our results also showed that the Stark shift’s dependence on the electric field is not purely quadratic but the linear contribution is also important and cannot be neglected, especially when the confinement gets weaker.
PRESSURE SHIFT AND GRAVITATIONAL REDSHIFT OF BALMER LINES IN WHITE DWARFS: REDISCUSSION
Energy Technology Data Exchange (ETDEWEB)
Halenka, Jacek; Olchawa, Wieslaw [Institute of Physics, University of Opole, ul. Oleska 48, 45-052, Opole (Poland); Madej, Jerzy [Astronomical Observatory, University of Warsaw, Al. Ujazdowskie 4, 00-478 Warszawa (Poland); Grabowski, Boleslaw, E-mail: halenka@uni.opole.pl, E-mail: wolch@uni.opole.pl, E-mail: jm@astrouw.edu.pl, E-mail: bgrab@uni.opole.pl [Wroclaw School of Information Technology WWSIS “Horyzont,” ul. Wejherowska 28, 54-239 Wroclaw (Poland)
2015-08-01
The Stark-induced shift and asymmetry, the so-called pressure shift (PS) of H{sub α} and H{sub β} Balmer lines in spectra of DA white dwarfs (WDs), have been examined in detail as masking effects in measurements of the gravitational redshift in WDs. The results are compared with our earlier ones from a quarter of a century ago. In these earlier papers, the standard, symmetrical Stark line profiles, as a dominant constituent of the Balmer line profiles but shifted as a whole by the PS effect, were applied to all spectrally active layers of the WD atmosphere. At present, in each of the WD layers, the Stark line profiles (especially of H{sub β}) are inherently asymmetrical and shifted due to the effects of strong inhomogeneity of the perturbing fields in plasma. To calculate the Stark line profiles in successive layers of the WD atmosphere we used the modified Full Computer Simulation Method, able to take adequately into account the complexity of local elementary quantum processes in plasma. In the case of the H{sub α} line, the present value of Stark-induced shift of the synthetic H{sub α} line profile is about half the previous one and it is negligible in comparison with the gravitational redshift. In the case of the H{sub β} line, the present value of Stark-induced shift of the synthetic H{sub β} line profile is about twice the previous one. The source of this extra shift is the asymmetry of H{sub β} peaks.
Stark Broadening and White Dwarfs
Directory of Open Access Journals (Sweden)
Dimitrijević Milan S.
2011-12-01
Full Text Available White dwarf and pre-white dwarfs are the best types of stars for the application of Stark broadening research results in astrophysics, since in the atmospheres of these stars physical conditions are very favorable for this line broadening mechanism - in hot hydrogen-deficient white dwarfs and pre-white dwarfs Teff = 75 000–180 000 K and log g = 5.5–8 [cgs]. Even for much cooler DA and DB white dwarfs with the typical effective temperatures 10 000-20 000 K, Stark broadening is usually the dominant broadening mechanism. In this review, Stark broadening in white dwarf spectra is considered, and the attention is drawn to the STARK-B database (http://stark-b.obspm.fr/, containing the parameters needed for analysis and synthesis of white dwarf spectra, as well as for the collective efforts to develop the Virtual Atomic and Molecular Data Center.
Runge-Lenz wave packet in multichannel Stark photoionization
International Nuclear Information System (INIS)
Texier, F.
2005-01-01
In a previous slow photoionization experiment, modulations of ionization rings were manifested for Xe in a constant electric field. The present quantum calculation reveals that the modulation is an effect of the multichannel core scattering and of tunneling waves through the Coulomb-Stark potential barrier: the barrier reduces the number of oscillations that is observed relatively to the number of oscillations of the short range wave functions, and the nonhydrogenic core phase shifts modify the position of the ionization rings. We find a hidden difference, in the ionization process, for two close values of the energy depending on the resonance with the barrier. The ionization intensity is interpreted as a Runge-Lenz wave packet; thus, we can relate the quantum modulation to the classical Coulomb-Stark trajectories. The Runge-Lenz wave packet differs from a usual temporal wave packet because its components are eigenstates of the Runge-Lenz vector z projection and its evolution is not temporal but spatial
Theoretical Stark widths and shifts of spectral lines of 2p5nf and 2p55g configurations of Mg III
International Nuclear Information System (INIS)
Moreno-Díaz, Cristina; Alonso-Medina, Aurelia; Colón, Cristóbal
2014-01-01
In this paper, we report theoretical Stark widths and shifts calculated using the Griem semi-empirical approach, which corresponds to 111 spectral lines of Mg III. The values of these Stark broadening parameters of spectral lines that arise from levels of 2p 5 nf and 2p 5 5g configurations of Mg III are presented in the literature for the first time. The aim of this work is to provide values to estimate the electron density of plasma Mg III in astrophysics and industrial applications. The data are presented for the temperatures T = 0.5–10.0 (10 4 K) and for an electron density of 10 17 cm −3 . The matrix of elements used in these calculations has been determined from 23 configurations of Mg III: 2s 2 2p 6 , 2s 2 2p 5 3p, 2s 2 2p 5 4p, 2s 2 2p 5 4f and 2s 2 2p 5 5f for the even parity and 2s 2 2p 5 ns (n = 3–6), 2s 2 2p 5 nd (n = 3–9), 2s 2 2p 5 5g and 2s2p 6 np (n = 3–8) for the odd parity. For the intermediate coupling calculations, we use the standard method of least square fitting from experimental energy levels by means of Cowan’s computer code. Lines with wavelengths of 134.6460, 135.2800, 189.0380, 190.0043, 192.8424, 408.2939 and 409.4375 nm have high probabilities and also have high values of broadening. Therefore, these lines can be used in some applications. A common regularity for the Stark width of the 189.038 nm spectral line of Mg III is discussed. (paper)
Stark broadening of Ca IV spectral lines of astrophysical interest
Alonso-Medina, A.; Colón, C.
2014-12-01
Ca IV emission lines are under the preview of Solar Ultraviolet Measurements of Emitted Radiation device aboard the Solar and Heliospheric Observatory. Also, lines of the Ca IV in planetary nebulae NGC 7027 were detected with the Short Wavelength Spectrometer on board the Infrared Space Observatory. These facts justify an attempt to provide new spectroscopic parameters of Ca IV. There are no theoretical or experimental Stark broadening data for Ca IV. Using the Griem semi-empirical approach and the COWAN code, we report in this paper calculated values of the Stark broadening parameters for 467 lines of Ca IV. They were calculated using a set of wavefunctions obtained by using Hartree-Fock relativistic calculations. These lines arising from 3s23p4ns (n = 4, 5), 3s23p44p, 3s23p4nd (n = 3, 4) configurations. Stark widths and shifts are presented for an electron density of 1017 cm-3 and temperatures T = 10 000, 20 000 and 50 200 K. As these data cannot be compared to others in the literature, we present an analysis of the different regularities of the values presented in this work.
Baranov, A. A.; Ermak, S. V.; Kulachenkov, N. K.; Petrenko, M. V.; Sagitov, E. A.; Semenov, V. V.
2017-11-01
This paper presents the results of investigation Stark shift effect influence on the long-term stability of a dual scheme of quantum magnetometers. Such scheme allows suppressing Stark shift components when a certain pumping light polarization is applied. As a result, long-term stability of a quantum sensor increases. However, when low-frequency (LF) and microwave fields are attached to a single vapor cell a coherence circulation in hyperfine structure of alkali atoms takes place. Physical origin of this effect is associated with the so called “dressed” atom theory, when atom is “dressed” by LF field. It yields in multiphoton absorption and resonance frequency shift. First estimates for this shift based on density matrix evolution formalism are provided in the paper.
Stark-shift of impurity fundamental state in a lens shaped quantum dot
Aderras, L.; Bah, A.; Feddi, E.; Dujardin, F.; Duque, C. A.
2017-05-01
We calculate the Stark effect and the polarisability of shallow-donor impurity located in the centre of lens shaped quantum dot by a variational method and in the effective-mass approximation. Our theoretical model assumes an infinite confinement to describe the barriers at the dot boundaries and the electric field is considered to be applied in the z-direction. The systematic theoretical investigation contains results with the quantum dot size and the strength of the external field. Our calculations reveal that the interval wherein the polarisability varies depends strongly on the dot size.
Baghshahi, H. R.; Tavassoly, M. K.; Faghihi, M. J.
2014-12-01
An entangled state, as an essential tool in quantum information processing, may be generated through the interaction between light and matter in cavity quantum electrodynamics. In this paper, we study the interaction between two two-level atoms and a two-mode field in an optical cavity enclosed by a medium with Kerr nonlinearity in the presence of a detuning parameter and Stark effect. It is assumed that the atom-field coupling and third-order susceptibility of the Kerr medium depend on the intensity of the light. In order to investigate the dynamics of the introduced system, we obtain the exact analytical form of the state vector of the considered atom-field system under initial conditions which may be prepared for the atoms (in a coherent superposition of their ground and upper states) and the fields (in a standard coherent state). Then, in order to evaluate the degree of entanglement between the subsystems, we investigate the dynamics of the entanglement by employing the entanglement of formation. Finally, we analyze in detail the influences of the Stark shift, the deformed Kerr medium, the intensity-dependent coupling, and also the detuning parameter on the behavior of this measure for different subsystems. The numerical results show that the amount of entanglement between the different subsystems can be controlled by choosing the evolved parameters appropriately.
International Nuclear Information System (INIS)
Baghshahi, H R; Tavassoly, M K; Faghihi, M J
2014-01-01
An entangled state, as an essential tool in quantum information processing, may be generated through the interaction between light and matter in cavity quantum electrodynamics. In this paper, we study the interaction between two two-level atoms and a two-mode field in an optical cavity enclosed by a medium with Kerr nonlinearity in the presence of a detuning parameter and Stark effect. It is assumed that the atom–field coupling and third-order susceptibility of the Kerr medium depend on the intensity of the light. In order to investigate the dynamics of the introduced system, we obtain the exact analytical form of the state vector of the considered atom–field system under initial conditions which may be prepared for the atoms (in a coherent superposition of their ground and upper states) and the fields (in a standard coherent state). Then, in order to evaluate the degree of entanglement between the subsystems, we investigate the dynamics of the entanglement by employing the entanglement of formation. Finally, we analyze in detail the influences of the Stark shift, the deformed Kerr medium, the intensity-dependent coupling, and also the detuning parameter on the behavior of this measure for different subsystems. The numerical results show that the amount of entanglement between the different subsystems can be controlled by choosing the evolved parameters appropriately. (paper)
Asymmetry of Hβ Stark profiles in T-tube hydrogen plasma
International Nuclear Information System (INIS)
Djurovic, S.; Nikolic, D.; Savic, I.; Soerge, S.; Demura, A. V.
2005-01-01
The whole Balmer H β line profiles are studied in detail experimentally in the T-tube discharge for the wide range of plasma parameters. Besides the common one, two additional parameters are introduced to characterize the asymmetry behavior of the experimental Stark profiles with the reference point chosen in the center of the line. The experimental data are analyzed and benchmarked versus the simple theoretical model based on the effects of microfield nonuniformity and electron impact shifts
Stark--Zeeman effect of metastable hydrogen molecules
International Nuclear Information System (INIS)
Kagann, R.H.
1975-01-01
The Stark effect of the N = 1 rotational level of orthohydrogen and the N = 2 rotational level of parahydrogen in the metastable c 3 PI/sub u/ electronic state has been measured using the molecular beam magnetic resonance method. The Stark effect of the metastable state is 10,000 times larger than that of the ground electronic state. The Stark effect of parahydrogen was found to be weakly dependent on static magnetic field strength, whereas the Stark effect of orthohydrogen was found to be more strongly dependent on the magnetic field strength. The Stark effect of orthohydrogen has been calculated using second-order perturbation theory with a pure Stark effect perturbation. The magnetic field dependence of the Stark effect was calculated using third-order perturbation theory with a mixed Stark--Zeeman effect double perturbation. A comparison of the experimental and theoretical values of α/sub perpendicular/ provides information on the electronic transition moment connecting the c 3 PI/sub u/ state to the a 3 Σ + /sub g/ state. The transition moment is needed to calculate the radiative lifetimes of the various vibrational levels of the c 3 PI/sub u/ state. The transition moment also enters the calculation of the quenching of this metastable state by an external electric field. There is a disagreement between theoretical predictions and the results of an experiment on the electric field quenching of the metastables. A test of the electronic transition moment may help shed light on this question. The experimental determination of the values of the transition moments allows one to test theory by comparing these values to those obtained by calculations employing ab initio wavefunctions
Scattering theory for Stark Hamiltonians
International Nuclear Information System (INIS)
Jensen, Arne
1994-01-01
An introduction to the spectral and scattering theory for Schroedinger operators is given. An abstract short range scattering theory is developed. It is applied to perturbations of the Laplacian. Particular attention is paid to the study of Stark Hamiltonians. The main result is an explanation of the discrepancy between the classical and the quantum scattering theory for one-dimensional Stark Hamiltonians. (author). 47 refs
Energy Technology Data Exchange (ETDEWEB)
Pablant, N. A. [University of California-San Diego, La Jolla, California 92093 (United States); Burrell, K. H.; Groebner, R. J.; Kaplan, D. H. [General Atomics, P.O. Box 85608, San Diego, California 92186-5608 (United States); Holcomb, C. T. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States)
2010-10-15
Results are presented from the B-Stark diagnostic installed on the DIII-D tokamak. This diagnostic provides measurements of the magnitude and direction of the internal magnetic field. The B-Stark system is a version of a motional Stark effect (MSE) diagnostic based on the relative line intensities and spacing of the Stark split D{sub {alpha}} emission from injected neutral beams. This technique may have advantages over MSE polarimetry based diagnostics in future devices, such as the ITER. The B-Stark diagnostic technique and calibration procedures are discussed. The system is shown to provide accurate measurements of B{sub {theta}}/B{sub T} and |B| over a range of plasma conditions. Measurements have been made with toroidal fields in the range of 1.2-2.1 T, plasma currents in the range 0.5-2.0 MA, densities between 1.7 and 9.0x10{sup 19} m{sup -3}, and neutral beam voltages between 50 and 81 keV. The viewing direction and polarization dependent transmission properties of the collection optics are found using an in situ beam into gas calibration. These results are compared to values found from plasma equilibrium reconstructions and the MSE polarimetry system on DIII-D.
Pablant, N A; Burrell, K H; Groebner, R J; Holcomb, C T; Kaplan, D H
2010-10-01
Results are presented from the B-Stark diagnostic installed on the DIII-D tokamak. This diagnostic provides measurements of the magnitude and direction of the internal magnetic field. The B-Stark system is a version of a motional Stark effect (MSE) diagnostic based on the relative line intensities and spacing of the Stark split D(α) emission from injected neutral beams. This technique may have advantages over MSE polarimetry based diagnostics in future devices, such as the ITER. The B-Stark diagnostic technique and calibration procedures are discussed. The system is shown to provide accurate measurements of B(θ)/B(T) and ∣B∣ over a range of plasma conditions. Measurements have been made with toroidal fields in the range of 1.2-2.1 T, plasma currents in the range 0.5-2.0 MA, densities between 1.7 and 9.0×10(19) m(-3), and neutral beam voltages between 50 and 81 keV. The viewing direction and polarization dependent transmission properties of the collection optics are found using an in situ beam into gas calibration. These results are compared to values found from plasma equilibrium reconstructions and the MSE polarimetry system on DIII-D.
Stark broadening parameters and transition probabilities of persistent lines of Tl II
de Andrés-García, I.; Colón, C.; Fernández-Martínez, F.
2018-05-01
The presence of singly ionized thallium in the stellar atmosphere of the chemically peculiar star χ Lupi was reported by Leckrone et al. in 1999 by analysis of its stellar spectrum obtained with the Goddard High Resolution Spectrograph (GHRS) on board the Hubble Space Telescope. Atomic data about the spectral line of 1307.50 Å and about the hyperfine components of the spectral lines of 1321.71 Å and 1908.64 Å were taken from different sources and used to analyse the isotopic abundance of thallium II in the star χ Lupi. From their results the authors concluded that the photosphere of the star presents an anomalous isotopic composition of Tl II. A study of the atomic parameters of Tl II and of the broadening by the Stark effect of its spectral lines (and therefore of the possible overlaps of these lines) can help to clarify the conclusions about the spectral abundance of Tl II in different stars. In this paper we present calculated values of the atomic transition probabilities and Stark broadening parameters for 49 spectral lines of Tl II obtained by using the Cowan code including core polarization effects and the Griem semiempirical approach. Theoretical values of radiative lifetimes for 11 levels (eight with experimental values in the bibliography) are calculated and compared with the experimental values in order to test the quality of our results. Theoretical trends of the Stark width and shift parameters versus the temperature for spectral lines of astrophysical interest are displayed. Trends of our calculated Stark width for the isoelectronic sequence Tl II-Pb III-Bi IV are also displayed.
Stark-like electron transfer between quantum wells
International Nuclear Information System (INIS)
Dubovis, S.A.; Voronko, A.N.; Basharov, A.M.
2008-01-01
The Stark-like mechanism of electron transfer between two energy subband localized in remote quantum wells is examined theoretically. Estimations of major parameters of the problem in case of delta-function-wells model are adduced. Schematic model allowing experimental study of Stark-like transfer is proposed
Black-body radiation effects and light shifts in atomic frequency standards
Energy Technology Data Exchange (ETDEWEB)
Pal' chikov, V G; Domnin, Yu S; Novoselov, A V [Institute of Metrology for Time and Space at National Research Institute for Physical-Technical and Radiotechnical Measurements - IMVP GP VNIIFTRI, Mendeleevo, Moscow Region, 141570 (Russian Federation)
2003-04-01
A general method is presented for calculating the higher-order terms of series in powers of the black-body radiation field for the Stark-state wavefunctions, dipole transition matrix elements and corresponding frequency shifts of hyperfine splitting in the ground states for Cs and Rb atoms. A numerical method for calculating the light shifts in Sr atoms is described. It is based on the Green function method for summation over all intermediate states and exact Dirac-Fock wavefunctions for the resonant transitions to the first excited s-, p- and d-states. By comparing the calculated Stark shift with results of measurements employing atomic frequency standards, the black-body radiation effects on the ground state are analysed.
Extremely short pulses via stark modulation of the atomic transition frequencies.
Radeonychev, Y V; Polovinkin, V A; Kocharovskaya, Olga
2010-10-29
We propose a universal method to produce extremely short pulses of electromagnetic radiation in various spectral ranges. The essence of the method is a resonant interaction of radiation with atoms under the conditions of adiabatic periodic modulation of atomic transition frequencies by a far-off-resonant control laser field via dynamic Stark shift of the atomic levels and proper adjustment of the control field intensity and frequency, as well as the optical depth of the medium. The potential of the method is illustrated by an example in a hydrogenlike atomic system.
International Nuclear Information System (INIS)
Sahal-Brechot, S
2010-01-01
Stark broadening theories and calculations have been extensively developed for about 50 years. The theory can now be considered as mature for many applications, especially for accurate spectroscopic diagnostics and modelling. In astrophysics, with the increasing sensitivity of observations and spectral resolution, in all domains of wavelengths from far UV to infrared, it has become possible to develop realistic models of interiors and atmospheres of stars and interpret their evolution and the creation of elements through nuclear reactions. For hot stars, especially white dwarfs, Stark broadening is the dominant collisional line broadening process. This requires the knowledge of numerous profiles, especially for trace elements, which are used as useful probes for modern spectroscopic diagnostics. Hence, calculations based on a simple but enough accurate and fast method, are necessary for obtaining numerous results. Ab initio calculations are a growing domain of development. Nowadays, the access to such data via an on line database becomes crucial. This is the object of STARK-B, which is a collaborative project between the Paris Observatory and the Astronomical Observatory of Belgrade. It is a database of calculated widths and shifts of isolated lines of atoms and ions due to electron and ion collisions. It is devoted to modelling and spectroscopic diagnostics of stellar atmospheres and envelopes. In addition, it is relevant to laboratory plasmas, laser equipments and technological plasmas. It is a part of VAMDC (Virtual Atomic and Molecular Data Centre), which is an European Union funded collaboration between groups involved in the generation and use of atomic and molecular data.
Stark widths regularities within spectral series of sodium isoelectronic sequence
Trklja, Nora; Tapalaga, Irinel; Dojčinović, Ivan P.; Purić, Jagoš
2018-02-01
Stark widths within spectral series of sodium isoelectronic sequence have been studied. This is a unique approach that includes both neutrals and ions. Two levels of problem are considered: if the required atomic parameters are known, Stark widths can be calculated by some of the known methods (in present paper modified semiempirical formula has been used), but if there is a lack of parameters, regularities enable determination of Stark broadening data. In the framework of regularity research, Stark broadening dependence on environmental conditions and certain atomic parameters has been investigated. The aim of this work is to give a simple model, with minimum of required parameters, which can be used for calculation of Stark broadening data for any chosen transitions within sodium like emitters. Obtained relations were used for predictions of Stark widths for transitions that have not been measured or calculated yet. This system enables fast data processing by using of proposed theoretical model and it provides quality control and verification of obtained results.
Stark broadening of several Bi IV spectral lines of astrophysical interest
Colón, C.; Moreno-Díaz, C.; de Andrés-García, I.; Alonso-Medina, A.
2017-09-01
The presence of spectral lines of bismuth in stellar atmospheres has been reported in different stars. The anomalous values of the spectral intensities of Bi II and Bi III, compared to the theoretical Local Termodinamic Equilibrium (LTE) standards of Bi I/Bi II/Bi III, have been reported in the spectra obtained with the High Resolution Spectrograph of the Hubble/Goddard Space Telescope in the chemically peculiar stars HgMn stars χ Lupi and HR 7775. Spectral lines of 1436.8, 1902.3, 2630.9 and 2936.7 Å of Bi II and 1423.4 Å of Bi III were reported and their relative intensities were measured in these studies Litzén & Wahlgren 2002. These lines are overlapped with spectral lines of 1437.65, 2630.1 and 2937.1 Å of Bi IV. A study of the Stark broadening parameters of Bi IV spectral lines can help to study these overlaps. In this paper, using the Griem semi-empirical approach, we report calculated values of the Stark parameters for 64 spectral lines of Bi IV. The matrix elements used in these calculations have been determined from 17 configurations of Bi IV. They were calculated using the cowan code including core polarization effects. Data are displayed for an electron density of 1017 cm-3 and temperatures T = 10 000-160 000 K. Also calculated radiative lifetimes for 12 levels with experimental lifetime are presented, in order to test the goodness of our calculations. Theoretical trends of the Stark width and shift parameters versus the temperature for spectral lines of astrophysical interest are displayed.
Stark Broadening of Cr III Spectral Lines: DO White Dwarfs
Directory of Open Access Journals (Sweden)
Milan S. Dimitrijević
2018-04-01
Full Text Available Using the modified semiempirical method of Dimitrijević and Konjević, Stark widths have been calculated for six Cr III transitions, for an electron density of 10 17 cm ‒ 3 and for temperatures from 5000–80,000 K. Results have been used for the investigation of the influence of Stark broadening on spectral lines in cool DO white dwarf atmospheres. Calculated Stark widths will be implemented in the STARK-B database, which is also a part of the Virtual Atomic and Molecular Data Center (VAMDC.
Dipole transitions and Stark effect in the charge-dyon system
International Nuclear Information System (INIS)
Mardoyan, Levon; Nersessian, Armen; Sarkisyan, Hayk; Yeghikyan, Vahagn
2007-01-01
We consider the dipole transitions and the linear and quadratic Stark effects in the MICZ-Kepler system interpreted as a charge-dyon system. We show that while the linear Stark effect in the ground state is proportional to the azimuth quantum number (and to the sign of the monopole number), the quadratic Stark effect in the ground state is independent of the signs of the azimuth and monopole numbers
Multiphoton Rabi oscillations between highly excited Stark states of potassium
International Nuclear Information System (INIS)
He Yonglin
2011-01-01
We have applied a nonperturbative resonant theory to study the Rabi frequency of microwave multiphoton transitions between two Rydberg states of potassium in a static electric field. The Stark electric dipole moments used to calculate the Rabi frequency are determined by the Stark states' wave functions, which are obtained by the diagonalization method. The frequencies of the Rabi oscillations are in good agreement with either experimental ones or ones calculated by the time-dependent close-coupling method and the Floquet theory. Furthermore, we are able to show that the size of avoided crossings between the (n+2)s and (n,3) states can be predicted from the Stark electric dipole moment and the difference of the two Stark states' energy at a given resonance.
El-Bashir, S. M.; Alwadai, N. M.; AlZayed, N.
2018-02-01
Polymer nanocomposite films were prepared by doping fullerene C60 in polymer blend composed of polymethacrylate/polyvinyl acetate blends (PMMA/PVAc) using solution cast technique. The films were characterized by differential scanning calorimeter (DSC), Transmission electron microscope (TEM), DC/AC electrical conductivity and dielectric measurements in the frequency range (100 Hz- 1 MHz). The glass transition temperature, Tg, was increased by increasing the concentration of fullerene C60; this property reflects the increase of thermal stability by increasing the nanofiller content. The DC and AC electrical conductivities were enhanced by increasing C60 concentration due to the electron hopping or tunneling between filled and empty localized states above Tg. The relaxation time was determined from the αβ -relaxations and found to be attenuated by increasing the temperature as a typical behavior of amorphous polymers. The calculated values of thermodynamic parameters revealed the increase of molecular stability by increasing the doping concentration; this feature supports the application of PMMA/PVAc/C60 nanocomposite films in a wide scale of solar energy conversion applications such as luminescent down-shifting (LDS) coatings for photovoltaic cells.
Stark broadening measurements of Xe III spectral lines
International Nuclear Information System (INIS)
Pelaez, R J; Cirisan, M; Djurovic, S; Aparicio, J A; Mar, S
2006-01-01
This work reports measured Stark widths of doubly ionized xenon lines. Pulsed arc was used as a plasma source. Measured electron densities and temperatures were in the ranges of (0.2 - 1.6) x 10 23 m -3 and 18 300-25 500 K, respectively. Stark halfwidths of lines from 6s-6p, 6s-4f and 5d-6p transitions have been measured and compared with available experimental and theoretical data
Stark width regularities within spectral series of the lithium isoelectronic sequence
Tapalaga, Irinel; Trklja, Nora; Dojčinović, Ivan P.; Purić, Jagoš
2018-03-01
Stark width regularities within spectral series of the lithium isoelectronic sequence have been studied in an approach that includes both neutrals and ions. The influence of environmental conditions and certain atomic parameters on the Stark widths of spectral lines has been investigated. This study gives a simple model for the calculation of Stark broadening data for spectral lines within the lithium isoelectronic sequence. The proposed model requires fewer parameters than any other model. The obtained relations were used for predictions of Stark widths for transitions that have not yet been measured or calculated. In the framework of the present research, three algorithms for fast data processing have been made and they enable quality control and provide verification of the theoretically calculated results.
Magnetic field pitch angle diagnostic using the motional Stark effect (invited)
International Nuclear Information System (INIS)
Levinton, F.M.; Gammel, G.M.; Kaita, R.; Kugel, H.W.; Roberts, D.W.
1990-01-01
The Stark effect has been employed in a novel technique for obtaining the pitch angle profile and q(r) using polarimetry measurements of the Doppler shifted H α emission from a hydrogen diagnostic neutral beam. As a neutral beam propagates through a plasma, collisions of the beam particles with the background ions and electrons will excite beam atoms, leading to emission of radiation. The motional Stark effect, which arises from the electric field induced in the atom's rest frame due to the beam motion across the magnetic field (E=V beam xB), causes a wavelength splitting of several angstroms and polarization of the emitted radiation. The Δm=±1 transitions, or σ components, from the beam fluorescence are linearly polarized parallel to the direction of the local magnetic field when viewed transverse to the fields. Since the hydrogen beam provides good spatial localization and penetration, the pitch angle can be obtained anywhere in the plasma. A photoelastic modulator (PEM) is used to modulate the linearly polarized light. Depending on the orientation of the PEM, it can measure the sine or cosine of the angle of polarization. Two PEM's are used to measure both components simultaneously. Results of q(r) for both Ohmic and NBI heated discharges have been obtained in the Princeton Beta Experiment (PBX-M) tokamak, with an uncertainty of ∼6% for q(0)
Propagation of vector solitons in a quasi-resonant medium with stark deformation of quantum states
Energy Technology Data Exchange (ETDEWEB)
Sazonov, S. V., E-mail: sazonov.sergei@gmail.com [National Research Centre Kurchatov Institute (Russian Federation); Ustinov, N. V., E-mail: n_ustinov@mail.ru [Moscow State Railway University, Kaliningrad Branch (Russian Federation)
2012-11-15
The nonlinear dynamics of a vector two-component optical pulse propagating in quasi-resonance conditions in a medium of nonsymmetric quantum objects is investigated for Stark splitting of quantum energy levels by an external electric field. We consider the case when the ordinary component of the optical pulse induces {sigma} transitions, while the extraordinary component induces the {pi} transition and shifts the frequencies of the allowed transitions due to the dynamic Stark effect. It is found that under Zakharov-Benney resonance conditions, the propagation of the optical pulse is accompanied by generation of an electromagnetic pulse in the terahertz band and is described by the vector generalization of the nonlinear Yajima-Oikawa system. It is shown that this system (as well as its formal generalization with an arbitrary number of optical components) is integrable by the inverse scattering transformation method. The corresponding Darboux transformations are found for obtaining multisoliton solutions. The influence of transverse effects on the propagation of vector solitons is investigated. The conditions under which transverse dynamics leads to self-focusing (defocusing) of solitons are determined.
Stark resonances in disordered systems
International Nuclear Information System (INIS)
Grecchi, V.; Maioli, M.; Modena Univ.; Sacchetti, A.
1992-01-01
By slightly restricting the conditions given by Herbst and Howland, we prove the existence of resonances in the Stark effect of disordered systems (and atomic crystals) for large atomic mean distance. In the crystal case the ladders of resonances have the Wannier behavior for small complex field. (orig.)
Stark laws and fair market value exceptions: an introduction.
Siebrasse, Paul B
2007-01-01
This article will focus on one aspect of complexity in modern healthcare, namely the implications of Stark laws and other fraud and abuse provisions, including anti-kickback statutes and HIPAA. Also, this article explores the prevalence of fair market value as an exception in the Stark laws and discusses the meanings of those exceptions. Finally, the article explores basic approaches to assessing fair market value, including cost, income, and marketing approaches.
Variable scaling method and Stark effect in hydrogen atom
International Nuclear Information System (INIS)
Choudhury, R.K.R.; Ghosh, B.
1983-09-01
By relating the Stark effect problem in hydrogen-like atoms to that of the spherical anharmonic oscillator we have found simple formulas for energy eigenvalues for the Stark effect. Matrix elements have been calculated using 0(2,1) algebra technique after Armstrong and then the variable scaling method has been used to find optimal solutions. Our numerical results are compared with those of Hioe and Yoo and also with the results obtained by Lanczos. (author)
Trends with coverage and pH in Stark tuning rates for CO on Pt(1 1 1) electrodes
International Nuclear Information System (INIS)
Uddin, Jamal; Anderson, Alfred B.
2013-01-01
The general understanding of so-called electrochemical Stark tuning rates, that is, the potential dependence of vibrational frequency of CO adsorbed on Pt(1 1 1), has developed over the past thirty years in terms of two semiempirical models. The first is the Fermi level shift model used in non-self-consistent-field one-electron molecular orbital theory. This approach has provided qualitative understanding in terms of Fermi level-dependent variations in σ and π orbital bonding between CO and the electrode surface atoms. The second is the use of self-consistent-field theory with surface charging to create adjustable electric fields. Adsorbed CO then reacts to the field in a classical Stark effect with some small uncharacterized Fermi level shift superimposed. It is now possible, using two-dimensional density functional theory, including electrolyte polarization from surface charging, and the dielectric continuum to approximate solvation energy, to calculate the tuning rate in response to shifts in the Fermi level and electrode potential caused by changing the surface charge density. Here we apply this first principles method to calculate trends in the tuning rate for CO adsorbed on 1-fold Pt(1 1 1) sites with changes in CO(ads) coverage and with changes in electrolyte pH. The tuning rate is calculated to decrease as the coverage is increased and, for high coverage, to increase as the pH is increased. These trends are shown to be in qualitative agreement with the very little existing experimental data for these trends
International Nuclear Information System (INIS)
Fang Jian-Cheng; Wang Tao; Li Yang; Cai Hong-Wei; Zhang Hong
2015-01-01
A method of measuring in-situ magnetic field gradient is proposed in this paper. The magnetic shield is widely used in the atomic magnetometer. However, there is magnetic field gradient in the magnetic shield, which would lead to additional gradient broadening. It is impossible to use an ex-situ magnetometer to measure magnetic field gradient in the region of a cell, whose length of side is several centimeters. The method demonstrated in this paper can realize the in-situ measurement of the magnetic field gradient inside the cell, which is significant for the spin relaxation study. The magnetic field gradients along the longitudinal axis of the magnetic shield are measured by a spin-exchange relaxation-free (SERF) magnetometer by adding a magnetic field modulation in the probe beam’s direction. The transmissivity of the cell for the probe beam is always inhomogeneous along the pump beam direction, and the method proposed in this paper is independent of the intensity of the probe beam, which means that the method is independent of the cell’s transmissivity. This feature makes the method more practical experimentally. Moreover, the AC-Stark shift can seriously degrade and affect the precision of the magnetic field gradient measurement. The AC-Stark shift is suppressed by locking the pump beam to the resonance of potassium’s D1 line. Furthermore, the residual magnetic fields are measured with σ + - and σ – -polarized pump beams, which can further suppress the effect of the AC-Stark shift. The method of measuring in-situ magnetic field gradient has achieved a magnetic field gradient precision of better than 30 pT/mm. (paper)
Semiconductor-metal transition induced by giant Stark effect in blue phosphorene nanoribbons
Energy Technology Data Exchange (ETDEWEB)
Xiong, Peng-Yu; Chen, Shi-Zhang; Zhou, Wu-Xing; Chen, Ke-Qiu, E-mail: keqiuchen@hnu.edu.cn
2017-06-28
The electronic structures and transport properties in monolayer blue phosphorene nanoribbons (BPNRs) with transverse electric field have been studied by using density functional theory and nonequilibrium Green's functions method. The results show that the band gaps of BPNRs with both armchair and zigzag edges are linearly decreased with the increasing of the strength of transverse electric field. A semiconductor-metal transition occurs when the electric field strength reaches to 5 V/nm. The Stark coefficient presents a linear dependency on BPNRs widths, and the slopes of both zBPNRs and aBPNRs are 0.41 and 0.54, respectively, which shows a giant Stark effect occurs. Our studies show that the semiconductor-metal transition originates from the giant Stark effect. - Highlights: • The electronic transport in blue phosphorene nanoribbons. • Semiconductor-metal transition can be observed. • The semiconductor-metal transition originates from the giant Stark effect.
International Nuclear Information System (INIS)
Catsalap, K.Yu.; Ershov-Pavlov, E.A.
2005-01-01
Emission spectral line profiles are commonly used for the evaluation of local plasma parameters. The plasma parameters and local line profiles are related in a rather simple way: e.g. at quadratic Stark broadening, the local line half widths and shifts are proportional to the electron density. For homogeneous optically thin plasmas, there is no difference in the line profiles of plasma emission and emissivity spectra. However for inhomogeneous source, the profiles are different due to spatial dependence of electron density and plasma temperature: profiles in the plasma emission are a superposition of different local ones. A transition from the recorded to local profiles is usually performed by tomography techniques. As the result, the measurement procedure is getting slower and additional errors occurs. For transparent plasmas, an approach was developed to evaluate local profiles from as recorded spectra using relations found by modeling. However, for semi-transparent plasmas the relation between the recorded and local profiles is more complicated one. With the optical thickness t increase, profile half width Δλ in the plasma emission spectrum changes much comparing to the profile half width Δλ 0 in the spectrum of optically thin plasma. The ratio t h =Δλ/Δλ 0 on τ for dispersion profile and homogeneous plasma can be written as t h =(-1-τ/ln((1+e -τ )/2)) 1/2 . When Δλ and τ are known, the function allows obtaining Δλ 0 , i. e. reducing the problem to the transparent plasma diagnostics. However, the plasma is nearly always inhomogeneous and the value t depends significantly on plasma inhomogeneity and on Stark parameters ratio d/w. Here, the dependence t(τ) for plasmas of different inhomogeneity rates has been obtained by the numerical simulation. The radiation transfer equation has been solved to calculate the spectral line profiles for LTE-plasma of known composition and distribution of temperature along the observation line. The temperature
Pressure dependence of backbone chemical shifts in the model peptides Ac-Gly-Gly-Xxx-Ala-NH2.
Erlach, Markus Beck; Koehler, Joerg; Crusca, Edson; Kremer, Werner; Munte, Claudia E; Kalbitzer, Hans Robert
2016-06-01
For a better understanding of nuclear magnetic resonance (NMR) detected pressure responses of folded as well as unstructured proteins the availability of data from well-defined model systems are indispensable. In this work we report the pressure dependence of chemical shifts of the backbone atoms (1)H(α), (13)C(α) and (13)C' in the protected tetrapeptides Ac-Gly-Gly-Xxx-Ala-NH2 (Xxx one of the 20 canonical amino acids). Contrary to expectation the chemical shifts of these nuclei have a nonlinear dependence on pressure in the range from 0.1 to 200 MPa. The polynomial pressure coefficients B 1 and B 2 are dependent on the type of amino acid studied. The coefficients of a given nucleus show significant linear correlations suggesting that the NMR observable pressure effects in the different amino acids have at least partly the same physical cause. In line with this observation the magnitude of the second order coefficients of nuclei being direct neighbors in the chemical structure are also weakly correlated.
Exceptions to the Stark law: practical considerations for surgeons.
Satiani, Bhagwan
2006-03-01
The purpose of this study was to provide an understanding of the applicable legislative exceptions to prohibitions under the Stark law, which governs common legitimate business relationships in surgical practice. Stark I and II prohibits all referrals (and claims) for the provision of designated health services for federal reimbursement if a physician or immediate family member has any financial relationship with the entity. Regardless of intent (unlike the antikickback statute), any financial relationship is illegal unless specifically excepted by statute. These exceptions are relevant to ownership, compensation arrangements, or both. The most important ones relevant to surgeons are as follows: physician service exception (services rendered in an intragroup referral); in-office ancillary services exception (office-based vascular laboratory); the whole hospital exception (ownership interest in a hospital or department); lease exception (conditions that must be met for a lease not to be considered illegal); bona fide employment exception (important to academic medical centers); personal services arrangement exception (vascular laboratory medical directorship); physician incentive plans exception (if volume or value of referrals are an issue); hospital-affiliated group practice exception (physician services billed by a hospital); recruitment arrangement exception (inducements by hospitals to relocate); items/services exception (transcription services purchased from a hospital); fair market value exception (covers services provided to health care entities); indirect compensation arrangements (dealings between a hospital and entity owned by physicians); and academic medical centers exception (new phase II rules broaden the definition of academic medical centers and ease the requirement that practice plans be tax-exempt organizations, among other changes. Although expert legal advice is required for navigation through the maze of Stark laws, it is incumbent on surgeons
Measurement of the poloidal magnetic field in the PBX-M tokamak using the motional Stark effect
International Nuclear Information System (INIS)
Levinton, F.M.; Fonck, R.J.; Gammel, G.M.; Kaita, R.; Kugel, H.W.; Powell, E.T.; Roberts, D.W.
1989-05-01
Polarimetry measurements of the Doppler-shifted H/sub α/ emission from a hydrogen neutral beam on the PBX-M tokamak have been employed in a novel technique for obtaining q(0) and poloidal magnetic field profiles. The electric field from the beam particle motion across the magnetic field (E = V/sub beam/ /times/ B) causes a wavelength splitting of several angstroms, and polarization of the emitted radiation (Stark effect). Viewed transverse to the fields, the emission is linearly polarized with the angle of polarization related to the direction of the magnetic field. 14 refs., 5 figs
On the Application of Stark Broadening Data Determined with a Semiclassical Perturbation Approach
Directory of Open Access Journals (Sweden)
Milan S. Dimitrijević
2014-08-01
Full Text Available The significance of Stark broadening data for problems in astrophysics, physics, as well as for technological plasmas is discussed and applications of Stark broadening parameters calculated using a semiclassical perturbation method are analyzed.
Hβ Stark broadening in cold plasmas with low electron densities calibrated with Thomson scattering
International Nuclear Information System (INIS)
Palomares, J.M.; Hübner, S.; Carbone, E.A.D.; Vries, N. de; Veldhuizen, E.M. de; Sola, A.; Gamero, A.; Mullen, J.J.A.M. van der
2012-01-01
In the present work Stark broadening measurements have been carried out on low electron density (n e 19 m −3 ) and (relatively) low gas temperature (T g e . - Highlights: ► Stark broadening measurements at low density and temperature conditions ► Calibration with Thomson scattering ► Indications of the non-Lorentzian shape of the Stark broadening ► Impossibility of simultaneous diagnostic of gas temperature and electron density
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Pressure dependence of backbone chemical shifts in the model peptides Ac-Gly-Gly-Xxx-Ala-NH{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Erlach, Markus Beck; Koehler, Joerg [University of Regensburg, Institute of Biophysics and Physical Biochemistry and Centre of Magnetic Resonance in Chemistry and Biomedicine (Germany); Crusca, Edson [University of São Paulo, Physics Institute of São Carlos (Brazil); Kremer, Werner [University of Regensburg, Institute of Biophysics and Physical Biochemistry and Centre of Magnetic Resonance in Chemistry and Biomedicine (Germany); Munte, Claudia E. [University of São Paulo, Physics Institute of São Carlos (Brazil); Kalbitzer, Hans Robert, E-mail: hans-robert.kalbitzer@biologie.uni-regensburg.de [University of Regensburg, Institute of Biophysics and Physical Biochemistry and Centre of Magnetic Resonance in Chemistry and Biomedicine (Germany)
2016-06-15
For a better understanding of nuclear magnetic resonance (NMR) detected pressure responses of folded as well as unstructured proteins the availability of data from well-defined model systems are indispensable. In this work we report the pressure dependence of chemical shifts of the backbone atoms {sup 1}H{sup α}, {sup 13}C{sup α} and {sup 13}C′ in the protected tetrapeptides Ac-Gly-Gly-Xxx-Ala-NH{sub 2} (Xxx one of the 20 canonical amino acids). Contrary to expectation the chemical shifts of these nuclei have a nonlinear dependence on pressure in the range from 0.1 to 200 MPa. The polynomial pressure coefficients B{sub 1} and B{sub 2} are dependent on the type of amino acid studied. The coefficients of a given nucleus show significant linear correlations suggesting that the NMR observable pressure effects in the different amino acids have at least partly the same physical cause. In line with this observation the magnitude of the second order coefficients of nuclei being direct neighbors in the chemical structure are also weakly correlated.Graphical Abstract.
Pressure dependence of side chain 13C chemical shifts in model peptides Ac-Gly-Gly-Xxx-Ala-NH2.
Beck Erlach, Markus; Koehler, Joerg; Crusca, Edson; Munte, Claudia E; Kainosho, Masatsune; Kremer, Werner; Kalbitzer, Hans Robert
2017-10-01
For evaluating the pressure responses of folded as well as intrinsically unfolded proteins detectable by NMR spectroscopy the availability of data from well-defined model systems is indispensable. In this work we report the pressure dependence of 13 C chemical shifts of the side chain atoms in the protected tetrapeptides Ac-Gly-Gly-Xxx-Ala-NH 2 (Xxx, one of the 20 canonical amino acids). Contrary to expectation the chemical shifts of a number of nuclei have a nonlinear dependence on pressure in the range from 0.1 to 200 MPa. The size of the polynomial pressure coefficients B 1 and B 2 is dependent on the type of atom and amino acid studied. For H N , N and C α the first order pressure coefficient B 1 is also correlated to the chemical shift at atmospheric pressure. The first and second order pressure coefficients of a given type of carbon atom show significant linear correlations suggesting that the NMR observable pressure effects in the different amino acids have at least partly the same physical cause. In line with this observation the magnitude of the second order coefficients of nuclei being direct neighbors in the chemical structure also are weakly correlated. The downfield shifts of the methyl resonances suggest that gauche conformers of the side chains are not preferred with pressure. The valine and leucine methyl groups in the model peptides were assigned using stereospecifically 13 C enriched amino acids with the pro-R carbons downfield shifted relative to the pro-S carbons.
Balancing the dynamic Stark shift in a driven Jaynes-Cummings system
International Nuclear Information System (INIS)
Mogilevtsev, D; Kilin, S
2004-01-01
In this work we discuss the possibility of balancing a dynamic Shark shift in a Jaynes-Cummings system by simultaneously driving the cavity and the atom with classical fields, of the same frequency. For a lossless Jaynes-Cummings system this can lead to unusual atomic population dynamics. For a lossy Jaynes-Cummings system such balancing can lead to complete suppression of resonance fluorescence even for leaky cavities
International Nuclear Information System (INIS)
Hong Sun
1998-11-01
The quantum confined Stark effect (QCSE) of excitons in GaAs/AlAs corrugated lateral surface superlattices (CLSSLs) is calculated. Blue and red shifts in the exciton energies are predicted for the heavy- and light-excitons in the CLSSLs, respectively, comparing with those in the unmodulated quantum well due to the different effective hole masses in the parallel direction. Sensitive dependence of the QCSE on the hole effective mass in the parallel direction is expected because of the ''centre-of-mass'' quantization (CMQ) induced by the periodic corrugated interfaces of the CLSSLs. The effect of the CMQ on the exciton mini-bands and the localization of the excitons in the CLSSLs is discussed. (author)
Energy Technology Data Exchange (ETDEWEB)
Palomares, J.M., E-mail: j.m.palomares-linares@tue.nl [Department of Applied Physics, Eindhoven University of Technology, P.O. Box 513, 5600 MB Eindhoven (Netherlands); Huebner, S.; Carbone, E.A.D.; Vries, N. de; Veldhuizen, E.M. de [Department of Applied Physics, Eindhoven University of Technology, P.O. Box 513, 5600 MB Eindhoven (Netherlands); Sola, A.; Gamero, A. [Departamento de Fisica, Universidad de Cordoba, Campus de Rabanales, ed. C-2, 14071 Cordoba (Spain); Mullen, J.J.A.M. van der [Department of Applied Physics, Eindhoven University of Technology, P.O. Box 513, 5600 MB Eindhoven (Netherlands)
2012-07-15
In the present work Stark broadening measurements have been carried out on low electron density (n{sub e} < 5{center_dot}10{sup 19} m{sup -3}) and (relatively) low gas temperature (T{sub g} < 1100 K) argon-hydrogen plasma, under low-intermediate pressure conditions (3 mbar-40 mbar). A line fitting procedure is used to separate the effects of the different broadening mechanisms (e.g. Doppler and instrumental broadening) from the Stark broadening. A Stark broadening theory is extrapolated to lower electron density values, below its theoretical validity regime. Thomson scattering measurements are used to calibrate and validate the procedure. The results show an agreement within 20%, what validates the use of this Stark broadening method under such low density conditions. It is also found that Stark broadened profiles cannot be assumed to be purely Lorentzian. Such an assumption would lead to an underestimation of the electron density. This implies that independent information on the gas temperature is needed to find the correct values of n{sub e}. - Highlights: Black-Right-Pointing-Pointer Stark broadening measurements at low density and temperature conditions Black-Right-Pointing-Pointer Calibration with Thomson scattering Black-Right-Pointing-Pointer Indications of the non-Lorentzian shape of the Stark broadening Black-Right-Pointing-Pointer Impossibility of simultaneous diagnostic of gas temperature and electron density.
Stark widths of Xe II lines in a pulsed plasma
International Nuclear Information System (INIS)
Djurovic, S; Pelaez, R J; Cirisan, M; Aparicio, J A; Mar, S
2006-01-01
In this paper, we present a review of experimental work on Stark broadening of singly ionized xenon lines. Eighty lines, from close UV to the red region of the spectrum, have been studied. Stark halfwidths were compared with experimental data from the literature and modified semi-empirical calculations. A pulsed arc with 95% of helium and 5% xenon was used as a plasma source for this study. Measured electron densities N e and temperatures T were in the ranges of 0.2-1.6 x 10 23 m -3 and 18 300-25 500 K, respectively
Spectral-Kinetic Coupling and Effect of Microfield Rotation on Stark Broadening in Plasmas
Directory of Open Access Journals (Sweden)
Alexander V. Demura
2014-07-01
Full Text Available The study deals with two conceptual problems in the theory of Stark broadening by plasmas. One problem is the assumption of the density matrix diagonality in the calculation of spectral line profiles. This assumption is closely related to the definition of zero wave functions basis within which the density matrix is assumed to be diagonal, and obviously violated under the basis change. A consistent use of density matrix in the theoretical scheme inevitably leads to interdependence of atomic kinetics, describing the population of atomic states with the Stark profiles of spectral lines, i.e., to spectral-kinetic coupling. The other problem is connected with the study of the influence of microfield fluctuations on Stark profiles. Here the main results of the perturbative approach to ion dynamics, called the theory of thermal corrections (TTC, are presented, within which the main contribution to effects of ion dynamics is due to microfield fluctuations caused by rotations. In the present study the qualitative behavior of the Stark profiles in the line center within predictions of TTC is confirmed, using non-perturbative computer simulations.
Existence of the Stark-Wannier quantum resonances
Energy Technology Data Exchange (ETDEWEB)
Sacchetti, Andrea, E-mail: andrea.sacchetti@unimore.it [Department of Physics, Computer Sciences and Mathematics, University of Modena e Reggio Emilia, Modena (Italy)
2014-12-15
In this paper, we prove the existence of the Stark-Wannier quantum resonances for one-dimensional Schrödinger operators with smooth periodic potential and small external homogeneous electric field. Such a result extends the existence result previously obtained in the case of periodic potentials with a finite number of open gaps.
The Stark effect of 1H and 4He+ in the beam foil source
International Nuclear Information System (INIS)
Doobov, M.H.; Hay, H.J.; Sofield, C.J.; Newton, C.S.
1974-01-01
The appearance of Stark patterns obtained with a beam-foil source differed from those characteristically obtained from gas discharge sources. In the former source excitation of the hydrogenic ions occurred in a brief time interval ( 14 s) during the passage of a high velocity unidirectional beam of ions which produces non-statistical population distributions for the Stark perturbed states. The relative intensities of Stark perturbed components of the Hsub(β) hydrogen line and the Fsub(α) ionized helium line have been measured in a beam-foil source. In each case an initial population of states of principal quantum number n = 4 due to radiative decay and Stark mixing, and comparing the resultant patterns with the observed patterns. The inferred population distributions indicate that the states of low orbital angular momentum (L) are preferentially populated, and alignment referred to the beam axis is produced such that states with lower z component of L are preferentially populated. (author)
A new questionnaire for measuring quality of life - the Stark QoL.
Hardt, Jochen
2015-10-26
The Stark questionnaire measures health-related quality of life (QoL) using pictures almost exclusively. It is supplemented by a minimum of words. It comprises a mental and a physical health component. A German sample of n = 500 subjects, age and gender stratified, filled out the Stark Qol questionnaire along with various other questionnaires via internet. The physical component shows good reliability (Cronbach's alpha = McDonalds Omega = greatest lower bound = .93), the mental component can be improved (Cronbach's alpha = .63, McDonalds Omega = .72, greatest lower bound = .77). Confirmatory factor analysis shows a good fit (Bentlers CFI = .97). Construct validity was proven. The Stark QoL is a promising new development in measuring QoL, it is a short and easy to apply questionnaire. Additionally, it is particularly promising for international research.
Phonon-assisted hopping of an electron on a Wannier-Stark ladder in a strong electric field
International Nuclear Information System (INIS)
Emin, D.; Hart, C.F.
1987-01-01
With the application of a spatially constant electric field, the degeneracy of electronic energy levels of geometrically equivalent sites of a crystal is generally lifted. As a result, the electric field causes the electronic eigenstates of a one-dimensional periodic chain to become localized. In particular, they are Wannier-Stark states. With sufficiently large electric-field strengths these states become sufficiently well localized that it becomes appropriate to consider electronic transport to occur via a succession of phonon-assisted hops between the localized Wannier-Stark states. In this paper, we present calculations of the drift velocity arising from acoustic- and optical-phonon-assisted hopping motion between Wannier-Stark states. When the intersite electronic transfer energy is sufficiently small so that the Wannier-Stark states are essentially each confined to a single atomic site, the transport reduces to that of a small polaron. In this regime, while the drift velocity initially rises with increasing electric field strength, the drift velocity ultimately falls with increasing electric-field strength at extremely large electric fields. More generally, for common values of the electronic bandwidth and electric field strength, the Wannier-Stark states span many sites. At sufficiently large electric fields, the energy separation between Wannier-Stark states exceeds the energy uncertainty associated with the carrier's interaction with phonons. Then, it is appropriate to treat the electronic transport in terms of phonon-assisted hopping between Wannier-Stark states. The resulting high-field drift velocity falls with increasing field strength in a series of steps. Thus, we find a structured negative differential mobility at large electric fields
Palacios, M.A.; Caffarri, S.; Bassi, R.; Grondelle, van R.; Amerongen, van H.
2004-01-01
The electric-field induced absorption changes (Stark effect) of reconstituted light-harvesting complex II (LHCII) in different oligomerisation states - monomers and trimers - with different xanthophyll content have been probed at 77 K. The Stark spectra of the reconstituted control samples,
Rydberg-Stark states of Positronium for atom optics
International Nuclear Information System (INIS)
Alonso, A M; Cooper, B S; Deller, A; Hogan, S D; Wall, T E; Cassidy, D B
2015-01-01
Positronium atoms were produced in Rydberg states by means of a two-step optical excitation process (1s→2p→nd/ns). The n = 11 Rydberg-Stark manifold has been studied using different laser polarizations providing greater control over the electric dipole moment. (paper)
DC Stark addressing for quantum memory in Tm:YAG
Gerasimov, Konstantin; Minnegaliev, Mansur; Urmancheev, Ravil; Moiseev, Sergey
2017-10-01
We observed a linear DC Stark effect for 3H6 - 3H4 optical transition of Tm3+ ions in Y3Al5O12. We observed that application of electric field pulse suppresses the two-pulse photon echo signal. If we then apply a second electric pulse of opposite polarity the echo signal is restored again, which indicates the linear nature of the observed effect. The effect is present despite the D2 symmetry of the Tm3+ sites that prohibits a linear Stark effect. Experimental data analysis shows that the observed electric field influence can be attributed to defects that break the local crystal field symmetry near Tm3+ ions. Using this effect we demonstrate selective retrieval of light pulses in two-pulse photon echo.
Supersonic Molecular Beam Optical Stark Spectroscopy of MnH.
Gengler, Jamie; Ma, Tongmei; Harrison, Jeremy; Steimle, Timothy
2006-03-01
The large moment of inertia, large magnetic moment, and possible large permanent electric dipole moment of manganese monohydride, MnH, makes it a prime candidate for ultra-cold molecule production via Stark deceleration and magnetic trapping. Here we report the first molecular beam production of MnH and the analysis of the Stark effect in the (0,0) A^7 π -- X^ 7σ^+ band. The sample was prepared by laser ablation of solid Mn in an H2 supersonic expansion. The low rotational temperature (MnH and the analysis of T.D. Varberg, J.A. Gray, R.W. Field, and A.J. Merer, J. Mol. Spec. 156, 296-318 (1992). I.E. Gordon, D.R.T. Appadoo, A. Shayesteh, K.A. Walker, and P.F. Bernath, J. Mol. Spec., 229, 145-149 (2005).
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
Dynamic Stark broadening as the Dicke narrowing effect
International Nuclear Information System (INIS)
Calisti, A.; Mosse, C.; Ferri, S.; Talin, B.; Rosmej, F.; Bureyeva, L. A.; Lisitsa, V. S.
2010-01-01
A very fast method to account for charged particle dynamics effects in calculations of spectral line shape emitted by plasmas is presented. This method is based on a formulation of the frequency fluctuation model (FFM), which provides an expression of the dynamic line shape as a functional of the static distribution of frequencies. Thus, the main numerical work rests on the calculation of the quasistatic Stark profile. This method for taking into account ion dynamics allows a very fast and accurate calculation of Stark broadening of atomic hydrogen high-n series emission lines. It is not limited to hydrogen spectra. Results on helium-β and Lyman-α lines emitted by argon in microballoon implosion experiment conditions compared with experimental data and simulation results are also presented. The present approach reduces the computer time by more than 2 orders of magnitude as compared with the original FFM with an improvement of the calculation precision, and it opens broad possibilities for its application in spectral line-shape codes.
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
Stark resonances: asymptotics and distributional Borel sum
International Nuclear Information System (INIS)
Caliceti, E.; Grecchi, V.; Maioli, M.
1993-01-01
We prove that the Stark effect perturbation theory of a class of bound states uniquely determines the position and the width of the resonances by Distributional Borel Sum. In particular the small field asymptotics of the width is uniquely related to the large order asymptotics of the perturbation coefficients. Similar results apply to all the ''resonances'' of the anharmonic and double well oscillators. (orig.)
A Stark-tuned, far-infrared laser for high frequency plasma diagnostics
International Nuclear Information System (INIS)
Mansfield, D.K.; Vocaturo, M.; Guttadora, L.; Rockmore, M.; Micai, K.; Krug, P.A.
1992-03-01
A Stark-tuned optically pumped far-infrared methanol laser operating at 119 micrometers has been built. The laser is designed to operate at high power while exhibiting a well-separated Stark doublet. At a pump power of 65 Watts and electric field of 1 kV/cm the laser has delivered over 100 mW c.w. while exhibiting a frequency splitting of 34 MHz. These parameters indicate that this laser would be suitable for use in the present generation of modulated interferometers on large thermonuclear plasma devices. The achieved modulation frequency is more than an order of magnitude higher than could be achieved using standard techniques
Stark effect in Rydberg states of helium and barium
International Nuclear Information System (INIS)
Lahaije, C.T.W.
1989-01-01
This thesis, which deals with the effect of an electric field up to moderate field strengths on atoms with two valence electrons outside closed shells, in casu helium and barium, contains chapter in which the linear Stark effect in the 1 snp 1, 3 p Rydberg states of helium (n around 40) has been studied in a CW laser-atomic beam experiment. The evolution of the angular momentum manifolds into the n-mixing regime was followed and avoided level crossings were observed. Stark manifolds were also calculated by diagonalization of the complete energy matrix in the presence of an electric field. It turned out to be necessary to include up to five n-values in the calculations already at moderate values of the field to reproduce the data within the experimental accuracy (a few MHz), especially in the regime of the avoided crossings. (author). 147 refs.; 30 figs.; 8 tabs
Stark broadening of potassium ns-4p and nd-4p lines in a wall-stabilized arc
International Nuclear Information System (INIS)
Hohimer, J.P.
1984-01-01
Stark-width measurements are reported for lines in the ns-4p (n = 7--10) and nd-4p (n = 5--8) series in neutral potassium (K I). These measurements were made by observing the end-on emission from a low pressure (20 Torr) potassium-argon wall-stabilized arc source. The on-axis electron density and temperature in the 20-A arc were (2.0 +- 0.2) x 10 15 cm -3 and 2955 +- 100 K, respectively. The experimentally determined Stark widths were compared with the theoretical values calculated by Griem. The measured Stark widths agreed with theory to within 30% for lines in the ns-4p series; while the measured Stark widths of the nd-4p series lines were only one-third of the theoretical values
Modeling of hydrogen Stark line shapes with kinetic theory methods
Rosato, J.; Capes, H.; Stamm, R.
2012-12-01
The unified formalism for Stark line shapes is revisited and extended to non-binary interactions between an emitter and the surrounding perturbers. The accuracy of this theory is examined through comparisons with ab initio numerical simulations.
Atomic Models for Motional Stark Effects Diagnostics
Energy Technology Data Exchange (ETDEWEB)
Gu, M F; Holcomb, C; Jayakuma, J; Allen, S; Pablant, N A; Burrell, K
2007-07-26
We present detailed atomic physics models for motional Stark effects (MSE) diagnostic on magnetic fusion devices. Excitation and ionization cross sections of the hydrogen or deuterium beam traveling in a magnetic field in collisions with electrons, ions, and neutral gas are calculated in the first Born approximation. The density matrices and polarization states of individual Stark-Zeeman components of the Balmer {alpha} line are obtained for both beam into plasma and beam into gas models. A detailed comparison of the model calculations and the MSE polarimetry and spectral intensity measurements obtained at the DIII-D tokamak is carried out. Although our beam into gas models provide a qualitative explanation for the larger {pi}/{sigma} intensity ratios and represent significant improvements over the statistical population models, empirical adjustment factors ranging from 1.0-2.0 must still be applied to individual line intensities to bring the calculations into full agreement with the observations. Nevertheless, we demonstrate that beam into gas measurements can be used successfully as calibration procedures for measuring the magnetic pitch angle through {pi}/{sigma} intensity ratios. The analyses of the filter-scan polarization spectra from the DIII-D MSE polarimetry system indicate unknown channel and time dependent light contaminations in the beam into gas measurements. Such contaminations may be the main reason for the failure of beam into gas calibration on MSE polarimetry systems.
RLE (Research Laboratory of Electronics) Progress Report Number 126.
1984-01-01
Loudness 184 26.3 Binaural Hearing 186 S.26.4 Hearing Aid Research 188 26.5 Discrimination of Spectral Shape 191 26.6 Tactile Perception of Speech... beating in the pulse. It is these high intensities which are responsible for large A.C. Stark shifts and ionization RLE P.R. No. 126 12 * . . . Atomic...Department of Aeronautics and Astronautics, Massachusetts Institute of Technology, 1984. 26.3 Binaural Hearing National Institutes of Health (Grant
ZEST: A Fast Code for Simulating Zeeman-Stark Line-Shape Functions
Directory of Open Access Journals (Sweden)
Franck Gilleron
2018-03-01
Full Text Available We present the ZEST code, dedicated to the calculation of line shapes broadened by Zeeman and Stark effects. As concerns the Stark effect, the model is based on the Standard Lineshape Theory in which ions are treated in the quasi-static approximation, whereas the effects of electrons are represented by weak collisions in the framework of a binary collision relaxation theory. A static magnetic field may be taken into account in the radiator Hamiltonian in the dipole approximation, which leads to additional Zeeman splitting patterns. Ion dynamics effects are implemented using the fast Frequency-Fluctuation Model. For fast calculations, the static ion microfield distribution in the plasma is evaluated using analytic fits of Monte-Carlo simulations, which depend only on the ion-ion coupling parameter and the electron-ion screening factor.
Single-cell atomic quantum memory for light
International Nuclear Information System (INIS)
Opatrny, Tomas
2006-01-01
Recent experiments demonstrating atomic quantum memory for light [B. Julsgaard et al., Nature 432, 482 (2004)] involve two macroscopic samples of atoms, each with opposite spin polarization. It is shown here that a single atomic cell is enough for the memory function if the atoms are optically pumped with suitable linearly polarized light, and quadratic Zeeman shift and/or ac Stark shift are used to manipulate rotations of the quadratures. This should enhance the performance of our quantum memory devices since less resources are needed and losses of light in crossing different media boundaries are avoided
Mass shift of charmonium states in p bar A collision
Wolf, György; Balassa, Gábor; Kovács, Péter; Zétényi, Miklós; Lee, Su Houng
2018-05-01
The masses of the low lying charmonium states, namely, the J / Ψ, Ψ (3686), and Ψ (3770) are shifted downwards due to the second order Stark effect. In p bar +Au collisions at 6-10 GeV we study their in-medium propagation. The time evolution of the spectral functions of these charmonium states is studied with a Boltzmann-Uehling-Uhlenbeck (BUU) type transport model. We show that their in-medium mass shift can be observed in the dilepton spectrum. Therefore, by observing the dileptonic decay channel of these low lying charmonium states, especially for Ψ (3686), we can gain information about the magnitude of the gluon condensate in nuclear matter. This measurement could be performed at the upcoming PANDA experiment at FAIR.
Theoretical investigation of stark effect on shallow donor binding energy in InGaN spherical QD-QW
International Nuclear Information System (INIS)
El Ghazi, Haddou; Jorio, Anouar; Zorkani, Izeddine
2013-01-01
In this paper, a simultaneous study of electric field and impurity's position effects on the ground-state shallow-donor binding energy in GaN|InGaN|GaN spherical quantum dot-quantum well (SQD-QW) as a function of the ratio of the inner and the outer radius is reported. The calculations are investigated using variational approach within the framework of the effective-mass approximation. The numerical results show that: (i) the binding energy is strongly affected by the external electric field and the SQD-QW dimension, (ii) a critical value of spherical system's radius is obtained constituting the limit of three dimension confinement and spherical thin layer confinement and (iii) the Stark shift increases with increasing electric field and it is more pronounced around the position of the impurity corresponding to the binding energy maxima than in the spherical layer extremities
Klepper, C. C.; Martin, E. H.; Isler, R. C.; Colas, L.; Hillairet, J.; Marandet, Y.; Lotte, Ph.; Colledani, G.; Martin, V.; Hillis, D. L.; Harris, J. H.; Saoutic, B.
2011-10-01
Computational models of the interaction between RF waves and the scrape-off layer plasma near ion cyclotron resonant heating (ICRH) and lower hybrid current drive launch antennas are continuously improving. These models mainly predict the RF electric fields produced in the SOL and, therefore, the best measurement for verification of these models would be a direct measurement of these electric fields. Both types of launch antennas are used on Tore Supra and are designed for high power (up to 4MW/antenna) and long pulse (> > 25s) operation. Direct, non-intrusive measurement of the RF electric fields in the vicinity of these structures is achieved by fitting spectral profiles of deuterium Balmer-alpha and Balmer-beta to a model that includes the dynamic, external-field Stark effect, as well as Zeeman splitting and Doppler broadening mechanisms. The measurements are compared to the mentioned, near-field region, RF antenna models. *Work supported in part by the US DOE under Contract No. DE-AC05-00OR22725 with UT-Battelle, LLC.
Comparison of three Stark problem solution techniques for the bounded case
Hatten, Noble; Russell, Ryan P.
2015-01-01
Three methods of obtaining solutions to the Stark problem—one developed by Lantoine and Russell using Jacobi elliptic and related functions, one developed by Biscani and Izzo using Weierstrass elliptic and related functions, and one developed by Pellegrini, Russell, and Vittaldev using and Taylor series extended to the Stark problem—are compared qualitatively and quantitatively for the bounded motion case. For consistency with existing available code for the series solution, Fortran routines of the Lantoine method and Biscani method are newly implemented and made available. For these implementations, the Lantoine formulation is found to be more efficient than the Biscani formulation in the propagation of a single trajectory segment. However, for applications for which acceptable accuracy may be achieved by orders up to 16, the Pellegrini series solution is shown to be more efficient than either analytical method. The three methods are also compared in the propagation of sequentially connected trajectory segments in a low-thrust orbital transfer maneuver. Separate tests are conducted for discretizations between 8 and 96 segments per orbit. For the series solution, the interaction between order and step size leads to computation times that are nearly invariable to discretization for a given truncation error tolerance over the tested range of discretizations. This finding makes the series solution particularly attractive for mission design applications where problems may require both coarse and fine discretizations. Example applications include the modeling of low-thrust propulsion and time-varying perturbations—problems for which the efficient propagation of relatively short Stark segments is paramount because the disturbing acceleration generally varies continuously.
Vacuum Bloch-Siegert shift in Landau polaritons with ultra-high cooperativity
Li, Xinwei; Bamba, Motoaki; Zhang, Qi; Fallahi, Saeed; Gardner, Geoff C.; Gao, Weilu; Lou, Minhan; Yoshioka, Katsumasa; Manfra, Michael J.; Kono, Junichiro
2018-06-01
A two-level system resonantly interacting with an a.c. magnetic or electric field constitutes the physical basis of diverse phenomena and technologies. However, Schrödinger's equation for this seemingly simple system can be solved exactly only under the rotating-wave approximation, which neglects the counter-rotating field component. When the a.c. field is sufficiently strong, this approximation fails, leading to a resonance-frequency shift known as the Bloch-Siegert shift. Here, we report the vacuum Bloch-Siegert shift, which is induced by the ultra-strong coupling of matter with the counter-rotating component of the vacuum fluctuation field in a cavity. Specifically, an ultra-high-mobility two-dimensional electron gas inside a high-Q terahertz cavity in a quantizing magnetic field revealed ultra-narrow Landau polaritons, which exhibited a vacuum Bloch-Siegert shift up to 40 GHz. This shift, clearly distinguishable from the photon-field self-interaction effect, represents a unique manifestation of a strong-field phenomenon without a strong field.
Surface Acoustic Bloch Oscillations, the Wannier-Stark Ladder, and Landau-Zener Tunneling in a Solid
de Lima, M. M., Jr.; Kosevich, Yu. A.; Santos, P. V.; Cantarero, A.
2010-04-01
We present the experimental observation of Bloch oscillations, the Wannier-Stark ladder, and Landau-Zener tunneling of surface acoustic waves in perturbed grating structures on a solid substrate. A model providing a quantitative description of our experimental observations, including multiple Landau-Zener transitions of the anticrossed surface acoustic Wannier-Stark states, is developed. The use of a planar geometry for the realization of the Bloch oscillations and Landau-Zener tunneling allows a direct access to the elastic field distribution. The vertical surface displacement has been measured by interferometry.
International Nuclear Information System (INIS)
Govorov, A.O.
1993-08-01
Interband optical absorption in the Wannier-Stark ladder in the presence of the electron-LO-phonon resonance is investigated theoretically. The electron-LO-phonon resonance occurs when the energy spacing between adjacent Stark-ladder levels coincides with the LO-phonon energy. We propose a model describing the polaron effect in a superlattice. Calculations show that the absorption line shape is strongly modified due to the polaron effect under the electron-LO-phonon resonance condition. We consider optical phenomena in a normal magnetic field that leads to enhancement of polaron effects. (author). 17 refs, 5 figs
Determination of Stark parameters by cross-calibration in a multi-element laser-induced plasma
Liu, Hao; Truscott, Benjamin S.; Ashfold, Michael N. R.
2016-05-01
We illustrate a Stark broadening analysis of the electron density Ne and temperature Te in a laser-induced plasma (LIP), using a model free of assumptions regarding local thermodynamic equilibrium (LTE). The method relies on Stark parameters determined also without assuming LTE, which are often unknown and unavailable in the literature. Here, we demonstrate that the necessary values can be obtained in situ by cross-calibration between the spectral lines of different charge states, and even different elements, given determinations of Ne and Te based on appropriate parameters for at least one observed transition. This approach enables essentially free choice between species on which to base the analysis, extending the range over which these properties can be measured and giving improved access to low-density plasmas out of LTE. Because of the availability of suitable tabulated values for several charge states of both Si and C, the example of a SiC LIP is taken to illustrate the consistency and accuracy of the procedure. The cross-calibrated Stark parameters are at least as reliable as values obtained by other means, offering a straightforward route to extending the literature in this area.
Theoretical investigation of stark effect on shallow donor binding energy in InGaN spherical QD-QW
Energy Technology Data Exchange (ETDEWEB)
El Ghazi, Haddou, E-mail: hadghazi@gmail.com [Solid State Physics Laboratory, Faculty of Science, Dhar EL Mehrez, BP 1796 Fes-Atlas (Morocco); Mathématiques spéciales, CPGE Kénitra, Chakib Arsalane Street (Morocco); Jorio, Anouar; Zorkani, Izeddine [Solid State Physics Laboratory, Faculty of Science, Dhar EL Mehrez, BP 1796 Fes-Atlas (Morocco)
2013-08-01
In this paper, a simultaneous study of electric field and impurity's position effects on the ground-state shallow-donor binding energy in GaN|InGaN|GaN spherical quantum dot-quantum well (SQD-QW) as a function of the ratio of the inner and the outer radius is reported. The calculations are investigated using variational approach within the framework of the effective-mass approximation. The numerical results show that: (i) the binding energy is strongly affected by the external electric field and the SQD-QW dimension, (ii) a critical value of spherical system's radius is obtained constituting the limit of three dimension confinement and spherical thin layer confinement and (iii) the Stark shift increases with increasing electric field and it is more pronounced around the position of the impurity corresponding to the binding energy maxima than in the spherical layer extremities.
Excitonic dynamical Franz-Keldysh effect
DEFF Research Database (Denmark)
Nordstrøm, K.B.; Johnsen, Kristinn; Allen, S.J.
1998-01-01
The dynamical Franz-Keldysh effect is exposed by exploring near-band-gap absorption in the presence of intense THz electric fields. It bridges the gap between the de Franz-Keldysh effect and multiphoton absorption and competes with the THz ac Stark effect in shifting the energy of the excitonic...... resonance. A theoretical model which includes the strong THz field nonperturbatively via a nonequilibrium Green functions technique is able to describe the dynamical Franz-Keldysh effect in the presence of excitonic absorption....
International Nuclear Information System (INIS)
Hsieh, Tien-Yu; Chang, Ting-Chang; Chen, Te-Chih; Tsai, Ming-Yen; Chen, Yu-Te
2013-01-01
This paper investigates the degradation mechanism of amorphous InGaZnO thin-film transistors under DC and AC gate bias stress. Comparing the degradation behavior at equal accumulated effective stress time, more pronounced threshold voltage shift under AC positive gate bias stress in comparison with DC stress indicates extra electron-trapping phenomenon that occurs in the duration of rising/falling time in pulse. Contrarily, illuminated AC negative gate bias stress exhibits much less threshold voltage shift than DC stress, suggesting that the photo-generated hole does not have sufficient time to drift to the interface of IGZO/gate insulator and causes hole-trapping under AC operation. Since the evolution of threshold voltage fits the stretched-exponential equation well, the different degradation tendencies under DC/AC stress can be attributed to the different electron- and hole-trapping efficiencies, and this is further verified by varying pulse waveform. - Highlights: ► Static and dynamic gate bias stresses are imposed on InGaZnO TFTs. ► Dynamic positive gate bias induces more pronounced threshold voltage shift. ► Static negative-bias illumination stress induces more severe threshold voltage shift. ► Evolution of threshold voltage fits the stretched-exponential equation well
Strong-field dissociation dynamics
International Nuclear Information System (INIS)
DiMauro, L.F.; Yang, Baorui.
1993-01-01
The strong-field dissociation behavior of diatomic molecules is examined under two distinctive physical scenarios. In the first scenario, the dissociation of the isolated hydrogen and deuterium molecular ions is discussed. The dynamics of above-threshold dissociation (ATD) are investigated over a wide range of green and infrared intensities and compared to a dressed-state model. The second situation arises when strong-field neutral dissociation is followed by ionization of the atomic fragments. The study results in a direct measure of the atomic fragment's ac-Stark shift by observing the intensity-dependent shifts in the electron or nuclear fragment kinetic energy. 8 figs., 14 refs
Improved transistorized AC motor controller for battery powered urban electric passenger vehicles
Peak, S. C.
1982-01-01
An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.
Developmental characters of Pseitina iijimae (Jordan and Starks), bothid flat fishes- pisces
Digital Repository Service at National Institute of Oceanography (India)
Devi, C.B.L.
Post larval stages of Psettina iQimae (Jordan and Starks) ranging from 1.8 mm NL to 44.6 mm SL collected during Naga Expedition and International Indian Ocean Expedition (JIOE) are described The characteristics which help to identify larval stages...
A Riemann-Hilbert approach to the inverse problem for the Stark operator on the line
Its, A.; Sukhanov, V.
2016-05-01
The paper is concerned with the inverse scattering problem for the Stark operator on the line with a potential from the Schwartz class. In our study of the inverse problem, we use the Riemann-Hilbert formalism. This allows us to overcome the principal technical difficulties which arise in the more traditional approaches based on the Gel’fand-Levitan-Marchenko equations, and indeed solve the problem. We also produce a complete description of the relevant scattering data (which have not been obtained in the previous works on the Stark operator) and establish the bijection between the Schwartz class potentials and the scattering data.
Surface Acoustic Analog of Bloch Oscillations, Wannier-Stark Ladders and Landau-Zener Tunneling
de Lima, M. M.; Kosevich, Yu. A.; Santos, P. V.; Cantarero, A.
2011-12-01
In this contribution, we discuss the recent experimental demonstration of Wannier-Stark ladders, Bloch Oscillations and Landau Zener tunneling in a solid by means of surface acoustic waves propagating through perturbed grating structures.
Directory of Open Access Journals (Sweden)
Djeniže S.
2000-01-01
Full Text Available In order to find reliable Stark width data, needed in plasma spectroscopy comparision between the existing measured, calculated and predicted Stark width values was performed for ten singly ionized emitters: C, N, O, F, Ne Si, P, S, Cl and Ar in the lower lying 3s - 3p, 3p - 3d and 4s - 4p transitions. These emitters are present in many cosmic light sources. On the basis of the agreement between mentioned values 17 spectral lines from six singly ionized spectra have been recommended, for the first time, for plasma spectroscopy as spectral lines with reliable Stark width data. Critical analysis of the existing Stark width data is also given.
Can the Stark-Einstein law resolve the measurement problem from an animate perspective?
Thaheld, Fred H
2015-09-01
Analysis of the Stark-Einstein law as it applies to the retinal molecule, which is part of the rhodopsin molecule within the rod cells of the retina, reveals that it may provide the solution to the measurement problem from an animate perspective. That it represents a natural boundary where the Schrödinger equation or wave function automatically goes from linear to nonlinear while remaining in a deterministic state. It will be possible in the near future to subject this theory to empirical tests as has been previously proposed. This analysis provides a contrast to the many decades well studied and debated inanimate measurement problem and would represent an addition to the Stark-Einstein law involving information carried by the photon. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Motional Stark Effect measurements of the local magnetic field in high temperature fusion plasmas
Wolf, R. C.; Bock, A.; Ford, O. P.; Reimer, R.; Burckhart, A.; Dinklage, A.; Hobirk, J.; Howard, J.; Reich, M.; Stober, J.
2015-10-01
The utilization of the Motional Stark Effect (MSE) experienced by the neutral hydrogen or deuterium injected into magnetically confined high temperature plasmas is a well established technique to infer the internal magnetic field distribution of fusion experiments. In their rest frame, the neutral atoms experience a Lorentz electric field, EL = v × B, which results in a characteristic line splitting and polarized line emission. The different properties of the Stark multiplet allow inferring, both the magnetic field strength and the orientation of the magnetic field vector. Besides recording the full MSE spectrum, several types of polarimeters have been developed to measure the polarization direction of the Stark line emission. To test physics models of the magnetic field distribution and dynamics, the accuracy requirements are quite demanding. In view of these requirements, the capabilities and issues of the different techniques are discussed, including the influence of the Zeeman Effect and the sensitivity to radial electric fields. A newly developed Imaging MSE system, which has been tested on the ASDEX Upgrade tokamak, is presented. The sensitivity allows to resolve sawtooth oscillations. A shorter version of this contribution is due to be published in PoS at: 1st EPS conference on Plasma Diagnostics
Colón, C.; Moreno-Díaz, C.; Alonso-Medina, A.
2013-10-01
In the present work we report theoretical Stark widths and shifts calculated using the Griem semi-empirical approach, corresponding to 237 spectral lines of Mg III. Data are presented for an electron density of 1017 cm-3 and temperatures T = 0.5-10.0 (104K). The matrix elements used in these calculations have been determined from 23 configurations of Mg III: 2s22p6, 2s22p53p, 2s22p54p, 2s22p54f and 2s22p55f for even parity and 2s22p5ns (n = 3-6), 2s22p5nd (n = 3-9), 2s22p55g and 2s2p6np (n = 3-8) for odd parity. For the intermediate coupling (IC) calculations, we use the standard method of least-squares fitting from experimental energy levels by means of the Cowan computer code. Also, in order to test the matrix elements used in our calculations, we present calculated values of 70 transition probabilities of Mg III spectral lines and 14 calculated values of radiative lifetimes of Mg III levels. There is good agreement between our calculations and experimental radiative lifetimes. Spectral lines of Mg III are relevant in astrophysics and also play an important role in the spectral analysis of laboratory plasma. Theoretical trends of the Stark broadening parameter versus the temperature for relevant lines are presented. No values of Stark parameters can be found in the bibliography.
Stark broadening of resonant Cr II 3d5-3d44p spectral lines in hot stellar atmospheres
Simić, Z.; Dimitrijević, M. S.; Sahal-Bréchot, S.
2013-07-01
New Stark broadening parameters of interest for the astrophysical, laboratory and technological plasma modelling, investigations and analysis for nine resonant Cr II multiplets have been determined within the semiclassical perturbation approach. In order to demonstrate one possibility for their usage in astrophysical plasma research, obtained results have been applied to the analysis of the Stark broadening influence on stellar spectral line shapes.
Stark effect-dependent of ground-state donor binding energy in InGaN/GaN parabolic QWW
International Nuclear Information System (INIS)
El Ghazi, Haddou; Zorkani, Izeddine; Jorio, Anouar
2013-01-01
Using the finite-difference method within the quasi-one-dimensional effective potential model and effective mass approximation, the ground-state binding energy of hydrogenic shallow-donor impurity in wurtzite (WZ) (In,Ga)N/GaN parabolic transversal-section quantum-well wires (PQWWs) subjected to external electric field is investigated. An effective radius of a cylindrical QWW describing the strength of the lateral confinement is introduced. The results show that (i) the position of the largest electron probability density in x–y plane is located at a point and it is pushed along the negative sense by the electric field directed along the positive sense, (ii) the ground-state binding energy is largest for the impurity located at this point and starts to decrease when the impurity is away from this point, (iii) the ground-state binding energy decreases with increase in the external electric field and effective radius, and (iv) the Stark-shift increases with the increase of the external electric field and the effective radius
2016-02-05
near sat- uration limit of the probe intensity [16]. In such spectro - scopic techniques, while it is important to obtain spec- trum of the intended...There are a few literature that exist on the ultrafast UV -laser excitation of NO, e.g., Lopez-Marten et al. have shown that the laser intensi- ties in...observe ac-Stark shift (see Ref. [40]). Though, to the best of our knowledge, no study has been reported for ionization of NO by UV pulse of 236 nm at 10
Pablant, N A; Burrell, K H; Groebner, R J; Kaplan, D H; Holcomb, C T
2008-10-01
We describe a version of a motional Stark effect (MSE) diagnostic based on the relative line intensities and spacing of Stark split D(alpha) emission from the neutral beams. This system, named B-Stark, has been recently installed on the DIII-D tokamak. To find the magnetic pitch angle, we use the ratio of the intensities of the pi(3) and sigma(1) lines. These lines originate from the same upper level and so are not dependent on the level populations. In future devices, such as ITER, this technique may have advantages over diagnostics based on MSE polarimetry. We have done an optimization of the viewing direction for the available ports on DIII-D to choose the installation location. With this placement, we have a near optimal viewing angle of 59.6 degrees from the vertical direction. All hardware has been installed for one chord, and we have been routinely taking data since January 2007. We fit the spectra using a simple Stark model in which the upper level populations of the D(alpha) transition are treated as free variables. The magnitude and direction of the magnetic field obtained using this diagnostic technique compare well with measurements from MSE polarimetry and EFIT.
Science Translator: An Interview with Louisa Stark.
Stark, Louisa A
2015-07-01
The Genetics Society of America's Elizabeth W. Jones Award for Excellence in Education recognizes significant and sustained impact on genetics education. The 2015 awardee, Louisa Stark, has made a major impact on global access to genetics education through her work as director of the University of Utah Genetic Science Learning Center. The Center's Learn.Genetics and Teach.Genetics websites are the most widely used online genetic education resources in the world. In 2014, they were visited by 18 million students, educators, scientists, and members of the public. With over 60 million page views annually, Learn.Genetics is among the most used sites on the Web. Copyright © 2015 by the Genetics Society of America.
Asymmetry of Stark-broadened Layman lines from laser-produced plasmas
International Nuclear Information System (INIS)
Joyce, R.F.; Woltz, L.A.; Hooper, C.F. Jr.
1986-01-01
This paper discusses three significant causes of spectral line asymmetry: the ion-quadrupole interaction, the quadratic Stark effect and fine structure splitting that are included in the calculation of Lyman line profiles emitted by highly-ionized hydrogenic radiators in a dense, hot plasma. The line asymmetries are shown to be strongly dependent on the plasma density, indicating that the asymmetry may be of use as a density diagnostic
Structural, ac conductivity and dielectric properties of 3-formyl chromone
Ali, H. A. M.
2017-07-01
The structure for the powder of 3-formyl chromone was examined by X-ray diffraction technique in the 2θ° range ( 4° - 60° . The configuration of Al/3-formyl chromone/Al samples was designed. The electrical and dielectric properties were studied as a function of frequency (42- 5 × 106 Hz) and temperature (298-408K). The ac conductivity data of bulk of 3-formyl chromone varies as a power law with the frequency at different temperatures. The predominant mechanism for ac conduction was deduced. The ac conductivity shows a thermally activated process at different frequencies. The dielectric constant and dielectric loss were determined using the capacitance and dissipation factor measurements at different temperatures. The dielectric loss shows a peak of relaxation time that shifted to higher frequency with an increase in the temperature. The activation energy of the relaxation process was estimated.
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
The beginnings of our research on the laser cooling of atomic gases
International Nuclear Information System (INIS)
Wang Yuzhu
2011-01-01
Reminiscences of the beginning of our research on the laser cooling of atomic gases are recounted, describing what motivated us to progress from atomic clocks to laser cooling. At the beginning, we pondered upon the mechanism of laser cooling, such as the cooling of atoms in red shifted diffuse light in an integrating sphere and using light frequency shifting (the A.C. Stark effect). A description of the atomic beam experimental equipment in our lab, which was used in laser cooling, is given, and some experimental results that we obtained are displayed. Finally, we summarize our experiences and lessons learnt. In looking back on our arduous beginnings, we cherish the present, and look forward to a bright future. (authors)
Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies
Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.
2016-11-01
We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Coherent Addressing of Individual Neutral Atoms in a 3D Optical Lattice.
Wang, Yang; Zhang, Xianli; Corcovilos, Theodore A; Kumar, Aishwarya; Weiss, David S
2015-07-24
We demonstrate arbitrary coherent addressing of individual neutral atoms in a 5×5×5 array formed by an optical lattice. Addressing is accomplished using rapidly reconfigurable crossed laser beams to selectively ac Stark shift target atoms, so that only target atoms are resonant with state-changing microwaves. The effect of these targeted single qubit gates on the quantum information stored in nontargeted atoms is smaller than 3×10^{-3} in state fidelity. This is an important step along the path of converting the scalability promise of neutral atoms into reality.
Quantum confined Stark effect in Gaussian quantum wells: A tight-binding study
International Nuclear Information System (INIS)
Ramírez-Morales, A.; Martínez-Orozco, J. C.; Rodríguez-Vargas, I.
2014-01-01
The main characteristics of the quantum confined Stark effect (QCSE) are studied theoretically in quantum wells of Gaussian profile. The semi-empirical tight-binding model and the Green function formalism are applied in the numerical calculations. A comparison of the QCSE in quantum wells with different kinds of confining potential is presented
Quantum confined Stark effect in Gaussian quantum wells: A tight-binding study
Energy Technology Data Exchange (ETDEWEB)
Ramírez-Morales, A.; Martínez-Orozco, J. C.; Rodríguez-Vargas, I. [Unidad Académica de Física, Universidad Autónoma de Zacatecas, Calzada Solidaridad Esquina Con Paseo La Bufa S/N, 98060 Zacatecas, Zac. (Mexico)
2014-05-15
The main characteristics of the quantum confined Stark effect (QCSE) are studied theoretically in quantum wells of Gaussian profile. The semi-empirical tight-binding model and the Green function formalism are applied in the numerical calculations. A comparison of the QCSE in quantum wells with different kinds of confining potential is presented.
International Nuclear Information System (INIS)
Sardar, Dhiraj K.; Yow, Raylon M.; Gruber, John B.; Allik, Toomas H.; Zandi, Bahram
2006-01-01
Stark energy levels of the 4 F 3/2 , 4 I 9/2 , and 4 I 11/2 manifolds have been characterized using the room temperature fluorescence spectra for the 4 F 3/2 → 4 I 9/2 and 4 F 3/2 → 4 I 11/2 transitions of Nd 3+ (4f 3 ) in polycrystalline ceramic garnet Y 3 Al 5 O 12 (YAG). The emission cross-sections of the intermanifold transitions, 4 F 3/2 → 4 I 9/2 and 4 F 3/2 → 4 I 11/2 , as well as the principal inter-Stark transitions, R 1 →Z 5 (945.3 nm) and R 1 →Y 2 (1063.5 nm), have also been determined. These results are finally compared with those of Nd 3+ :YAG single crystal
Soliton motion in a parametrically ac-driven damped Toda lattice
International Nuclear Information System (INIS)
Rasmussen, K.O.; Malomed, B.A.; Bishop, A.R.; Groenbech-Jensen, N.
1998-01-01
We demonstrate that a staggered parametric ac driving term can support stable progressive motion of a soliton in a Toda lattice with friction, while an unstaggered driving force cannot. A physical context of the model is that of a chain of anharmonically coupled particles adsorbed on a solid surface of a finite size. The ac driving force is generated by a standing acoustic wave excited on the surface. Simulations demonstrate that the state left behind the moving soliton, with the particles shifted from their equilibrium positions, gradually relaxes back to the equilibrium state that existed before the passage of the soliton. The perturbation theory predicts that the ac-driven soliton exists if the amplitude of the drive exceeds a certain threshold. The analytical prediction for the threshold is in reasonable agreement with that found numerically. Collisions between two counterpropagating solitons is also simulated, demonstrating that the collisions are, effectively, fully elastic. copyright 1998 The American Physical Society
Raman-laser spectroscopy of Wannier-Stark states
International Nuclear Information System (INIS)
Tackmann, G.; Pelle, B.; Hilico, A.; Beaufils, Q.; Pereira dos Santos, F.
2011-01-01
Raman lasers are used as a spectroscopic probe of the state of atoms confined in a shallow one-dimensional (1D) vertical lattice. For sufficiently long laser pulses, resolved transitions in the bottom band of the lattice between Wannier Stark states corresponding to neighboring wells are observed. Couplings between such states are measured as a function of the lattice laser intensity and compared to theoretical predictions, from which the lattice depth can be extracted. Limits to the linewidth of these transitions are investigated. Transitions to higher bands can also be induced, as well as between transverse states for tilted Raman beams. All these features allow for a precise characterization of the trapping potential and for an efficient control of the atomic external degrees of freedom.
International Nuclear Information System (INIS)
Sakai, Hisashi; Takiyama, Ken; Kimura, Masahiko; Yamasaki, Motokuni; Fujita, Toshiaki; Oda, Toshiatsu; Kawasaki, Ken.
1993-01-01
The electric quadrupole moment transition and the Stark effect are investigated in a He hollow cathode discharge with laser-induced fluorescence method. It is shown that the forbidden transition from 2 1 S to 3 1 D in the negative glow is dominantly due to the quadrupole moment transition. This absorption coefficient is obtained from the laser-induced fluorescence intensity measurement in which the collisional transfers are taken into account. The result agrees with the theoretical coefficient. In the cathode dark space the fluorescence due to the Stark effect is also observed. Spatial distribution of the fluorescence is discussed, compared with the electric field distribution in the dark space. (author)
Imaging motional Stark effect measurements at ASDEX Upgrade
Energy Technology Data Exchange (ETDEWEB)
Ford, O. P.; Burckhart, A.; McDermott, R.; Pütterich, T.; Wolf, R. C. [Max-Planck Institut für Plasmaphysik, Greifswald/Garching (Germany)
2016-11-15
This paper presents an overview of results from the Imaging Motional Stark Effect (IMSE) diagnostic obtained during its first measurement campaign at ASDEX Upgrade since installation as a permanent diagnostic. A brief overview of the IMSE technique is given, followed by measurements of a standard H-mode discharge, which are compared to equilibrium reconstructions showing good agreement where expected. The development of special discharges for the calibration of pitch angle is reported and safety factor profile changes during sawteeth crashes are shown, which can be resolved to a few percent due to the high sensitivity at good time resolution of the new IMSE system.
Optimal beam sources for Stark decelerators in collision experiments: a tutorial review
International Nuclear Information System (INIS)
Vogels, Sjoerd N.; Gao, Zhi; Meerakker, Sebastiaan Y.T. van de
2015-01-01
With the Stark deceleration technique, packets of molecules with a tunable velocity, a narrow velocity spread, and a high state purity can be produced. These tamed molecular beams find applications in high resolution spectroscopy, cold molecule trapping, and controlled scattering experiments. The quality and purity of the packets of molecules emerging from the decelerator critically depend on the specifications of the decelerator, but also on the characteristics of the molecular beam pulse with which the decelerator is loaded. We consider three frequently used molecular beam sources, and discuss their suitability for molecular beam deceleration experiments, in particular with the application in crossed beam scattering in mind. The performance of two valves in particular, the Nijmegen Pulsed Valve and the Jordan Valve, is illustrated by decelerating ND 3 molecules in a 2.6 meter-long Stark decelerator. We describe a protocol to characterize the valve, and to optimally load the pulse of molecules into the decelerator. We characterize the valves regarding opening time duration, optimal valve-to-skimmer distance, mean velocity, velocity spread, state purity, and relative intensity. (orig.)
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Plasma density characterization at SPARC-LAB through Stark broadening of Hydrogen spectral lines
Energy Technology Data Exchange (ETDEWEB)
Filippi, F., E-mail: francesco.filippi@roma1.infn.it [Dipartimento di Scienze di Base e Applicate per l' Ingegneria (SBAI), ‘Sapienza’ Università di Roma, Via A. Scarpa 14-16, 00161 Roma (Italy); INFN-Roma1, Piazzale Aldo Moro, 2 00161 Roma (Italy); Anania, M.P.; Bellaveglia, M.; Biagioni, A.; Chiadroni, E. [Laboratori Nazionali di Frascati, INFN, Via E. Fermi, Frascati (Italy); Cianchi, A. [Dipartimento di Fisica, Universitá di Roma Tor Vergata, Via della Ricerca Scientifica 1, 00133 Roma (Italy); Di Giovenale, D.; Di Pirro, G.; Ferrario, M. [Laboratori Nazionali di Frascati, INFN, Via E. Fermi, Frascati (Italy); Mostacci, A.; Palumbo, L. [Dipartimento di Scienze di Base e Applicate per l' Ingegneria (SBAI), ‘Sapienza’ Università di Roma, Via A. Scarpa 14-16, 00161 Roma (Italy); INFN-Roma1, Piazzale Aldo Moro, 2 00161 Roma (Italy); Pompili, R.; Shpakov, V.; Vaccarezza, C.; Villa, F. [Laboratori Nazionali di Frascati, INFN, Via E. Fermi, Frascati (Italy); Zigler, A. [Hebrew University of Jerusalem, Jerusalem 91904 (Israel)
2016-09-01
Plasma-based acceleration techniques are of great interest for future, compact accelerators due to their high accelerating gradient. Both particle-driven and laser-driven Plasma Wakefield Acceleration experiments are foreseen at the SPARC-LAB Test Facility (INFN National Laboratories of Frascati, Italy), with the aim to accelerate high-brightness electron beams. In order to optimize the efficiency of the acceleration in the plasma and preserve the quality of the accelerated beam, the knowledge of the plasma electron density is mandatory. The Stark broadening of the Hydrogen spectral lines is one of the candidates used to characterize plasma density. The implementation of this diagnostic for plasma-based experiments at SPARC-LAB is presented. - Highlights: • Stark broadening of Hydrogen lines has been measured to determine plasma density. • Plasma density diagnostic tool for plasma-based experiments at SPARC-LAB is presented. • Plasma density in tapered laser triggered ablative capillary discharge was measured. • Results of plasma density measurements in ablative capillaries are shown.
Plasma density characterization at SPARC-LAB through Stark broadening of Hydrogen spectral lines
International Nuclear Information System (INIS)
Filippi, F.; Anania, M.P.; Bellaveglia, M.; Biagioni, A.; Chiadroni, E.; Cianchi, A.; Di Giovenale, D.; Di Pirro, G.; Ferrario, M.; Mostacci, A.; Palumbo, L.; Pompili, R.; Shpakov, V.; Vaccarezza, C.; Villa, F.; Zigler, A.
2016-01-01
Plasma-based acceleration techniques are of great interest for future, compact accelerators due to their high accelerating gradient. Both particle-driven and laser-driven Plasma Wakefield Acceleration experiments are foreseen at the SPARC-LAB Test Facility (INFN National Laboratories of Frascati, Italy), with the aim to accelerate high-brightness electron beams. In order to optimize the efficiency of the acceleration in the plasma and preserve the quality of the accelerated beam, the knowledge of the plasma electron density is mandatory. The Stark broadening of the Hydrogen spectral lines is one of the candidates used to characterize plasma density. The implementation of this diagnostic for plasma-based experiments at SPARC-LAB is presented. - Highlights: • Stark broadening of Hydrogen lines has been measured to determine plasma density. • Plasma density diagnostic tool for plasma-based experiments at SPARC-LAB is presented. • Plasma density in tapered laser triggered ablative capillary discharge was measured. • Results of plasma density measurements in ablative capillaries are shown.
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
International Nuclear Information System (INIS)
Watahiki, M.; Murakami, M.; Yoo, S.I.
1997-01-01
We report the temperature and magnetic field dependence of the complex a.c. susceptibility with bias d.c. magnetic fields for melt-processed Nd-Ba-Cu-O superconductor. The onset temperature (T onset ) of the real part of a.c. susceptibility shifted to a lower temperature with increasing d.c. magnetic field. The superconducting transition temperature (T c ) determined by d.c. magnetization measurements did not shift appreciably to a lower-temperature region with increasing d.c. magnetic field. The distinction between T onset and T c indicates that the a.c. susceptibility measurements detect the energy dissipation generated by the motion of flux lines. We have also measured flux profiles and found that there was no appreciable change in flux penetration below and above the peak field, which suggests that the peak effect in Nd-Ba-Cu-O is not due to the phase transition in the flux line lattice. (author)
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
International Nuclear Information System (INIS)
Bakshi, V.
1988-01-01
The Stark widths of seven Ar I transitions are reported. Axial line shape data from an atmospheric d.c. argon plasma jet were Abel-inverted to obtain radial line shapes. The electron-density was determined by Stark width measurements of the hydrogen H β transition. In the electron-density region of ≤6 x 10 22 m -3 the experimental Ar I Stark widths are fitted to a linear dependence on the electron-density. Values of Stark width extrapolated to other electron densities are compared to measurements reported in the literature on the 4s-4p array. Experimental values are up to 45% smaller than those predicted by Griem's theory of Stark broadening. Conditions for local thermodynamic equilibrium (LTE) to exist in an atmospheric argon plasma jet were studied. The experiment measures the emission coefficient of seven Ar I transitions and the line shape of the hydrogen H beta transition. After transforming the side-on data into radial space the excited neutral argon atom-density and the electron-density are determined. It is found LTE does not exist below an electron-density of 6 x 10 33 m -3 in the experimental conditions
International Nuclear Information System (INIS)
Gleizes, A.; Benoit-Cattin, P.; Bordenave-Montesquieu, A.; Merchez, H.
1976-01-01
A detailed study is given of the influence of the Doppler shift and broadening on the spectra of electrons ejected by autoionization in collisions between heavy particles. General formulae have been obtained which permit the validity of results already published by other authors to be discussed. These results have been applied to the spectra of electrons ejected in He + -He collisions at 15 keV. The variation of the width of the autoionization peaks against ejection angle is well explained by Doppler broadening. On the contrary, the shape of these peaks cannot be due to the Doppler effect but rather to the Stark effect which is also studied in various experimental cases; it has been verified that the latter effect disappears in collisions between neutral particles for which symmetric peaks at 15 keV are obtained. (author)
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Directory of Open Access Journals (Sweden)
Dufour P.
2011-12-01
Full Text Available White dwarf stars are traditionally found to have surface compositions made primarily of hydrogen or helium. However, a new family has recently been uncovered, the so-called hot DQ white dwarfs, which have surface compositions dominated by carbon and oxygen with little or no trace of hydrogen and helium (Dufour et al. 2007, 2008, 2010. Deriving precise atmospheric parameters for these objects (such as the effective temperature and the surface gravity requires detailed modeling of spectral line profiles. Stark broadening parameters are of crucial importance in that context. We present preliminary results from our new generation of model atmospheres including the latest Stark broadening calculations for C II lines and discuss the implications as well as future work that remains to be done.
A novel wireless power and data transmission AC to DC converter for an implantable device.
Liu, Jhao-Yan; Tang, Kea-Tiong
2013-01-01
This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz.
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
Focused feasibility study of phytoremediation alternative for the Industrial Excess Landfill site in Stark County, Ohio. More information can be found on the NPL Fact Sheet for this site at www.epa.gov/region5/superfund/npl/ohio/OHD000377971.htm
International Nuclear Information System (INIS)
Jones, N J A; Minns, R S; Patel, R; Fielding, H H
2008-01-01
The Stark spectra of Rydberg states of NO below the υ + = 0 ionization limit, with principal quantum numbers n = 25-30, have been investigated in the presence of dc electric fields in the range 0-150 V cm -1 . The Stark states were accessed by two-colour, double-resonance excitation via the υ' = 0, N' = 0 rovibrational state of the A 2 Σ + state. The N( 2 D) atoms produced by predissociation were measured by (2 + 1) resonance-enhanced multiphoton ionization, and compared with pulsed-field ionization spectra of the bound Rydberg state population (Patel et al 2007 J. Phys. B: At. Mol. Opt. Phys. 40 1369)
Anti-Stokes emissions and determination of Stark sub-level diagram of Er3+ ions in KY3F10
International Nuclear Information System (INIS)
Boulma, E; Diaf, M; Jouart, J P; Bouffard, M; Doualan, J L; Moncorge, R
2006-01-01
We are interested, in this work, in determining the Stark sub-level of Er 3+ ions doping a KY 3 F 10 single crystal with a molar concentration of 1%. We have used a new method of measurement of energies of the ground level and emitting levels from excitation and anti-Stokes emission spectra recorded at liquid nitrogen temperature. This technique is based on a spectral analysis of the anti-Stokes emissions recorded after selective excitation with a red dye tunable laser. Thus, we could determine the Stark sub-levels of the ground and the principal emitting levels in the infrared, visible and near-UV ranges with a very good precision
A strontium lattice clock with reduced blackbody radiation shift
Energy Technology Data Exchange (ETDEWEB)
Al-Masoudi, Ali Khalas Anfoos
2016-09-30
Optical clocks have been quickly moving to the forefront of the frequency standards field due to their high spectral resolution, and therefore the potential high stability and accuracy. The accuracy and stability of the optical clocks are nowadays two orders of magnitude better than microwave Cs clocks, which realize the SI second. Envisioned applications of highly accurate optical clocks are to perform tests of fundamental physics, for example, searching for temporal drifts of the fine structure constant α, violations of the Local Position Invariance (LPI), dark matter and dark energy, or to performance relativistic geodesy. In this work, the uncertainty of a strontium lattice clock, based on the {sup 1}S{sub 0}-{sup 3}P{sub 0} transition in {sup 87}Sr, due to the blackbody radiation (BBR) shift has been reduced to less than 1 x 10{sup -18} by more than one order of magnitude compared to the previous evaluation of the BBR shift uncertainty in this clock. The BBR shift has been reduced by interrogating the atoms in a cryogenic environment. The systematic uncertainty of the cryogenic lattice clock is evaluated to be 1.3 x 10{sup -17} which is dominated by the uncertainty of the AC Stark shift of the lattice laser and the uncertainty contribution of the BBR shift is negligible. Concerning the instability of the clock, the detection noise of the clock has been measured, and a model linking noise and clock instability has been developed. This noise model shows that, in our lattice clock, quantum projection noise is reached if more than 130 atoms are interrogated. By combining the noise model with the degradation due to the Dick effect reflecting the frequency noise of the interrogation laser, the instability of the clock is estimated to be 1.6 x 10{sup -16}/√(τ/s) in regular operation. During this work, several high-accuracy comparisons to other atomic clocks have been performed, including several absolute frequency measurements. The Sr clock transition frequency
The influence of static fields on the dynamic Stark spectra of hydrogen Balmer lines
International Nuclear Information System (INIS)
Janssen, G.C.A.M.; Jayakumar, R.; Granneman, E.H.A.
1981-01-01
In plasmas atomic-line radiation is influenced by static and high frequency fields. A simple method of calculating the Stark profiles of the Balmer α and β lines for the case of one-dimensional fields is discussed. Using a Holtsmark field for the static component, the resulting profile of Balmer α shows a splitting of the satellites. (author)
Your Lung Operation: After Your Operation
Full Text Available ... Value-Based Payment Modifier Accountable Care Organizations Stark Law and Anti-Kickback Third Party Payors State Legislation ... Subscribe to SRGS Issues Contact and FAQs ACS Case Reviews in Surgery ACS Case Reviews in Surgery ...
Full Text Available ... Value-Based Payment Modifier Accountable Care Organizations Stark Law and Anti-Kickback Third Party Payors State Legislation ... Subscribe to SRGS Issues Contact and FAQs ACS Case Reviews in Surgery ACS Case Reviews in Surgery ...
Application of Stark Tuned Laser for Interferometry and Polarimetry in Plasmas
International Nuclear Information System (INIS)
H.K. Park; K.C. Lee; B. Deng; C.W. Domier; M. Johnson; B. Nathan; N.C. Luhmann, Jr.
2001-01-01
A Stark-tuned optically pumped far-infrared CH(subscript ''3'')OH laser at 119 mm has been successfully applied in the Far Infrared Tangential Interferometer/Polarimeter (FIReTIP) system for the National Spherical Torus Experiment (NSTX). The system will provide temporally and radially resolved 2-D electron density profile [n(subscript ''e'')(r,t)] and toroidal field profile [B(subscript ''T'')(r,t)] data. In the 2001 campaign, a single channel interferometer system has been operated and tested for the Faraday rotation measurement. A plan for improvement and upgrading of the FIReTIP is discussed
Stark broadening in the laser-induced Cu I and Cu II spectra
International Nuclear Information System (INIS)
Skočić, M; Burger, M; Nikolić, Z; Bukvić, S; Djeniže, S
2013-01-01
In this work we present the Stark widths (W) of 22 neutral (Cu I) and 100 singly ionized (Cu II) copper spectral lines that have been measured at 18 400 K and 19 300 K electron temperatures and 6.3 × 10 22 m −3 and 2.1 × 10 23 m −3 electron densities, respectively. The experiment is conducted in the laser-induced plasma—the Nd:YAG laser, operating at 532 nm, was used to produce plasma from the copper sample in the residual air atmosphere at a pressure of 8 Pa. The electron temperature and density were estimated by the Boltzmann-plot method and from the Saha equation. The investigated Cu I lines belong to the 4s–4p′, 4s 2 –4p″ and 4p′–4d′ transitions while Cu II spectral lines belong to the 4s–4p, 4p–5s, 4p–4d, 4p–4s 2 , 4d–4f and 4d–v transitions. Comparison with existing experimental data was possible only in the case of 17 Cu II lines due to a lack of experimental and theoretical values. The rest of the data, Stark widths of 22 Cu I and 83 Cu II lines are published for the first time. (paper)
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
Polaron effects on the dc- and ac-tunneling characteristics of molecular Josephson junctions
Wu, B. H.; Cao, J. C.; Timm, C.
2012-07-01
We study the interplay of polaronic effect and superconductivity in transport through molecular Josephson junctions. The tunneling rates of electrons are dominated by vibronic replicas of the superconducting gap, which show up as prominent features in the differential conductance for the dc and ac current. For relatively large molecule-lead coupling, a features that appears when the Josephson frequency matches the vibron frequency can be identified with an over-the-gap structure observed by Marchenkov [Nat. Nanotech. 1748-338710.1038/nnano.2007.2182, 481 (2007)]. However, we are more concerned with the weak-coupling limit, where resonant tunneling through the molecular level dominates. We find that certain features involving both Andreev reflection and vibron emission show an unusual shift of the bias voltage V at their maximum with the gate voltage Vg as V˜(2/3)Vg. Moreover, due to the polaronic effect, the ac Josephson current shows a phase shift of π when the bias eV is increased by one vibronic energy quantum ℏωv. This distinctive even-odd effect is explained in terms of the different sign of the coupling to vibrons of electrons and of Andreev-reflected holes.
Low-frequency, self-sustained oscillations in inductively coupled plasmas used for optical pumping
Energy Technology Data Exchange (ETDEWEB)
Coffer, J.; Encalada, N.; Huang, M.; Camparo, J. [Physical Sciences Laboratories, The Aerospace Corporation 2310, E. El Segundo Blvd., El Segundo, California 90245 (United States)
2014-10-28
We have investigated very low frequency, on the order of one hertz, self-pulsing in alkali-metal inductively-coupled plasmas (i.e., rf-discharge lamps). This self-pulsing has the potential to significantly vary signal-to-noise ratios and (via the ac-Stark shift) resonant frequencies in optically pumped atomic clocks and magnetometers (e.g., the atomic clocks now flying on GPS and Galileo global navigation system satellites). The phenomenon arises from a nonlinear interaction between the atomic physics of radiation trapping and the plasma's electrical nature. To explain the effect, we have developed an evaporation/condensation theory (EC theory) of the self-pulsing phenomenon.
Influence of the ac magnetic field frequency on the magnetoimpedance of amorphous wire
International Nuclear Information System (INIS)
Chen, A P; Garcia, C; Zhukov, A; Dominguez, L; Blanco, J M; Gonzalez, J
2006-01-01
Experimental and theoretical studies on the influence of ac magnetic field frequency on the axial diagonal (ζ zz ) and off-diagonal (ζ Φz ) components of the magnetoimpedance (MI) tensor in (Co 0.94 Fe 0.06 ) 72.5 Si 12.5 B 15 amorphous wires have been performed. The frequency (f) of an ac current flowing along the wire was varied from 1 to 20 MHz with the current amplitude less than 15 mA. In order to enhance the ζ Φz component, the amorphous wire was submitted to torsion annealing for developing and preserving a helical magnetic anisotropy in the surface of the wire. The experimental measurements show that the value of the impedance is proportional to the square-root of the ac current frequency, √f, in the vicinity of H ex K and this increase is due to the contribution of the resistance (real part of the impedance). The measurements also indicate that the peaks of the MI curve shift slightly towards higher field values with increasing f. In a theoretical study the magnetoimpedance expressions ζ zz and ζ Φz have been deduced using the Faraday law in combination with the solutions of the Maxwell and Landau-Lifshitz-Gilbert (LLG) equations. By analysing quantitatively the spectra of ζ zz and ζ Φz , the phenomenon of the shift in the peaks of the MI curve with f has been considered as a characteristic of the helical anisotropy in the domain structure of the wire surface
Improved signal analysis for motional Stark effect data
International Nuclear Information System (INIS)
Makowski, M.A.; Allen, S.L.; Ellis, R.; Geer, R.; Jayakumar, R.J.; Moller, J.M.; Rice, B.W.
2005-01-01
Nonideal effects in the optical train of the motional Stark effect diagnostic have been modeled using the Mueller matrix formalism. The effects examined are birefringence in the vacuum windows, an imperfect reflective mirror, and signal pollution due to the presence of a circularly polarized light component. Relations for the measured intensity ratio are developed for each case. These relations suggest fitting functions to more accurately model the calibration data. One particular function, termed the tangent offset model, is found to fit the data for all channels better than the currently used tangent slope function. Careful analysis of the calibration data with the fitting functions reveals that a nonideal effect is present in the edge array and is attributed to nonideal performance of a mirror in that system. The result of applying the fitting function to the analysis of our data has been to improve the equilibrium reconstruction
Stark parameters of some asymmetrical Si II lines
International Nuclear Information System (INIS)
Ferhat, B; Azzouz, Y; Redon, R; Ripert, M; Lesage, A
2012-01-01
Six lines of SiII are experimentally studied in pulsed plasma generated by Nd :Yag laser breakdown on pure solid silicon target. A set of experimental Stark parameters of asymmetrical lines are measured in temperature range from 14 000 K to 18 000 K (using Boltzmann plot). Calculated values of the electron density (using Griem's formula) vary from 1.7 to 6.1 × 10 23 m −3 . Processed spectral lines are 333.982 nm (3s 2 4p -3s 2 6s) and 397.746 nm, 399.177 nm, 399.801 nm, 401.622 nm (3d' 2 F 0 -4f' 4 G) and (3d' 2 F 0 - 4f' 2 G) of astrophysical interest. Asymmetrical line shapes are synthesized by a sum of two semi-Lorentzian distributions. The obtained fit is in good agreement with the measured spectra.
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Directory of Open Access Journals (Sweden)
Aguiar J.A.K.
1999-01-01
Full Text Available Flavobacterium heparinum is a soil bacterium that produces several mucopolysaccharidases such as heparinase, heparitinases I and II, and chondroitinases AC, B, C and ABC. The purpose of the present study was to optimize the preparation of F. heparinum chondroitinases, which are very useful tools for the identification and structural characterization of chondroitin and dermatan sulfates. We observed that during the routine procedure for cell disruption (ultrasound, 100 kHz, 5 min some of the chondroitinase B activity was lost. Using milder conditions (2 min, most of the chondroitinase B and AC protein was solubilized and the enzyme activities were preserved. Tryptic soy broth without glucose was the best culture medium both for bacterial growth and enzyme induction. Chondroitinases AC and B were separated from each other and also from glucuronidases and sulfatases by hydrophobic interaction chromatography on HP Phenyl-Sepharose. A rapid method for screening of the column fractions was also developed based on the metachromatic shift of the color of dimethylmethylene blue.
Schmidt, Burkhard; Friedrich, Bretislav
2014-02-14
We show that combined permanent and induced electric dipole interactions of linear polar and polarizable molecules with collinear electric fields lead to a sui generis topology of the corresponding Stark energy surfaces and of other observables - such as alignment and orientation cosines - in the plane spanned by the permanent and induced dipole interaction parameters. We find that the loci of the intersections of the surfaces can be traced analytically and that the eigenstates as well as the number of their intersections can be characterized by a single integer index. The value of the index, distinctive for a particular ratio of the interaction parameters, brings out a close kinship with the eigenproperties obtained previously for a class of Stark states via the apparatus of supersymmetric quantum mechanics.
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Progress on advanced dc and ac induction drives for electric vehicles
Schwartz, H. J.
1982-01-01
Progress is reported in the development of complete electric vehicle propulsion systems, and the results of tests on the Road Load Simulator of two such systems representative of advanced dc and ac drive technology are presented. One is the system used in the DOE's ETV-1 integrated test vehicle which consists of a shunt wound dc traction motor under microprocessor control using a transistorized controller. The motor drives the vehicle through a fixed ratio transmission. The second system uses an ac induction motor controlled by transistorized pulse width modulated inverter which drives through a two speed automatically shifted transmission. The inverter and transmission both operate under the control of a microprocessor. The characteristics of these systems are also compared with the propulsion system technology available in vehicles being manufactured at the inception of the DOE program and with an advanced, highly integrated propulsion system upon which technology development was recently initiated.
Zagonel, L. F.; Tizei, L. H. G.; Vitiello, G. Z.; Jacopin, G.; Rigutti, L.; Tchernycheva, M.; Julien, F. H.; Songmuang, R.; Ostasevicius, T.; de la Peña, F.; Ducati, C.; Midgley, P. A.; Kociak, M.
2016-05-01
We report on a detailed study of the intensity dependent optical properties of individual GaN/AlN quantum disks (QDisks) embedded into GaN nanowires (NW). The structural and optical properties of the QDisks were probed by high spatial resolution cathodoluminescence (CL) in a scanning transmission electron microscope (STEM). By exciting the QDisks with a nanometric electron beam at currents spanning over three orders of magnitude, strong nonlinearities (energy shifts) in the light emission are observed. In particular, we find that the amount of energy shift depends on the emission rate and on the QDisk morphology (size, position along the NW and shell thickness). For thick QDisks (>4 nm), the QDisk emission energy is observed to blueshift with the increase of the emission intensity. This is interpreted as a consequence of the increase of carriers density excited by the incident electron beam inside the QDisks, which screens the internal electric field and thus reduces the quantum confined Stark effect (QCSE) present in these QDisks. For thinner QDisks (energy shifts, marking the transition from unscreened to partially screened QCSE. From the threshold value we estimate the lifetime in the unscreened regime. These observations suggest that, counterintuitively, electrons of high energy can behave ultimately as single electron-hole pair generators. In addition, when we increase the current from 1 to 10 pA the light emission efficiency drops by more than one order of magnitude. This reduction of the emission efficiency is a manifestation of the "efficiency droop" as observed in nitride-based 2D light emitting diodes, a phenomenon tentatively attributed to the Auger effect.
Cross-sectional nanophotoluminescence studies of Stark effects in self-assembled quantum dots
International Nuclear Information System (INIS)
Htoon, H.; Keto, J. W.; Baklenov, O.; Holmes, A. L. Jr.; Shih, C. K.
2000-01-01
By using a cross-sectional geometry, we show the capability to perform single-dot spectroscopy in self-assembled quantum dots using far-field optics. By using this method, we study the quantum-confined Stark effect in self-assembled quantum dots. For single-stack quantum dots (QDs), we find that the spectra are redshifted with an increase in electric field. For vertically coupled double-stack quantum dots, while most of the QDs are redshifted, some QDs show blueshifted spectra, which can be interpreted as an evidence of coupled QD molecules. (c) 2000 American Institute of Physics
Observation of asymmetric Stark profiles from plasmas created by a picosecond KrF laser
International Nuclear Information System (INIS)
Nam, C.H.; Tighe, W.; Suckewer, S.; Seely, J.F.; Feldman, U.; Woltz, L.A.
1987-10-01
High-resolution extreme ultraviolet (XUV) spectra from solid targets irradiated by a picosecond KrF* laser focused to 10 16 W/cm 2 have been recorded. The line profiles of transitions in Li-like fluorine and oxygen are asymmetric and up to 2 A in width. Calculations indicate the presence of transitions of the type 2p-3p and other forbidden Stark components. 11 refs., 6 figs
Hargart, F.; Roy-Choudhury, K.; John, T.; Portalupi, S. L.; Schneider, C.; Höfling, S.; Kamp, M.; Hughes, S.; Michler, P.
2016-12-01
In this work we present an extensive experimental and theoretical investigation of different regimes of strong field light-matter interaction for cavity-driven quantum dot (QD) cavity systems. The electric field enhancement inside a high-Q micropillar cavity facilitates exceptionally strong interaction with few cavity photons, enabling the simultaneous investigation for a wide range of QD-laser detuning. In case of a resonant drive, the formation of dressed states and a Mollow triplet sideband splitting of up to 45 μeV is measured for a mean cavity photon number ≤slant 1. In the asymptotic limit of the linear AC Stark effect we systematically investigate the power and detuning dependence of more than 400 QDs. Some QD-cavity systems exhibit an unexpected anomalous Stark shift, which can be explained by an extended dressed 4-level QD model. We provide a detailed analysis of the QD-cavity systems properties enabling this novel effect. The experimental results are successfully reproduced using a polaron master equation approach for the QD-cavity system, which includes the driving laser field, exciton-cavity and exciton-phonon interactions.
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
International Nuclear Information System (INIS)
Gabris, A.; Agarwal, G.S.
2005-01-01
A collective system of atoms in a high-quality cavity can be described by a nonlinear interaction which arises due to the Lamb shift of the energy levels due to the cavity vacuum [Agarwal et al., Phys. Rev. A 56, 2249 (1997)]. We show how this collective interaction can be used to perform quantum logic. In particular we produce schemes to realize controlled-NOT gates not only for two-qubit but also for three-qubit systems. We also discuss realizations of Toffoli gates. Our effective Hamiltonian is also realized in other systems such as trapped ions or magnetic molecules
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Experimental transition probabilities and Stark parameters of singly ionized noble gases
Belmonte Sainz-Ezquerra, María Teresa
2016-01-01
La medida de parámetros atómicos, tales como las probabilidades de transición y las anchuras y desplazamientos Stark, es de gran importancia no solo en el campo de la física teórica y atómica, sino también en el diagnóstico de cualquier fuente emisora de radiación y en el área de la astrofísica. El objetivo de esta tesis doctoral es la medida de nuevos datos atómicos mediante una técnica de espectroscopia de emisión de plasmas. En concreto, este trabajo se ha centrado en: 1) Me...
The giant Stark effect in armchair-edge phosphorene nanoribbons under a transverse electric field
Zhou, Benliang; Zhou, Benhu; Liu, Pu; Zhou, Guanghui
2018-01-01
We study the variation of electronic properties for armchair-edge phosphorene nanoribbons (APNRs) modulated by a transverse electric field. Within the tight-binding model Hamiltonian, and by solving the differential Schrödinger equation, we find that a band gap closure appears at the critical field due to the giant Stark effect for an APNR. The gap closure has no field polarity, and the gap varies quadratically for small fields but becomes linear for larger ones. We attribute the giant Stark effect to the broken edge degeneracy, i.e., the charge redistributions of the conduction band minimum and valence band maximum states localized at opposite edges induced by the field. By combined with the Green's function approach, it is shown that in the presence of the critical field a gap of density of states (DOS) disappears and a high value DOS turns up at the energy position of the band gap closure. Finally, as the field increases, we find the band gap decreases more rapidly and the gap closure occurs at smaller fields for wider ribbons. Both the band gap and DOS variations with the field show an insulator-metal transition induced by a transverse electric field for the APNR. Our results show that wider APNRs are more appreciable to design field-effect transistors.
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Energy Technology Data Exchange (ETDEWEB)
Schmidt, Burkhard, E-mail: burkhard.schmidt@fu-berlin.de [Institute for Mathematics, Freie Universität Berlin, Arnimallee 6, D-14195 Berlin (Germany); Friedrich, Bretislav, E-mail: brich@fhi-berlin.mpg.de [Fritz-Haber-Institut der Max-Planck-Gesellschaft, Faradayweg 4-6, D-14195 Berlin (Germany)
2014-02-14
We show that combined permanent and induced electric dipole interactions of linear polar and polarizable molecules with collinear electric fields lead to a sui generis topology of the corresponding Stark energy surfaces and of other observables – such as alignment and orientation cosines – in the plane spanned by the permanent and induced dipole interaction parameters. We find that the loci of the intersections of the surfaces can be traced analytically and that the eigenstates as well as the number of their intersections can be characterized by a single integer index. The value of the index, distinctive for a particular ratio of the interaction parameters, brings out a close kinship with the eigenproperties obtained previously for a class of Stark states via the apparatus of supersymmetric quantum mechanics.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Stark mapping of H2 Rydberg states in the strong-field regime with dynamical resolution
International Nuclear Information System (INIS)
Glab, W.L.; Qin, K.
1993-01-01
We have acquired spectra of high Rydberg states of molecular hydrogen in a static external field, in the energy region from below the energy at which field ionization becomes classically possible (E c ) to well above this energy. Simultaneous spectra of ionization and dissociation were acquired, thereby allowing direct information on the excited-state decay dynamics to be obtained. We have found that states with energies below E c undergo field-induced predissociation, while states with energies well above E c decay predominantly by field ionization. Field ionization and dissociation compete effectively as decay channels for states with energies in a restricted region just above E c . Comparison of our ionization spectra to the results of a single-channel quantum-defect theory Stark calculation shows quantitative agreement except near curve crossings, indicating that inclusion of different core rotational state channels will be required to properly account for coupling between the Stark states. Several states in the spectra undergo pronounced changes in their dynamical properties over a narrow range of field values, which we interpret as being due to interference cancellation of the ionization rates for these states
Interband Stark effects in InxGa1-xAs/InyAl1-yAs coupled step quantum wells
International Nuclear Information System (INIS)
Kim, J.H.; Kim, T.W.; Yoo, K.H.
2005-01-01
The effects of an electric field on the interband transitions in In x Ga 1-x As/In y Al 1-y As coupled step quantum wells have been investigated both experimentally and theoretically. A In x Ga 1-x As/In y Al 1-y As coupled step quantum well sample consisted of the two sets of a 50 Aa In 0.53 Ga 0.47 As shallow quantum well and a 50 Aa In 0.65 Ga 0.35 As deep step quantum well bounded by two thick In 0.52 Al 0.48 As barriers separated by a 30 Aa In 0.52 Al 0.48 As embedded potential barrier. The Stark shift of the interband transition energy in the In x Ga 1-x As/In y Al 1-y As coupled step quantum well is larger than that of the single quantum well, and the oscillator strength in the In x Ga 1-x As/In y Al 1-y As coupled step quantum well is larger than that in a coupled rectangular quantum well. These results indicate that In x Ga 1-x As/In y Al 1-y As coupled step quantum wells hold promise for potential applications in optoelectron devices, such as tunable lasers
Energy Technology Data Exchange (ETDEWEB)
Pal' chikov, V.G. [National Research Institute for Physical-Technical and Radiotechnical Measurements - VNIIFTRI (Russian Federation)], E-mail: vitpal@mail.ru
2000-08-15
A quantum-electrodynamical (QED) perturbation theory is developed for hydrogen and hydrogen-like atomic systems with interaction between bound electrons and radiative field being treated as the perturbation. The dependence of the perturbed energy of levels on hyperfine structure (hfs) effects and on the higher-order Stark effect is investigated. Numerical results have been obtained for the transition probability between the hfs components of hydrogen-like bismuth.
International Nuclear Information System (INIS)
Torres, J; Carabano, O; Fernandez, M; Rubio, S; Alvarez, R; Rodero, A; Lao, C; Quintero, M C; Gamero, A; Sola, A
2006-01-01
The use of the Stark broadening of Balmer lines spontaneously emitted by atmospheric-pressure plasmas as a method to determine both the electron density and temperature in high-pressure plasmas is discussed in this paper. This method is applied to argon and helium plasmas produced in microwave discharges. Especially for Ar plasmas, valuable and reliable results are obtained
Two-channel interaction models in cavity QED
International Nuclear Information System (INIS)
Wang, L.
1993-01-01
The authors introduce four fully quantized models of light-matter interactions in optical or microwave cavities. These are the first exactly soluble models in cavity quantum electrodynamics (cavity QED) that provide two transition channels for the flipping of atomic states. In these models a loss-free cavity is assumed to support three or four quantized field modes, which are coupled to a single atom. The atom exchanges photons with the cavity, in either the Raman configuration including both Stokes and anti-Stokes modes, or through two-photon cascade processes. The authors obtain the effective Hamiltonians for these models by adiabatically eliminating an off-resonant intermediate atomic level, and discuss their novel properties in comparison to the existing one-channel Jaynes-Cummings models. They give a detailed description of a method to find exact analytic solutions for the eigenfunctions and eigenvalues for the Hamiltonians of four models. These are also valid when the AC Stark shifts are included. It is shown that the eigenvalues can be expressed in very simple terms, and formulas for normalized eigenvectors are also given, as well as discussions of some of their simple properties. Heisenberg picture equations of motions are derived for several operators with solutions provided in a couple of cases. The dynamics of the systems with both Fock state and coherent state fields are demonstrated and discussed using the model's two key variables, the atomic inversion and the expectation value of photon number. Clear evidences of high efficiency mode-mixing are seen in both the Raman and cascade configurations, and different kinds of collapses and revivals are encountered in the atomic inversions. Effects of several factors like the AC Stark shift and variations in the complex coupling constants are also illustrated
Lan, Chunbo; Tang, Lihua; Harne, Ryan L.
2018-05-01
Nonlinear piezoelectric energy harvester (PEH) has been widely investigated during the past few years. Among the majority of these researches, a pure resistive load is used to evaluate power output. To power conventional electronics in practical application, the alternating current (AC) generated by nonlinear PEH needs to be transformed into a direct current (DC) and rectifying circuits are required to interface the device and electronic load. This paper aims at exploring the critical influences of AC and DC interface circuits on nonlinear PEH. As a representative nonlinear PEH, we fabricate and evaluate a monostable PEH in terms of generated power and useful operating bandwidth when it is connected to AC and DC interface circuits. Firstly, the harmonic balance analysis and equivalent circuit representation method are utilized to tackle the modeling of nonlinear energy harvesters connected to AC and DC interface circuits. The performances of the monostable PEH connected to these interface circuits are then analyzed and compared, focusing on the influences of the varying load, excitation and electromechanical coupling strength on the nonlinear dynamics, bandwidth and harvested power. Subsequently, the behaviors of the monostable PEH with AC and DC interface circuits are verified by experiment. Results indicate that both AC and DC interface circuits have a peculiar influence on the power peak shifting and operational bandwidth of the monostable PEH, which is quite different from that on the linear PEH.
ac conductivity of a one-dimensional site-disordered lattice
International Nuclear Information System (INIS)
Albers, R.C.; Gubernatis, J.E.
1978-01-01
We report the results of a numerical study of the ac conductivity for the Anderson model of a one-dimensional, site-disordered system of 400 atoms. For different degrees of disorder, we directly diagonalized the Anderson Hamiltonian, used the Kubo-Greenwood formula to evaluate the conductivity, and then averaged the conductivity over 12 configurations. We found that the dominant frequency dependence of the conductivity consisted of a single peak which shifted to higher frequency and decreased in overall magnitude as the disorder was increased. The joint density of states and the eigenstate localization were also computed and are discussed in connection with our results
Impedance Localization Measurements using AC Dipoles in the LHC
Biancacci, Nicolo; Papotti, Giulia; Persson, Tobias; Salvant, Benoit; Tomás, Rogelio
2016-01-01
The knowledge of the LHC impedance is of primary importance to predict the machine performance and allow for the HL-LHC upgrade. The developed impedance model can be benchmarked with beam measurements in order to assess its validity and limit. This is routinely done, for example, moving the LHC collimator jaws and measuring the induced tune shift. In order to localize possible unknown impedance sources, the variation of phase advance with intensity between beam position monitors can be measured. In this work we will present the impedance localization measurements performed at injection in the LHC using AC dipoles as exciter as well as the underlying theory.
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Mungazi, Dickson A.
1989-01-01
Contends that educational policy in Zimbabwe from 1934 to 1954 served the political purposes of the colonial government and neglected genuine educational development of the colonized Africans. During George Stark's tenure as Director of Native Education, Zimbabweans were consigned to "practical training" programs and were denied access…
The role of baculovirus apoptotic suppressors in AcMNPV-mediated translation arrest in Ld652Y cells
International Nuclear Information System (INIS)
Thiem, Suzanne M.; Chejanovsky, Nor
2004-01-01
Infecting the insect cell line IPLB-Ld652Y with the baculovirus Autographa californica multinucleocapsid nucleopolyhedrovirus (AcMNPV) results in global translation arrest, which correlates with the presence of the AcMNPV apoptotic suppressor, p35. In this study, we investigated the role of apoptotic suppression on AcMNPV-induced translation arrest. Infecting cells with AcMNPV bearing nonfunctional mutant p35 did not result in global translation arrest. In contrast, global translation arrest was observed in cells infected with AcMNPV in which p35 was replaced with Opiap, Cpiap, or p49, baculovirus apoptotic suppressors that block apoptosis by different mechanisms than p35. These results indicated that suppressing apoptosis triggered translation arrest in AcMNPV-infected Ld652Y cells. Experiments using the DNA synthesis inhibitor aphidicolin and temperature shift experiments, using the AcMNPV replication mutants ts8 and ts8Δp35, indicated that translation arrest initiated during the early phase of infection, but events during the late phase were required for global translation arrest. Peptide caspase inhibitors could not substitute for baculovirus apoptotic suppressors to induce translation arrest in Ld652Y cells infected with a p35-null virus. However, if the p35-null-AcMNPV also carried hrf-1, a novel baculovirus host range gene, progeny virus was produced and treatment with peptide caspase inhibitors enhanced translation of a late viral gene transcript. Together, these results indicate that translation arrest in AcMNPV-infected Ld652Y cells is due to the anti-apoptotic function of p35, but suggests that rather than simply preventing caspase activation, its activity enhances signaling to a separate translation arrest pathway, possibly by stimulating the late stages of the baculovirus infection cycle
Validation of archived chemical shifts through atomic coordinates
Rieping, Wolfgang; Vranken, Wim F
2010-01-01
The public archives containing protein information in the form of NMR chemical shift data at the BioMagResBank (BMRB) and of 3D structure coordinates at the Protein Data Bank are continuously expanding. The quality of the data contained in these archives, however, varies. The main issue for chemical shift values is that they are determined relative to a reference frequency. When this reference frequency is set incorrectly, all related chemical shift values are systematically offset. Such wrongly referenced chemical shift values, as well as other problems such as chemical shift values that are assigned to the wrong atom, are not easily distinguished from correct values and effectively reduce the usefulness of the archive. We describe a new method to correct and validate protein chemical shift values in relation to their 3D structure coordinates. This method classifies atoms using two parameters: the per-atom solvent accessible surface area (as calculated from the coordinates) and the secondary structure of the parent amino acid. Through the use of Gaussian statistics based on a large database of 3220 BMRB entries, we obtain per-entry chemical shift corrections as well as Z scores for the individual chemical shift values. In addition, information on the error of the correction value itself is available, and the method can retain only dependable correction values. We provide an online resource with chemical shift, atom exposure, and secondary structure information for all relevant BMRB entries (http://www.ebi.ac.uk/pdbe/nmr/vasco) and hope this data will aid the development of new chemical shift-based methods in NMR. Proteins 2010. © 2010 Wiley-Liss, Inc. PMID:20602353
The motional stark effect with laser-induced fluorescence diagnostic
Foley, E. L.; Levinton, F. M.
2010-05-01
The motional Stark effect (MSE) diagnostic is the worldwide standard technique for internal magnetic field pitch angle measurements in magnetized plasmas. Traditionally, it is based on using polarimetry to measure the polarization direction of light emitted from a hydrogenic species in a neutral beam. As the beam passes through the magnetized plasma at a high velocity, in its rest frame it perceives a Lorentz electric field. This field causes the H-alpha emission to be split and polarized. A new technique under development adds laser-induced fluorescence (LIF) to a diagnostic neutral beam (DNB) for an MSE measurement that will enable radially resolved magnetic field magnitude as well as pitch angle measurements in even low-field (experiments. An MSE-LIF system will be installed on the National Spherical Torus Experiment (NSTX) at the Princeton Plasma Physics Laboratory. It will enable reconstructions of the plasma pressure, q-profile and current as well as, in conjunction with the existing MSE system, measurements of radial electric fields.
Real-time motional Stark effect in jet
International Nuclear Information System (INIS)
Alves, D.; Stephen, A.; Hawkes, N.; Dalley, S.; Goodyear, A.; Felton, R.; Joffrin, E.; Fernandes, H.
2004-01-01
The increasing importance of real-time measurements and control systems in JET experiments, regarding e.g. Internal Transport Barrier (ITB) and q-profile control, has motivated the development of a real-time motional Stark effect (MSE) system. The MSE diagnostic allows the measurement of local magnetic fields in different locations along the neutral beam path providing, therefore, local measurement of the current and q-profiles. Recently in JET, an upgrade of the MSE diagnostic has been implemented, incorporating a totally new system which allows the use of this diagnostic as a real-time control tool as well as an extended data source for off-line analysis. This paper will briefly describe the technical features of the real-time diagnostic with main focus on the system architecture, which consists of a VME crate hosting three PowerPC processor boards and a fast ADC, all connected via Front Panel Data Port (FPDP). The DSP algorithm implements a lockin-amplifier required to demodulate the JET MSE signals. Some applications for the system will be covered such as: feeding the real-time equilibrium reconstruction code (EQUINOX) and allowing the full coverage analysis of the Neutral Beam time window. A brief comparison between the real-time MSE analysis and the off-line analysis will also be presented
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
A novel five-level optimized carrier multilevel PWM quad-inverter six-phase AC drive
DEFF Research Database (Denmark)
Sanjeevikumar, P.; Blaabjerg, F.; Wheeler, Pat
2016-01-01
A novel single carrier pulse-width modulation (PWM) for a new quad-inverter configuration for multilevel six-phase asymmetrical open-winding ac converter is proposed in this article. Modularity of the circuit consist of four standard two-level voltage source inverters (VSIs) with slight modificat......A novel single carrier pulse-width modulation (PWM) for a new quad-inverter configuration for multilevel six-phase asymmetrical open-winding ac converter is proposed in this article. Modularity of the circuit consist of four standard two-level voltage source inverters (VSIs) with slight...... modifications, i.e. one additional bi-direction switch (MOSFET/IGBT) in each phase and a link to neutral with two capacitors to generate increased output levels. Furthermore, original optimal single carrier zero-shifted five-level modulation (SCZSFM) algorithm is developed for each VSI to behave as equivalent...
Born, M.; Bongers, F.; Poelman, E.H.; Sterck, F.J.
2010-01-01
Dry-season retreat and dietary shift of the dart-poison frog Delldrobates tillCtOrillS (Anura: Dendrobatidae). Seasonal rainfall affects tropical forest dynamics and behavior of species that are part of these ecosystems. TIle positive correlation between amphibian ac tivity pattems and rainfall has
Two-Gyro Pointing Stability of HST measured with ACS
Koekemoer, Anton M.; Kozhurina-Platais, Vera; Riess, Adam; Sirianni, Marco; Biretta, John; Pavlovsky
2005-06-01
We present the results of the pointing stability tests for HST, as measured with the ACS/ HRC during the Two-Gyro test program conducted in February 2005. We measure the shifts of 185 exposures of the globular clusters NGC6341 and Omega Centauri, obtained over a total of 13 orbits, and compare the measured pointings to those that were commanded in the observing program. We find in all cases that the measured shifts and rotations have the same level of accuracy as those that were commanded in three-gyro mode. Specifically, the pointing offsets during an orbit relative to the first exposure can be characterized with distributions having a dispersion of 2.3 milliarcseconds for shifts and 0.00097 degrees for rotations, thus less than 0.1 HRC pixels, and agree extremely well with similar values measured for comparable exposures obtained in three-gyro mode. In addition, we successfully processed these two-gyro test data through the MultiDrizzle software which is used in the HST pipeline to perform automated registration, cosmic ray rejection and image combination for multiple exposure sequences, and we find excellent agreement with similar exposures obtained in three-gyro mode. In summary, we find no significant difference between the quality of HST pointing as measured from these two-gyro test data, relative to the nominal behavior of HST in regular three-gyro operations.
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Direct measurement of electron density in microdischarge at atmospheric pressure by Stark broadening
International Nuclear Information System (INIS)
Dong Lifang; Ran Junxia; Mao Zhiguo
2005-01-01
We present a method and results for measurement of electron density in atmospheric-pressure dielectric barrier discharge. The electron density of microdischarge in atmospheric pressure argon is measured by using the spectral line profile method. The asymmetrical deconvolution is used to obtain Stark broadening. The results show that the electron density in single filamentary microdischarge at atmospheric pressure argon is 3.05x10 15 cm -3 if the electron temperature is 10,000 K. The result is in good agreement with the simulation. The electron density in dielectric barrier discharge increases with the increase of applied voltage
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
AC measurements on uranium doped high temperature superconductors
International Nuclear Information System (INIS)
Eisterer, M.
1999-11-01
The subject of this thesis is the influence of fission tracks on the superconducting properties of melt textured Y-123. The critical current densities, the irreversibility lines and the transition temperature were determined by means of ac measurements. The corresponding ac techniques are explored in detail. Deviations of the ac signal from the expectations according to the Bean model were explained by the dependence of the shielding currents on the electric field. This explanation is supported by the influence of the ac amplitude and frequency on the critical current density but also by a comparison of the obtained data with other experimental techniques. Y-123 has to be doped with uranium in order to induce fission tracks. Uranium forms normal conducting clusters, which are nearly spherical, with a diameter of about 300 nm. Fission of uranium-235 by thermal neutrons creates two high energy ions with a total energy of about 160 MeV. Each of these fission products induces a linear defect with a diameter of about 10 nm. The length of one fission track is 2-4 μm. At 77 K the critical current density is enhanced by the pinning action of the uranium clusters, compared to undoped samples. With decreasing temperature this influence becomes negligible. The critical current densities are strongly enhanced due to the irradiation. At low magnetic fields we find extremely high values for melt textured materials, e.g. 2.5x10 9 Am -2 at 77 K and 0.25 T or 6x10 10 Am -2 at 5 K. Since the critical current was found to be inverse proportional to the square root of the applied magnetic field it decreases rapidly as the field increases. This behavior is predicted by simple theoretical considerations, but is only valid at low temperatures as well as in low magnetic fields at high temperatures. At high fields the critical current drops more rapidly. The irreversibility lines are only slightly changed by this irradiation technique. Only a small shift to higher fields and temperatures
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Stark effect of optical properties of excitons in a quantum nanorod with parabolic confinement
Energy Technology Data Exchange (ETDEWEB)
Lyo, S.K., E-mail: sklyo@uci.edu
2014-01-15
We study the quantum Stark effect of optical properties of a quasi-one-dimensional quantum rod with parabolic confinement. Interplays between the competing/cooperative forces from confinement, electron–hole (e–h) attraction, and an external field are examined by studying the binding energy, the oscillator strength, and the root-mean-square (RMS) average of the e–h separation in a nonlinear electric field. In a long rod with weak confinement, the e–h interaction dominates over the confinement effect, yielding an abrupt drop of the exciton binding energy, oscillator strength, and a sudden increase of the RMS average e–h separation as the excitons are dissociated at the threshold field as the field increases. The exciton-dissociation transition is gradual in a short rod, where the confinement force dominates over the e–h attraction. We show that a DC field can induce an optically active excited exciton state in a narrow field range, causing a sharp peak in the oscillator strength and a dip in the RMS average of the e–h separation as the field increases. The Stark effects are also investigated as a function of the linear confinement length (i.e., rod length) at fixed fields. -- Highlights: • Study the dependence of optical properties of nanorods on the rod size and field. • Study the interplay between forces of confinement, Coulomb attraction, and field. • A strong field induces an optically active excited state observed in quantum dots.
Extensión del Formalismo de Orbitales de Defecto Cuántico al tratamiento del efecto Stark (SQDO).
Menéndez, J. M.; Martín, I.; Velasco, A. M.
El estudio experimental de las interacciones de átomos Rydberg altamente excitados con campos eléctricos ha experimentado un creciente interés durante las dos últimas décadas debido, en gran medida, al desarrollo de nuevas técnicas para crear y estudiar átomos Rydberg en el laboratorio. Acompañando a estas nuevas técnicas experimentales, es necesario el desarrollo de modelos teóricos que nos permitan contrastar sus medidas y conocer mejor los fundamentos de los mismos. Desde el punto de vista teórico el conocimiento del desdoblamiento de los niveles energéticos de un átomo en función de la magnitud del campo eléctrico aplicado (lo que se conoce como mapa Stark) es el mejor punto de partida para la descripción del sistema y un prerrequisito fundamental para el cálculo de distintas propiedades atómicas en presencia del campo eléctrico tales como intensidades de transición, umbrales de ionización de campo eléctrico, tiempos de vida, posición y anchura de cruces evitados, etc. En este trabajo presentamos la adaptación del método de orbitales de defecto cuántico [1,2,3] al tratamiento del efecto Stark (SQDO) [4] y su aplicación al cálculo de los desdoblamientos energéticos y fuerzas de oscilador de estados Rydberg en los átomos de Li, Na y K. El propósito de este estudio es, por un lado, desarrollar métodos fiables para la determinación de propiedades atómicas en presencia de campos eléctricos y, por otro, mostrar la fiabilidad de las funciones de onda QDO en la descripción del efecto Stark en sistemas atómicos.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
International Nuclear Information System (INIS)
Basharov, A. M.
2011-01-01
The effective Hamiltonian describing resonant interaction of an ensemble of identical quantum particles with a photon-free vacuum electromagnetic field has been obtained with allowance for terms of second order in the coupling constant (the Stark interaction) by means of the perturbation theory on the basis of the unitary transformation of the system quantum state. It has been shown that in the Markov approximation the effective Hamiltonian terms of first order in the coupling constant are represented by the quantum Wiener process, whereas terms of second order are expressed by the quantum Poisson process. During the course of the investigation, it was established that the Stark interaction played a significant role in the ensemble dynamics, thus influencing the collective spontaneous decay of the ensemble of an appreciably high number of identical particles. Fundamental effects have been discovered, i.e., the excitation conservation in a sufficiently dense ensemble of identical particles and superradiance suppression in the collective decaying process of an excited ensemble with a determined number of particles.
Hoffman, Lauren A; Sklar, Alfredo L; Nixon, Sara Jo
2015-05-01
A limited number of publications have documented the effects of acute alcohol administration among older adults. Among these, only a few have investigated sex differences within this population. The current project examined the behavioral effects of acute low- and moderate-dose alcohol on 62 older (ages 55-70) male and female, healthy, light to moderate drinkers. Participants were randomly assigned to one of three dose conditions: placebo (peak breath alcohol concentration [BrAC] of 0 mg/dL), low (peak BrAC of 40 mg/dL), and moderate (peak BrAC of 65 mg/dL). Tasks assessed psychomotor, set-shifting, and working memory performance. Better set-shifting abilities were observed among women, whereas men demonstrated more efficient working memory, regardless of dose. The moderate-dose group did not significantly differ from the placebo group on any task. However, the low-dose group performed better than the moderate-dose group across measures of set shifting and working memory. Relative to the placebo group, the low-dose group exhibited better working memory, specifically for faces. Interestingly, there were no sex by dose interactions. These data suggest that, at least for our study's task demands, low and moderate doses of alcohol do not significantly hinder psychomotor, set-shifting, or working memory performance among older adults. In fact, low-dose alcohol may facilitate certain cognitive abilities. Furthermore, although sex differences in cognitive abilities were observed, these alcohol doses did not differentially affect men and women. Further investigation is necessary to better characterize the effects of sex and alcohol dose on cognition in older adults. Copyright © 2015 Elsevier Inc. All rights reserved.
El-Shabaan, M. M.
2018-02-01
Impedance spectroscopy and alternating-current (AC) conductivity (σ AC) studies of bulk 3-amino-7-(dimethylamino)-2-methyl-hydrochloride (neutral red, NR) have been carried out over the temperature (T) range from 303 K to 383 K and frequency (f) range from 0.5 kHz to 5 MHz. Dielectric data were analyzed using the complex impedance (Z *) and complex electric modulus (M *) for bulk NR at various temperatures. The impedance loss peaks were found to shift towards high frequencies, indicating an increase in the relaxation time (τ 0) and loss in the material, with increasing temperature. For each temperature, a single depressed semicircle was observed at high frequencies, originating from the bulk transport, and a spike in the low-frequency region, resulting from the electrode effect. Fitting of these curves yielded an equivalent circuit containing a parallel combination of a resistance R and constant-phase element (CPE) Q. The carrier transport in bulk NR is governed by the correlated barrier hopping (CBH) mechanism, some parameters of which, such as the maximum barrier height (W M), charge density (N), and hopping distance (r), were determined as functions of both temperature and frequency. The frequency dependence of σ AC at different temperatures indicated that the conduction in bulk NR is a thermally activated process. The σ AC value at different frequencies increased linearly with temperature.
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
Stark broadening of the Hα line of hydrogen at low densities: quantal and semiclassical results
International Nuclear Information System (INIS)
Stehle, C.; Feautrier, N.
1984-01-01
Stark profiles of the Hα lines of hydrogen are computed at low densities in the 'impact' theory. By a comparison with quantal results, it is shown that a simple semiclassical perturbational approach with appropriate cutoffs is sufficient to give accurate profiles in the line centre. Neglecting the natural broadening and the fine-structure effects, the authors prove that the electronic broadening is negligible and that the profile has a Lorentzian shape. An analytical expression of the half width is given. (author)
Chen, Jiann-Jong; Kung, Che-Min
2010-09-01
The communication speed between components is far from satisfactory. To achieve high speed, simple control system configuration, and low cost, a new on-chip all-digital three-phase dc/ac power inverter using feedforward and frequency control techniques is proposed. The controller of the proposed power inverter, called the shift register, consists of six-stage D-latch flip-flops with a goal of achieving low-power consumption and area efficiency. Variable frequency is achieved by controlling the clocks of the shift register. One advantage regarding the data signal (D) and the common clock (CK) is that, regardless of the phase difference between the two, all of the D-latch flip-flops are capable of delaying data by one CK period. To ensure stability, the frequency of CK must be six times higher than that of D. The operation frequency of the proposed power inverter ranges from 10 Hz to 2 MHz, and the maximum output loading current is 0.8 A. The prototype of the proposed circuit has been fabricated with TSMC 0.35 μm 2P4M CMOS processes. The total chip area is 2.333 x 1.698 mm2. The three-phase dc/ac power inverter is applicable in uninterrupted power supplies, cold cathode fluorescent lamps, and motors, because of its ability to convert the dc supply voltage into the three-phase ac power sources.
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Spontaneous emission of the non-Wiener type
International Nuclear Information System (INIS)
Basharov, A. M.
2011-01-01
The spontaneous emission of a quantum particle and superradiation of an ensemble of identical quantum particles in a vacuum electromagnetic field with zero photon density are examined under the conditions of significant Stark particle and field interaction. New fundamental effects are established: suppression of spontaneous emission by the Stark interaction, an additional “decay” shift in energy of the decaying level as a consequence of Stark interaction unrelated to the Lamb and Stark level shifts, excitation conservation phenomena in a sufficiently dense ensemble of identical particles and suppression of superradiaton in the decay of an ensemble of excited quantum particles of a certain density. The main equations describing the emission processes under conditions of significant Stark interaction are obtained in the effective Hamiltonian representation of quantum stochastic differential equations. It is proved that the Stark interaction between a single quantum particle and a broadband electromagnetic field is represented as a quantum Poisson process and the stochastic differential equations are of the non-Wiener (generalized Langevin) type. From the examined case of spontaneous emission of a quantum particle, the main rules are formulated for studying open systems in the effective Hamiltonian representation.
El Harouny, El Hassan; Nakra Mohajer, Soukaina; Ibral, Asmaa; El Khamkhami, Jamal; Assaid, El Mahdi
2018-05-01
Eigenvalues equation of hydrogen-like off-center single donor impurity confined in polarized homogeneous hemispherical quantum dot deposited on a wetting layer, capped by insulated matrix and submitted to external uniform electric field is solved in the framework of the effective mass approximation. An infinitely deep potential is used to describe effects of quantum confinement due to conduction band offsets at surfaces where quantum dot and surrounding materials meet. Single donor ground state total and binding energies in presence of electric field are determined via two-dimensional finite difference approach and Ritz-Hassé variation principle. For the latter method, attractive coulomb correlation between electron and ionized single donor is taken into account in the expression of trial wave function. It appears that off-center single dopant binding energy, spatial extension and radial probability density are strongly dependent on hemisphere radius and single dopant position inside quantum dot. Influence of a uniform electric field is also investigated. It shows that Stark effect appears even for very small size dots and that single dopant energy shift is more significant when the single donor is near hemispherical surface.
International Nuclear Information System (INIS)
Takiyama, K.; Namba, S.; Furukawa, S.; Oda, T.; James, B.W.; Andruczyk, D.
2004-01-01
Interference between Stark-induced dipole and electric quadrupole amplitudes was observed in a He hollow cathode plasma with axial magnetic field perpendicular to the sheath electric field E by laser-induced fluorescence (LIF) method. Circularly polarized LIF signals were observed in the sheath region. Spatial profile of the degree of polarization P c showed characteristic features of the interference. Using theoretically calculated P c -E relationship, E-profile was successfully obtained form the measure P c . (author)
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
National Oceanic and Atmospheric Administration, Department of Commerce — The data in this accession were collected in Mediterranean Sea from ship STARK between January 7, 1992 and January 31, 1992. The real time data of water temperature...
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
International Nuclear Information System (INIS)
Padhi, H.C.; Dhal, B.B.; Nandi, T.; Trautmann, D.
1995-01-01
L-subshell ionization of Au and Bi induced by boron impact has been investigated for impact energies ranging from 0.48 to 0.88 MeV/μ. The energy dependence of the measured ionization cross section shows, for the first time, a plateau structure for all three subshells. The plateau structure revealed by previous data for proton and helium impact was for the L 1 subshell only and this had been attributed to the bimodal nature of the 2s electron density. The observed plateau structure for all the three subshells and its occurrence at a somewhat lower energy signifies a considerable amount of Stark mixing of target 2s and 2p atomic wavefunctions. Fresh calculations incorporating the Stark mixing effect in target atomic wavefunctions are necessary to improve agreement with the present data. The existing theories, however, are found to be inadequate. (author)
Energy Technology Data Exchange (ETDEWEB)
Moradi, Christopher P.; Douberly, Gary E., E-mail: douberly@uga.edu [Department of Chemistry, University of Georgia, Athens, Georgia 30602-2556 (United States); Xie, Changjian; Guo, Hua [Department of Chemistry and Chemical Biology, University of New Mexico, Albuquerque, New Mexico 87131 (United States); Kaufmann, Matin [Department of Physical Chemistry II, Ruhr-University Bochum, D-44801 Bochum (Germany)
2016-04-28
Pyrolytic dissociation of Cl{sub 2} is employed to dope helium droplets with single Cl atoms. Sequential addition of NH{sub 3} to Cl-doped droplets leads to the formation of a complex residing in the entry valley to the substitution reaction Cl + NH{sub 3} → ClNH{sub 2} + H. Infrared Stark spectroscopy in the NH stretching region reveals symmetric and antisymmetric vibrations of a C{sub 3v} symmetric top. Frequency shifts from NH{sub 3} and dipole moment measurements are consistent with a ClNH{sub 3} complex containing a relatively strong two-center three-electron (2c–3e) bond. The nature of the 2c–3e bonding in ClNH{sub 3} is explored computationally and found to be consistent with the complexation-induced blue shifts observed experimentally. Computations of interconversion pathways reveal nearly barrierless routes to the formation of this complex, consistent with the absence in experimental spectra of two other complexes, NH{sub 3}Cl and Cl–HNH{sub 2}, which are predicted in the entry valley to the hydrogen abstraction reaction Cl + NH{sub 3} → HCl + NH{sub 2}.
Liu, Han-Bing; Yang, Bing; Xue, Nan-Dong
2016-11-15
A series of hydrophobic-modified (polydimethylsiloxane (PDMS) coating) activated carbons (ACs) were developed to answer a fundamental question: what are the determinants that dominate the adsorption on ACs under humid conditions? Using column experiments, an inter-comparison among bare-AC and PDMS-coated ACs was conducted regarding the association of surface characteristics and adsorption capacity. Primary outcomes occurred in two dominating markers, hydrophobicity and total micropore volume, which played a key role in water adsorption on ACs. However, their contributions to water adsorption on ACs substantially differed under different Pwater/Pair conditions. Hydrophobicity was the only contributor in Pwater/Pair=0.1-0.6, while the two markers contributed equally in Pwater/Pair=0.7-1.0. Furthermore, PDMS-coated AC had a significant increase in benzene adsorption capacities compared to bare-AC at 0-90% relative humidity, while these differences were not significant among PDMS-coated ACs. It is thus presumed that the balance between the two markers can be shifted to favor almost unchanged benzene adsorption capacities among PDMS-coated ACs over a large range of relative humidity. These findings suggest potential benefits of PDMS coating onto ACs in enhancing selective adsorption of hydrophobic volatile organic compounds under high humid conditions. To develop new porous materials with both high total micropore volume and hydrophobicity should thus be considered. Copyright © 2016 Elsevier B.V. All rights reserved.
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
AC electric field induced dipole-based on-chip 3D cell rotation.
Benhal, Prateek; Chase, J Geoffrey; Gaynor, Paul; Oback, Björn; Wang, Wenhui
2014-08-07
The precise rotation of suspended cells is one of the many fundamental manipulations used in a wide range of biotechnological applications such as cell injection and enucleation in nuclear transfer (NT) cloning. Noticeably scarce among the existing rotation techniques is the three-dimensional (3D) rotation of cells on a single chip. Here we present an alternating current (ac) induced electric field-based biochip platform, which has an open-top sub-mm square chamber enclosed by four sidewall electrodes and two bottom electrodes, to achieve rotation about the two axes, thus 3D cell rotation. By applying an ac potential to the four sidewall electrodes, an in-plane (yaw) rotating electric field is generated and in-plane rotation is achieved. Similarly, by applying an ac potential to two opposite sidewall electrodes and the two bottom electrodes, an out-of-plane (pitch) rotating electric field is generated and rolling rotation is achieved. As a prompt proof-of-concept, bottom electrodes were constructed with transparent indium tin oxide (ITO) using the standard lift-off process and the sidewall electrodes were constructed using a low-cost micro-milling process and then assembled to form the chip. Through experiments, we demonstrate rotation of bovine oocytes of ~120 μm diameter about two axes, with the capability of controlling the rotation direction and the rate for each axis through control of the ac potential amplitude, frequency, and phase shift, and cell medium conductivity. The maximum observed rotation rate reached nearly 140° s⁻¹, while a consistent rotation rate reached up to 40° s⁻¹. Rotation rate spectra for zona pellucida-intact and zona pellucida-free oocytes were further compared and found to have no effective difference. This simple, transparent, cheap-to-manufacture, and open-top platform allows additional functional modules to be integrated to become a more powerful cell manipulation system.
Directory of Open Access Journals (Sweden)
Baosheng Cao
2015-12-01
Full Text Available Upconversion luminescence properties from the emissions of Stark sublevels of Er3+ were investigated in Er3+-Yb3+-Mo6+-codoped TiO2 phosphors in this study. According to the energy levels split from Er3+, green and red emissions from the transitions of four coupled energy levels, 2H11/2(I/2H11/2(II, 4S3/2(I/4S3/2(II, 4F9/2(I/4F9/2(II, and 2H11/2(I + 2H11/2(II/4S3/2(I + 4S3/2(II, were observed under 976 nm laser diode excitation. By utilizing the fluorescence intensity ratio (FIR technique, temperature-dependent upconversion emissions from these four coupled energy levels were analyzed at length. The optical temperature-sensing behaviors of sensing sensitivity, measurement error, and operating temperature for the four coupled energy levels are discussed, all of which are closely related to the energy gap of the coupled energy levels, FIR value, and luminescence intensity. Experimental results suggest that Er3+-Yb3+-Mo6+-codoped TiO2 phosphor with four pairs of energy levels coupled by Stark sublevels provides a new and effective route to realize multiple optical temperature-sensing through a wide range of temperatures in an independent system.
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Quality Of Starking Apples After Exposure To Gamma Radiation As A Quarantine Treatment
International Nuclear Information System (INIS)
Mansour, M.; Mohamad, F.; Al-Bachir, M.
2004-01-01
Starking apples approaching physiological maturity were exposed, immediately after harvest, to gamma radiation doses ranging from 100 to 400 Gy. The irradiated fruit were stored for six months in a cold storage facility at 1±1 deg. C and 90±5 % RH. Effects of gamma radiation on weight loss, fruit firmness, pH of fruit juice, fruit taste, color and visible injuries were evaluated. The results showed that gamma irradiation increased weight loss, particularly in the first 45 days of storage. Doses higher than 200 Gy, on the other hand, reduced apple firmness after 45 days of storage while a 400 Gy dose decreased fruit pH immediately after irradiation. (Authors)
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Electric field measurements in a xenon discharge using Spark spectroscopy
Wagenaars, E.; Bowden, M.D.; Kroesen, G.M.W.
2005-01-01
Measurements of electric field distributions in a low-pressure xenon discharge are presented. The measurement technique is based on Stark spectroscopy, using a 2 + 1 excitation scheme with fluorescence dip detection. Electric fields can be measured by detecting Stark shifts of high-lying Rydberg
Wang, Qin; Hou, Shunyong; Xu, Liang; Yin, Jianping
2016-02-21
To meet some demands for realizing precise measurements of an electric dipole moment of electron (eEDM) and examining cold collisions or cold chemical physics, we have proposed a novel, versatile electrostatic Stark decelerator with an array of true 3D electric potential wells, which are created by a series of horizontally-oriented, U-shaped electrodes with time-sequence controlling high voltages (± HV) and two guiding electrodes with a constant voltage. We have calculated the 2D electric field distribution, the Stark shifts of the four lowest rotational sub-levels of PbF molecules in the X1(2)Π1/2(v = 0) electronic and vibrational ground states as well as the population in the different rotational levels. We have discussed the 2D longitudinal and transverse phase-space acceptances of PbF molecules in our decelerator. Subsequently, we have simulated the dynamic processes of the decelerated PbF molecules using the 3D Monte-Carlo method, and have found that a supersonic PbF beam with a velocity of 300 m s(-1) can be efficiently slowed to about 5 m s(-1), which will greatly enhance the sensitivities to research a parity violation and measure an eEDM. In addition, we have investigated the dependences of the longitudinal velocity spread, longitudinal temperature and bunching efficiency on both the number of guiding stages and high voltages, and found that after bunching, a cold packet of PbF molecules in the J = 7/2, MΩ = -7/4 state with a longitudinal velocity spread of 0.69 m s(-1) (corresponding to a longitudinal temperature of 2.35 mK) will be produced by our high-efficient decelerator, which will generate a high energy-resolution molecular beam for studying cold collision physics. Finally, our novel decelerator can also be used to efficiently slow NO molecules with a tiny electric dipole moment (EDM) of 0.16 D from 315 m s(-1) to 28 m s(-1). It is clear that our proposed new decelerator has a good slowing performance and experimental feasibility as well as wide
Behavior of Rydberg atoms at surfaces: energy level shifts and ionization
Energy Technology Data Exchange (ETDEWEB)
Dunning, F.B. E-mail: fbd@rice.edu; Dunham, H.R.; Oubre, C.; Nordlander, P
2003-04-01
The ionization of xenon atoms excited to the extreme red and blue states in high-lying Xe(n) Stark manifolds at a metal surface is investigated. The data show that, despite their very different initial spatial characteristics, the extreme members of a given Stark manifold ionize at similar atom/surface separations. This is explained, with the aid of complex scaling calculations, in terms of the strong perturbations in the energies and structure of the atomic states induced by the presence of the surface which lead to avoided crossings between neighboring levels as the surface is approached.
Behavior of Rydberg atoms at surfaces: energy level shifts and ionization
Dunning, F B; Oubre, C D; Nordlander, P
2003-01-01
The ionization of xenon atoms excited to the extreme red and blue states in high-lying Xe(n) Stark manifolds at a metal surface is investigated. The data show that, despite their very different initial spatial characteristics, the extreme members of a given Stark manifold ionize at similar atom/surface separations. This is explained, with the aid of complex scaling calculations, in terms of the strong perturbations in the energies and structure of the atomic states induced by the presence of the surface which lead to avoided crossings between neighboring levels as the surface is approached.
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Spectroscopy of Rb atoms in hollow-core fibers
International Nuclear Information System (INIS)
Slepkov, Aaron D.; Bhagwat, Amar R.; Venkataraman, Vivek; Londero, Pablo; Gaeta, Alexander L.
2010-01-01
Recent demonstrations of light-matter interactions with atoms and molecules confined to hollow waveguides offer great promise for ultralow-light-level applications. The use of waveguides allows for tight optical confinement over interaction lengths much greater than what could be achieved in bulk geometries. However, the combination of strong atom-photon interactions and nonuniformity of guided light modes gives rise to spectroscopic features that must be understood in order to take full advantage of the properties of such systems. We use light-induced atomic desorption to generate an optically dense Rb vapor at room temperature inside a hollow-core photonic band-gap fiber. Saturable-absorption spectroscopy and passive slow-light experiments reveal large ac Stark shifts, power broadening, and transit-time broadening, that are present in this system even at nanowatt powers.
National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Station Data from 17 stations; and Conductivity, Temperature and Depth (CTD) data from 49 casts were collected using ship Stark during cruises # 688-711....
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Ab initio modeling of the motional Stark effect on MAST
International Nuclear Information System (INIS)
De Bock, M. F. M.; Conway, N. J.; Walsh, M. J.; Carolan, P. G.; Hawkes, N. C.
2008-01-01
A multichord motional Stark effect (MSE) system has recently been built on the MAST tokamak. In MAST the π and σ lines of the MSE spectrum overlap due to the low magnetic field typical for present day spherical tokamaks. Also, the field curvature results in a large change in the pitch angle over the observation volume. The measured polarization angle does not relate to one local pitch angle but to an integration over all pitch angles in the observation volume. The velocity distribution of the neutral beam further complicates the measurement. To take into account volume effects and velocity distribution, an ab initio code was written that simulates the MSE spectrum on MAST. The code is modular and can easily be adjusted for other tokamaks. The code returns the intensity, polarized fraction, and polarization angle as a function of wavelength. Results of the code are presented, showing the effect on depolarization and wavelength dependence of the polarization angle. The code is used to optimize the design and calibration of the MSE diagnostic.
Ko, J.; Chung, J.
2017-06-01
The safety factor profile evolutions have been measured from the plasma discharges with the external current drive mechanism such as the multi-ion-source neutral beam injection for the Korea Superconducting Tokamak Advanced Research (KSTAR) for the first time. This measurement has been possible by the newly installed motional Stark effect (MSE) diagnostic system that utilizes the polarized Balmer-alpha emission from the energetic neutral deuterium atoms induced by the Stark effect under the Lorentz electric field. The 25-channel KSTAR MSE diagnostic is based on the conventional photoelastic modulator approach with the spatial and temporal resolutions less than 2 cm (for the most of the channels except 2 to 3 channels inside the magnetic axis) and about 10 ms, respectively. The strong Faraday rotation imposed on the optical elements in the diagnostic system is calibrated out from a separate and well-designed polarization measurement procedure using an in-vessel reference polarizer during the toroidal-field ramp-up phase before the plasma experiment starts. The combination of the non-inductive current drive during the ramp-up and shape control enables the formation of the internal transport barrier where the pitch angle profiles indicate flat or slightly hollow profiles in the safety factor.
Stark broadening of the 1640- and 4686-A lines of ionized helium
International Nuclear Information System (INIS)
Greene, R.L.
1976-01-01
The Stark-broadened profiles of the 1640- and 4686-A lines of ionized helium have been calculated using an approximation to the electron broadening operator in the unified classical-path theory of Smith, Vidal, and Cooper. The approximation is such that the results reproduce the time-ordered impact-theory results in the line center, and the ionized-radiator quasistatic results in the far wings. Sample calculations at n/sub e/ = 10/sup 17/ cm/sup -3/ and T = 40 000 degreeK are found to give significantly more narrow profiles than the corresponding modified-impact-theory results because of a different treatment of the lower-state interaction. Indirect comparison with experiment indicates that the calculated lines are too narrow, but it is expected that the inclusion of neglected effects of ion dynamics and inelastic collisions would improve agreement
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Directory of Open Access Journals (Sweden)
Shoaib Rauf
2017-01-01
Full Text Available Smart grid for the past few years has been the prime focus of research in power systems. The aim is to eliminate load shedding and problematic blackout conditions, further offering cheap and continuous supply of electricity for both large and small consumers. Another benefit is to integrate renewable energy resources with existing dump grid in more efficient and cost-effective manner. In past few years, growing demand for sustainable energy increases the consumption of solar PV. Since generation from solar PV is in DC and most of the appliances at home could be operated on DC, AC-DC hybrid distribution system with energy management system is proposed in this paper. EMS helps to shift or control the auxiliary load and compel the users to operate specific load at certain time slots. These techniques further help to manage the excessive load during peak and off peak hours. It demonstrates the practical implementation of DC-AC network with integration of solar PV and battery storage with existing infrastructure. The results show a remarkable improvement using hybrid AC-DC framework in terms of reliability and efficiency. All this functioning together enhances the overall efficiency; hence, a secure, economical, reliable, and intelligent system leads to a smart grid.
Directory of Open Access Journals (Sweden)
Domenica Veniero
2017-06-01
Full Text Available Transcranial electrical stimulation (tES is being investigated as an experimental and clinical interventional technique in human participants. While promising, important limitations have been identified, including weak effect sizes and high inter- and intra-individual variability of outcomes. Here, we compared two “inhibitory” tES-techniques with supposedly different mechanisms of action as to their effects on performance in a visuospatial attention task, and report on a direct replication attempt. In two experiments, 2 × 20 healthy participants underwent tES in three separate sessions testing different protocols (10 min stimulation each with a montage targeting right parietal cortex (right parietal–left frontal, electrode-sizes: 3cm × 3cm–7 cm × 5 cm, while performing a perceptual line bisection (landmark task. The tES-protocols were compared as to their ability to modulate pseudoneglect (thought to be under right hemispheric control. In experiment 1, sham-tES was compared to transcranial alternating current stimulation at alpha frequency (10 Hz; α-tACS (expected to entrain “inhibitory” alpha oscillations and to cathodal transcranial direct current stimulation (c-tDCS (shown to suppress neuronal spiking activity. In experiment 2, we attempted to replicate the findings of experiment 1, and establish frequency-specificity by adding a 45 Hz-tACS condition to α-tACS and sham. In experiment 1, right parietal α-tACS led to the expected changes in spatial attention bias, namely a rightward shift in subjective midpoint estimation (relative to sham. However, this was not confirmed in experiment 2 and in the complete sample. Right parietal c-tDCS and 45 Hz-tACS had no effect. These results highlight the importance of replication studies, adequate statistical power and optimizing tES-interventions for establishing the robustness and reliability of electrical stimulation effects, and best practice.
Implementation of quantum logic gates via Stark-tuned Förster resonance in Rydberg atoms
Huang, Xi-Rong; Hu, Chang-Sheng; Shen, Li-Tuo; Yang, Zhen-Biao; Wu, Huai-Zhi
2018-02-01
We present a scheme for implementation of controlled-Z and controlled-NOT gates via rapid adiabatic passage and Stark-tuned Förster resonance. By sweeping the Förster resonance once without passing through it and adiabatically tuning the angle-dependent Rydberg-Rydberg interaction of the dipolar nature, the system can be effectively described by a two-level system with the adiabatic theorem. The single adiabatic passage leads to a gate fidelity as high as 0.999 and a greatly reduced gate operation time. We investigate the scheme by considering an actual atomic level configuration with rubidium atoms, where the fidelity of the controlled-Z gate is still higher than 0.99 under the influence of the Zeeman effect.
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
International Nuclear Information System (INIS)
Karachevtseva, L.; Goltviansky, Yu.; Sapelnikova, O.; Lytvynenko, O.; Stronska, O.; Bo, Wang; Kartel, M.
2016-01-01
Highlights: • The IR absorption spectra of oxidized macroporous silicon were studied. • The Wannier–Stark electro-optical effect on Si-SiO_2 boundary was confirmed. • An additional electric field of quasi-guided optical modes was evaluated. • The photonic modes and band gaps were measured as peculiarities in absorption spectra. - Abstract: Opportunities to enhance the properties of structured surfaces were demonstrated on 2D macroporous silicon structures with SiO_2 coatings. We investigated the IR light absorption oscillations in macroporous silicon structures with SiO2 coatings 0–800 nm thick. The Wannier–Stark electro-optical effect due to strong electric field on Si-SiO_2boundary and an additional electric field of quasi-guided optical modes were taken into account. The photonic modes and band gaps were also considered as peculiarities in absorbance spectra of macroporous silicon structures with a thick SiO_2 coating. The photonic modes do not coincide with the quasi-guided modes in the silicon matrix and do not appear in absorption spectra of 2D macroporous silicon structures with surface nanocrystals.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Indian Academy of Sciences (India)
ized neon and argon for laboratory plasma diagnostics. The shifts have been compared with existing experimental values. The obtained data will be included in the STARK-B database, which is a part of the Virtual. Atomic and Molecular Data Center – VAMDC. Key words. Stark broadening—atomic data—Ne I: line profiles.
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Korucuoglu, Ozlem; Sher, Kenneth J; Wood, Phillip K; Saults, John Scott; Altamirano, Lee; Miyake, Akira; Bartholow, Bruce D
2017-03-01
To compare the acute effects of alcohol on set-shifting task performance (relative to sober baseline performance) during ascending and descending limb breath alcohol concentration (BrAC), as well as possible moderation of these effects by baseline individual differences. Shifting performance was tested during an initial baseline and a subsequent drinking session, during which participants were assigned randomly to one of three beverage conditions (alcohol, placebo or control) and one of two BrAC limb conditions [ascending and descending (A/D) or descending-only (D-only)]. A human experimental laboratory on the University of Missouri campus in Columbia, MO, USA. A total of 222 moderate-drinking adults (ages 21-30 years) recruited from Columbia, MO and tested between 2010 and 2013. The outcome measure was performance on set-shifting tasks under the different beverage and limb conditions. Shifting performance assessed at baseline was a key moderator. Although performance improved across sessions, this improvement was reduced in the alcohol compared with no-alcohol groups (post-drink latent mean comparison across groups, all Ps ≤ 0.05), and this effect was more pronounced in individuals with lower pre-drink performance (comparison of pre- to post-drink path coefficients across groups, all Ps ≤ 0.05). In the alcohol group, performance was better on descending compared with ascending limb (P ≤ 0.001), but descending limb performance did not differ across the A/D and D-only groups. Practising tasks before drinking moderates the acute effects of alcohol on the ability to switch between tasks. Greater impairment in shifting ability on descending compared with ascending breath alcohol concentration is not related to task practice. © 2016 Society for the Study of Addiction.
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
International Nuclear Information System (INIS)
Hazarika, J.; Kumar, A.
2014-01-01
In this paper, we report the 160 MeV Ni 12+ swift heavy ions (SHIs) irradiation effects on AC conductivity and dielectric relaxation properties of polypyrrole (PPy) nanoparticles in the frequency range of 42 Hz–5 MHz. Four ion fluences of 5 × 10 10 , 1 × 10 11 , 5 × 10 11 and 1 × 10 12 ions/cm 2 have been used for the irradiation purpose. Transport properties in the pristine and irradiated PPy nanoparticles have been investigated with permittivity and modulus formalisms to study the polarization effects and conductivity relaxation. With increasing ion fluence, the relaxation peak in imaginary modulus (M ″ ) plots shifts toward high frequency suggesting long range motion of the charge carriers. The AC conductivity studies suggest correlated barrier hopping as the dominant transport mechanism. The hopping distance (R ω ) of the charge carriers decreases with increasing the ion fluence. Binding energy (W m ) calculations depict that polarons are the dominant charge carriers
Theory of coherent Stark nonlinear spectroscopy in a three-level system
International Nuclear Information System (INIS)
Loiko, Yurii; Serrat, Carles
2007-01-01
Coherent Stark nonlinear spectroscopy (CSNS) is a spectroscopic tool based on the cancellation of the phase sensitivity at frequency 5ω in the ultrafast four-wave mixing (FWM) of two-color pulses with frequencies ω and 3ω. We develop a theory for CSNS in three-level V-type systems, and reveal that the mechanism for the phase sensitivity at 5ω is the quantum interference between the two primary paths in the FWM of the ω and 3ω fields. We find that the cancellation phenomenon occurs when the probability amplitude of one of these two primary pathways becomes equal to zero due to the competition effect between the two allowed transitions in the V-type system. The analytical expressions that describe the phase-sensitivity phenomenon and the conditions for its cancellation have been derived on the basis of perturbation theory, and are confirmed by numerical integration of the density matrix and Maxwell equations. We argue that CSNS can be utilized, in particular, for the investigation of optically dense media
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Directory of Open Access Journals (Sweden)
Aynur Batkan
2012-06-01
Full Text Available In this research, the effects of three different holding periods (6, 12 and 24 hours prior to storage on the quality attributes of Starking Delicious apples were investigated during storage of 8 months at 0.5 ± 1.0 ºC. Changes in weight loss, flesh firmness, pH values, soluble dry matter amount, titratable acidity values, ascorbic acid contents, and total and reducing sugar content were determined. According to the results, the holding period showed statistically significant changes in the quality attributes of the apples (p Neste trabalho, os efeitos de três diferentes tempos de espera (6, 12 e 24 horas antes do armazenamento sobre os atributos de qualidade de maçãs tipo Starking Delicious foram investigados durante o armazenamento de 8 meses a 0,5 ± 1,0 ºC. Alterações na perda de peso, firmeza da polpa, valores de pH, quantidade de matéria seca solúvel, valores de acidez titulável, teor de ácido ascórbico e teor de açúcar redutor e total das amostras foram determinadas. De acordo com os resultados da análise, o tempo de espera causou alterações estatisticamente significativas sobre as nos atributos de qualidade das maçãs (p < 0,05.
Study of Stark Effect in n-doped 1.55 μm InN0.92yP1-1.92yBiy/InP MQWs
Bilel, C.; Chakir, K.; Rebey, A.; Alrowaili, Z. A.
2018-05-01
The effect of an applied electric field on electronic band structure and optical absorption properties of n-doped InN0.92y P1-1.92y Bi y /InP multiple quantum wells (MQWs) was theoretically studied using a self-consistent calculation combined with the 16-band anti-crossing model. The incorporation of N and Bi atoms into an InP host matrix leads to rapid reduction of the band gap energy covering a large infrared range. The optimization of the well parameters, such as the well/barrier widths, N/Bi compositions and doping density, allowed us to obtain InN0.92y P1-1.92y Bi y /InP MQWs operating at the wavelength 1.55 μm. Application of the electric field causes a red-shift of the fundamental transition energy T 1 accompanied by a significant change in the spatial distribution of confined electron density. The Stark effect on the absorption coefficient of n-doped InN0.92y P1-1.92y Bi y /InP MQWs was investigated. The Bi composition of these MQWs was adjusted for each electric field value in order to maintain the wavelength emission at 1.55 μm.
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
International Nuclear Information System (INIS)
Torres, J; Jonkers, J; Sande, M J van de; Mullen, J J A M van der; Gamero, A; Sola, A
2003-01-01
This paper discusses the possibility of determining, at the same time, both the electron density and temperature in a discharge produced at atmospheric pressure using the Stark broadening of lines spontaneously emitted by a plasma. This direct method allows us to obtain experimental results that are in good agreement with others previously obtained for the same type of discharge. Its advantages and disadvantages compared to other direct methods of diagnostics, namely Thomson scattering, are also discussed. (rapid communication)
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
Directory of Open Access Journals (Sweden)
Aynur Batkan
2012-06-01
Full Text Available In this research, the effects of three different holding periods (6, 12 and 24 hours prior to storage on the quality attributes of Starking Delicious apples were investigated during storage of 8 months at 0.5 ± 1.0 ºC. Changes in weight loss, flesh firmness, pH values, soluble dry matter amount, titratable acidity values, ascorbic acid contents, and total and reducing sugar content were determined. According to the results, the holding period showed statistically significant changes in the quality attributes of the apples (p < 0.05.
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
Reversible Data Hiding Using Two Marked Images Based on Adaptive Coefficient-Shifting Algorithm
Directory of Open Access Journals (Sweden)
Ching-Yu Yang
2012-01-01
Full Text Available This paper proposes a novel form of reversible data hiding using two marked images by employing the adaptive coefficient-shifting (ACS algorithm. The proposed ACS algorithm consists of three parts: the minimum-preserved scheme, the minimum-preserved with squeezing scheme, and the base-value embedding scheme. More specifically, each input block of a host image can be encoded to two stego-blocks according to three predetermined rules by the above three schemes. Simulations validate that the proposed method not only completely recovers the host medium but also losslessly extracts the hidden message. The proposed method can handle various kinds of images without any occurrence of overflow/underflow. Moreover, the payload and peak signal-to-noise ratio (PSNR performance of the proposed method is superior to that of the conventional invertible data hiding schemes. Furthermore, the number of shadows required by the proposed method is less than that required by the approaches which are based upon secret image sharing with reversible steganography.
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
Coupled-cluster treatment of molecular strong-field ionization
Jagau, Thomas-C.
2018-05-01
Ionization rates and Stark shifts of H2, CO, O2, H2O, and CH4 in static electric fields have been computed with coupled-cluster methods in a basis set of atom-centered Gaussian functions with a complex-scaled exponent. Consideration of electron correlation is found to be of great importance even for a qualitatively correct description of the dependence of ionization rates and Stark shifts on the strength and orientation of the external field. The analysis of the second moments of the molecular charge distribution suggests a simple criterion for distinguishing tunnel and barrier suppression ionization in polyatomic molecules.
Transients of the electromagnetically-induced-transparency-enhanced refractive Kerr nonlinearity
International Nuclear Information System (INIS)
Pack, M. V.; Camacho, R. M.; Howell, J. C.
2007-01-01
We report observations of the dynamics of electromagnetically induced transparency (EIT) in a Λ system when the ground states are Stark shifted. Interactions of this type exhibit large optical nonlinearities called Kerr nonlinearities, and have numerous applications. The EIT Kerr nonlinearity is relatively slow, which is a limiting factor that may make many potential applications impossible. Using rubidium atoms, we observe the dynamics of the EIT Kerr nonlinearity using a Mach-Zehnder interferometer to measure phase modulation of the EIT fields resulting from a pulsed signal beam Stark shifting the ground state energy levels. The rise times and transients agree well with theory
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
CSIR Research Space (South Africa)
Zoorob, SE
2018-01-01
Full Text Available he concept of temperature shift factor (aT) as defined by Doolittle, relating the free volume of a viscoelastic material at the current and reference states is briefly examined together with the resultant William-Landel-Ferry equation. This paper...
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
Stark tuning and electrical charge state control of single divacancies in silicon carbide
de las Casas, Charles F.; Christle, David J.; Ul Hassan, Jawad; Ohshima, Takeshi; Son, Nguyen T.; Awschalom, David D.
2017-12-01
Neutrally charged divacancies in silicon carbide (SiC) are paramagnetic color centers whose long coherence times and near-telecom operating wavelengths make them promising for scalable quantum communication technologies compatible with existing fiber optic networks. However, local strain inhomogeneity can randomly perturb their optical transition frequencies, which degrades the indistinguishability of photons emitted from separate defects and hinders their coupling to optical cavities. Here, we show that electric fields can be used to tune the optical transition frequencies of single neutral divacancy defects in 4H-SiC over a range of several GHz via the DC Stark effect. The same technique can also control the charge state of the defect on microsecond timescales, which we use to stabilize unstable or non-neutral divacancies into their neutral charge state. Using fluorescence-based charge state detection, we show that both 975 nm and 1130 nm excitation can prepare their neutral charge state with near unity efficiency.
Advanced DC/AC inverters applications in renewable energy
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
Qing-Hui, Wang; Xu-Ping, Shao; Xiao-Hua, Yang
2016-01-01
Hyperfine structures of ICl in its vibronic ground state due to the nuclear spin and electric quadruple interactions are determined by diagonalizing the effective Hamiltonian matrix. Furthermore, the Stark sub-levels are precisely determined as well. The results are helpful for electro-static manipulation (trapping or further cooling) of cold ICl molecules. For example, an electric field of 1000 V/cm can trap ICl molecules less than 637 μK in the lowest hyperfine level. Project supported by the National Natural Science Foundation of China (Grant No. 11034002), the National Basic Research Program of China (Grant No. 2011CB921602), and Qing Lan Project, China.
Chen, Horng-Shyang; Liu, Zhan Hui; Shih, Pei-Ying; Su, Chia-Ying; Chen, Chih-Yen; Lin, Chun-Han; Yao, Yu-Feng; Kiang, Yean-Woei; Yang, C C
2014-04-07
A reverse-biased voltage is applied to either device in the vertical configuration of two light-emitting diodes (LEDs) grown on patterned and flat Si (110) substrates with weak and strong quantum-confined Stark effects (QCSEs), respectively, in the InGaN/GaN quantum wells for independently controlling the applied voltage across and the injection current into the p-i-n junction in the lateral configuration of LED operation. The results show that more carrier supply is needed in the LED of weaker QCSE to produce a carrier screening effect for balancing the potential tilt in increasing the forward-biased voltage, when compared with the LED of stronger QCSE. The small spectral shift range in increasing injection current in the LED of weaker QCSE is attributed not only to the weaker QCSE, but also to its smaller device resistance such that a given increment of applied voltage leads to a larger increment of injection current. From a viewpoint of practical application in LED operation, by applying a reverse-biased voltage in the vertical configuration, the applied voltage and injection current in the lateral configuration can be independently controlled by adjusting the vertical voltage for keeping the emission spectral peak fixed.
N-Mesityl-C-acylketenimines: 1,5-Sigmatropic Shifts and Electrocyclization to Quinolines.
Rao, V. V. Ramana; Fulloon, Belinda E.; Bernhardt, Paul V.; Koch, Rainer; Wentrup, Curt
1998-08-21
Flash vacuum thermolysis (FVT) of triazoles 6a-c generates alpha-oxoketenimines 10, the ester 10a being isolable. FVT of pyrroledione 8 generates the isomeric imidoylketene 9a. Ketenes 9 and ketenimines 10 undergo thermal interconversion by 1,3-shifts of methoxy and dimethylamino groups under mild FVT conditions (ca. 350-400 degrees C). Both 9 and 10 are directly observable by IR spectroscopy at either 77 K or on Ar matrix isolation at 12 K. On FVT at temperatures above ca. 400 degrees C, the ketenimines 10 undergo a 1,5-H shift to o-quinoid imines 12/13, followed by electrocyclization to dihydroquinolines 14 (unobserved) and 15 (observed by NMR). The latter are easily oxidized to alkylquinoline-3-carboxylates or quinoline-3-carboxamides 16 by atmospheric oxygen. Ab initio calculations on model compounds 18-23 predict an energy barrier of ca. 38 kcal mol(-)(1) (161 kJ mol(-)(1)) for the 1,5-H shift in N-(o-methylphenyl)ketenimines via the transition state TS19 followed by an electrocyclization barrier to dihydroquinoline 23a via TS22a of ca. 16 kcal mol(-)(1).
A single-phase embedded Z-source DC-AC inverter.
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
Optimal superadiabatic population transfer and gates by dynamical phase corrections
Vepsäläinen, A.; Danilin, S.; Paraoanu, G. S.
2018-04-01
In many quantum technologies adiabatic processes are used for coherent quantum state operations, offering inherent robustness to errors in the control parameters. The main limitation is the long operation time resulting from the requirement of adiabaticity. The superadiabatic method allows for faster operation, by applying counterdiabatic driving that corrects for excitations resulting from the violation of the adiabatic condition. In this article we show how to construct the counterdiabatic Hamiltonian in a system with forbidden transitions by using two-photon processes and how to correct for the resulting time-dependent ac-Stark shifts in order to enable population transfer with unit fidelity. We further demonstrate that superadiabatic stimulated Raman passage can realize a robust unitary NOT-gate between the ground state and the second excited state of a three-level system. The results can be readily applied to a three-level transmon with the ladder energy level structure.
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
7 CFR 1737.31 - Area Coverage Survey (ACS).
2010-01-01
... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...
Energy Technology Data Exchange (ETDEWEB)
Hernandez, Federico J. [Department of Chemistry, University of Georgia, Athens, Georgia 30602 (United States); INFIQC, Dpto. de Fisicoquímica, Facultad de Ciencias Químicas, Centro Láser de Ciencias Moleculares, Universidad Nacional de Córdoba, Ciudad Universitaria, Pabellón, X5000HUA Córdoba (Argentina); Brice, Joseph T.; Leavitt, Christopher M.; Liang, Tao; Douberly, Gary E., E-mail: douberly@uga.edu [Department of Chemistry, University of Georgia, Athens, Georgia 30602 (United States); Raston, Paul L. [Department of Chemistry and Biochemistry, James Madison University, Harrisonburg, Virginia 22807 (United States); Pino, Gustavo A. [INFIQC, Dpto. de Fisicoquímica, Facultad de Ciencias Químicas, Centro Láser de Ciencias Moleculares, Universidad Nacional de Córdoba, Ciudad Universitaria, Pabellón, X5000HUA Córdoba (Argentina)
2015-10-28
Small water clusters containing a single hydroxyl radical are synthesized in liquid helium droplets. The OH–H{sub 2}O and OH(D{sub 2}O){sub n} clusters (n = 1-3) are probed with infrared laser spectroscopy in the vicinity of the hydroxyl radical OH stretch vibration. Experimental band origins are qualitatively consistent with ab initio calculations of the global minimum structures; however, frequency shifts from isolated OH are significantly over-predicted by both B3LYP and MP2 methods. An effective Hamiltonian that accounts for partial quenching of electronic angular momentum is used to analyze Stark spectra of the OH–H{sub 2}O and OH–D{sub 2}O binary complexes, revealing a 3.70(5) D permanent electric dipole moment. Computations of the dipole moment are in good agreement with experiment when large-amplitude vibrational averaging is taken into account. Polarization spectroscopy is employed to characterize two vibrational bands assigned to OH(D{sub 2}O){sub 2}, revealing two nearly isoenergetic cyclic isomers that differ in the orientation of the non-hydrogen-bonded deuterium atoms relative to the plane of the three oxygen atoms. The dipole moments for these clusters are determined to be approximately 2.5 and 1.8 D for “up-up” and “up-down” structures, respectively. Hydroxyl stretching bands of larger clusters containing three or more D{sub 2}O molecules are observed shifted approximately 300 cm{sup −1} to the red of the isolated OH radical. Pressure dependence studies and ab initio calculations imply the presence of multiple cyclic isomers of OH(D{sub 2}O){sub 3}.
Chen, Zhi-Teng; Du, Yu-Zhou
2016-01-01
A new species of the Neoperla clymene group (Plecoptera, Perlidae), Neoperla chebalinga sp. n. from Guangdong Province of southern China is described, illustrated, and compared with related taxa. The new species is characterized by the slender aedeagal tube, strongly sclerotized dorsally, and weakly sclerotized ventrally with an upcurved, medial, finger-like membranous lobe. Additionally the aedeagal sac gradually tapers to a blunt apex with a dorsoapical patch of spines. A supplementary description of the female of Neoperla mnong Stark, 1987 from Guangdong Province, China is also given.
Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers
Directory of Open Access Journals (Sweden)
Abdul Sattar Larik
2011-01-01
Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.
Layfield, Joshua P; Hammes-Schiffer, Sharon
2013-01-16
The vibrational Stark effect provides insight into the roles of hydrogen bonding, electrostatics, and conformational motions in enzyme catalysis. In a recent application of this approach to the enzyme ketosteroid isomerase (KSI), thiocyanate probes were introduced in site-specific positions throughout the active site. This paper implements a quantum mechanical/molecular mechanical (QM/MM) approach for calculating the vibrational shifts of nitrile (CN) probes in proteins. This methodology is shown to reproduce the experimentally measured vibrational shifts upon binding of the intermediate analogue equilinen to KSI for two different nitrile probe positions. Analysis of the molecular dynamics simulations provides atomistic insight into the roles that key residues play in determining the electrostatic environment and hydrogen-bonding interactions experienced by the nitrile probe. For the M116C-CN probe, equilinen binding reorients an active-site water molecule that is directly hydrogen-bonded to the nitrile probe, resulting in a more linear C≡N--H angle and increasing the CN frequency upon binding. For the F86C-CN probe, equilinen binding orients the Asp103 residue, decreasing the hydrogen-bonding distance between the Asp103 backbone and the nitrile probe and slightly increasing the CN frequency. This QM/MM methodology is applicable to a wide range of biological systems and has the potential to assist in the elucidation of the fundamental principles underlying enzyme catalysis.
Importance of Attenuation Correction (AC) for Small Animal PET Imaging
DEFF Research Database (Denmark)
El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær
2012-01-01
was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...
Energy Technology Data Exchange (ETDEWEB)
Hazarika, J.; Kumar, A., E-mail: ask@tezu.ernet.in
2014-08-15
In this paper, we report the 160 MeV Ni{sup 12+} swift heavy ions (SHIs) irradiation effects on AC conductivity and dielectric relaxation properties of polypyrrole (PPy) nanoparticles in the frequency range of 42 Hz–5 MHz. Four ion fluences of 5 × 10{sup 10}, 1 × 10{sup 11}, 5 × 10{sup 11} and 1 × 10{sup 12} ions/cm{sup 2} have been used for the irradiation purpose. Transport properties in the pristine and irradiated PPy nanoparticles have been investigated with permittivity and modulus formalisms to study the polarization effects and conductivity relaxation. With increasing ion fluence, the relaxation peak in imaginary modulus (M{sup ″}) plots shifts toward high frequency suggesting long range motion of the charge carriers. The AC conductivity studies suggest correlated barrier hopping as the dominant transport mechanism. The hopping distance (R{sub ω}) of the charge carriers decreases with increasing the ion fluence. Binding energy (W{sub m}) calculations depict that polarons are the dominant charge carriers.
THE ACS NEARBY GALAXY SURVEY TREASURY
International Nuclear Information System (INIS)
Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.
2009-01-01
The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
Scaling and universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, Jeppe
2000-01-01
Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...
Directory of Open Access Journals (Sweden)
Mukherjee Sunil K
2010-06-01
Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.
Preliminary study on AC superconducting machines
International Nuclear Information System (INIS)
Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.
1988-01-01
This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed
21 CFR 880.5500 - AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...
Cooperative Frequency Control for Autonomous AC Microgrids
DEFF Research Database (Denmark)
Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.
2015-01-01
Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
AC power flow importance measures considering multi-element failures
International Nuclear Information System (INIS)
Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling
2017-01-01
Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.
Systémový pohled na klub AC Sparta
Čečák, František
2015-01-01
Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Directory of Open Access Journals (Sweden)
Zhi-Teng Chen
2016-09-01
Full Text Available A new species of the Neoperla clymene group (Plecoptera, Perlidae, N. chebalinga sp. n. from Guangdong Province of southern China is described, illustrated, and compared with related taxa. The new species is characterized by the slender aedeagal tube, strongly sclerotized dorsally, and weakly sclerotized ventrally with an upcurved, medial, finger-like membranous lobe. Additionally the aedeagal sac gradually tapers to a blunt apex with a dorsoapical patch of spines. A supplementary description of the female of N. mnong Stark, 1987 from Guangdong Province, China is also given.
Aragonite coating solutions (ACS) based on artificial seawater
Tas, A. Cuneyt
2015-03-01
Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org
2002-12-01
The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.
Suicide cases investigated at the state mortuary in Bloemfontein ...
African Journals Online (AJOL)
2009-07-27
Jul 27, 2009 ... Correspondence to: Dr Karen Stark, e-mail: starkk.md@ufs.ac.za. Keywords: suicide; profile; rate; prevention; Free State Province. Introduction. Completed suicide is defined as any fatality resulting directly or indirectly from a deed committed by the victim who believed or knew that his/her action would result ...
ac propulsion system for an electric vehicle
Geppert, S.
1980-01-01
It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.
Simultaneous influence of Stark effect and excessive line broadening on the Hα line
Cvetanović, Nikola; Ivković, Saša S.; Obradović, Bratislav M.; Kuraica, Milorad M.
2017-12-01
The aim of this paper is to study the combined influence of the Stark effect and the excessive Doppler broadening on the Balmer alpha line in hydrogen discharges. Since this line is a good candidate for measuring electric field in various types of discharges with different gas compositions, a simple method for field measurement based on polarization spectroscopy is developed, that includes all the excitation mechanisms. To simultaneously test the flexibility of the fitting procedure and investigate the excessive broadening, we applied the fitting procedure on line profiles obtained at a range of conditions from two different discharges. The range of pressures and voltages was examined in an abnormal glow and in dielectric barrier discharge operating with hydrogen gas. The model fitting function was able to respond and follow the change in the line profile caused by the change of conditions. This procedure can therefore be recommended for electric field measurement. Contribution to the "Topical Issue: Physics of Ionized Gases (SPIG 2016)", edited by Goran Poparic, Bratislav Obradovic, Dragana Maric and Aleksandar Milosavljevic.
Systémový pohled na klub AC Sparta
Čečák, František
2014-01-01
Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string
Mapa acústico parcial de Benetusser
MORILLA CASTELLANOS, EMILIO
2012-01-01
Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...
DEFF Research Database (Denmark)
Liu, Xiong; Wang, Peng; Loh, Poh Chiang
2011-01-01
This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...
AC conductivity of a quantum Hall line junction
International Nuclear Information System (INIS)
Agarwal, Amit; Sen, Diptiman
2009-01-01
We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.
International Nuclear Information System (INIS)
King, D.S.; Cox, A.N.; Hodson, S.W.
1975-01-01
Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)
ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus
International Nuclear Information System (INIS)
Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi
2007-01-01
orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
Detection of Genetic Modification 'ac2' in Potato Foodstuffs
Directory of Open Access Journals (Sweden)
Petr Kralik
2009-01-01
Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.
Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk
2015-01-01
An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493
Ammonia treated Mo/AC catalysts for CO hydrogenation with ...
Indian Academy of Sciences (India)
SHARIF F ZAMAN
the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.
Publications & News Shift Colors Pages default Sign In NPC Logo Banner : Shift Colors Search Navy Personnel Command > Reference Library > Publications & News > Shift Colors Top Link Bar Navy Personnel Library Expand Reference Library Quick Launch Shift Colors Shift Colors Archives Mailing Address How to
Estimation of the Thurstonian model for the 2-AC protocol
DEFF Research Database (Denmark)
Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.
2012-01-01
. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...
International Nuclear Information System (INIS)
Perez, C.; Rosa, M. I. de la; Gruetzmacher, K.; Fuentes, L. M.; Gonzalo, A. B.
2008-01-01
In this work we present Doppler-free two-photon optogalvanic spectroscopy as a tool to measure the electric field strength in the cathode fall region of a hollow cathode discharge via the Stark splitting of the 2S level of atomic deuterium. The strong electric field strength present in the hollow cathode is determined for various discharge conditions which allows studying the corresponding variations of the cathode fall, and its changes with discharge operation time.
System and method for determining stator winding resistance in an AC motor
Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI
2011-05-31
A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.
Generation of ion-acoustic waves in an inductively coupled, low-pressure discharge lamp
International Nuclear Information System (INIS)
Camparo, J. C.; Klimcak, C. M.
2006-01-01
For a number of years it has been known that the alkali rf-discharge lamps used in atomic clocks can exhibit large amplitude intensity oscillations. These oscillations arise from ion-acoustic plasma waves and have typically been associated with erratic clock behavior. Though large amplitude ion-acoustic plasma waves are clearly deleterious for atomic clock operation, it does not follow that small amplitude oscillations have no utility. Here, we demonstrate two easily implemented methods for generating small amplitude ion-acoustic plasma waves in alkali rf-discharge lamps. Furthermore, we demonstrate that the frequency of these waves is proportional to the square root of the rf power driving the lamp and therefore that their examination can provide an easily accessible parameter for monitoring and controlling the lamp's plasma conditions. This has important consequences for precise timekeeping, since the atomic ground-state hyperfine transition, which is the heart of the atomic clock signal, can be significantly perturbed by changes in the lamp's output via the ac-Stark shift
International Nuclear Information System (INIS)
Mohideen, U.
1993-01-01
This thesis is a study of the effect of high intensity lasers on atoms, free electrons and the generation of X-rays from solid density plasmas. The laser produced 50 milli Joule 180 femto sec pulses at 5 Hz. This translates to a maximum intensity of 5 x 10 18 W/cm 2 . At such high fields the AC stark shifts of atoms placed at the focus is much greater than the ionization energy. The characteristics of multiphoton ionization of atoms in intense laser fields was studied by angle resolved photoelectron spectroscopy. Free electrons placed in high intensity laser fields lead to harmonic generation. This phenomenon of Nonlinear Compton Scattering was theoretically investigated. Also, when these high intensity pulses are focused on solids a hot plasma is created. This plasma is a bright source of a short X-ray pulse. The pulse-width of X-rays from these solid density plasmas was measured by time-resolved X-ray spectroscopy
Lamin A/C might be involved in the EMT signalling pathway.
Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu
2018-07-15
We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.
Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids
DEFF Research Database (Denmark)
Chiang Loh, Poh; Li, Ding; Kang Chai, Yi
2013-01-01
sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...
International Nuclear Information System (INIS)
Sandolache, G.; Zoita, V.; Bauchire, M.; Le Menn, E.; Gentils, F.; Fleurier, C.
2001-01-01
Copper lines are frequently observed in various types of plasma device and industrial plasmas and then it is desirable to develop methods of plasma diagnostics using the emission spectrum of copper lines. The aim of this work is to create a database for the neutral copper spectral lines directly usable for the diagnostic of plasmas with metal vapors. An experimental device has been developed to create a metal plasma having the required metrological properties to facilitate the spectroscopic measurements. A capillary discharge technique has been used to create a plasma jet representing a radially symmetric light source. The copper-hydrogen plasma jet was produced by the ablation of the capillary wall consisting of a copper-embedded elastomer. The plasma jet was observed side-on using the high-resolution spectrometers equipped with ICCD detectors. The 2D square matrix ICCD detectors have permitted the observation of cross sections of the plasma jet. The high-speed time resolved camera equipped with interference filters has been used to check the cylindrical shape and the homogeneity of the plasma jet. The electron density of the plasma jet was obtained by using the H α spectral line of the hydrogen component plasma. The temperature was determined by applying the relative intensity method to the measured intensities of the neutral copper spectral lines emitted by the plasma jet. The hydrogen and copper lines were broadened principally by the Stark effect. The measured temperatures were about 15,000 K and the electron density of about 2x10 17 cm -3 . The results of the Stark broadening of the neutral cooper concerned particularly the lines 453.9 nm, 465.1 nm, 515.3 nm and 529.2 nm. (authors)
The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology
Directory of Open Access Journals (Sweden)
Anja Pahor
2018-01-01
Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.
Shrestha, Rebika; Cardenas, Alfredo E; Elber, Ron; Webb, Lauren J
2015-02-19
The magnitude of the membrane dipole field was measured using vibrational Stark effect (VSE) shifts of nitrile oscillators placed on the unnatural amino acid p-cyanophenylalanine (p-CN-Phe) added to a peptide sequence at four unique positions. These peptides, which were based on a repeating alanine-leucine motif, intercalated into small unilamellar DMPC vesicles which formed an α-helix as confirmed by circular dichroic (CD) spectroscopy. Molecular dynamics simulations of the membrane-intercalated helix containing two of the nitrile probes, one near the headgroup region of the lipid (αLAX(25)) and one buried in the interior of the bilayer (αLAX(16)), were used to examine the structure of the nitrile with respect to the membrane normal, the assumed direction of the dipole field, by quantifying both a small tilt of the helix in the bilayer and conformational rotation of the p-CN-Phe side chain at steady state. Vibrational absorption energies of the nitrile oscillator at each position showed a systematic blue shift as the nitrile was stepped toward the membrane interior; for several different concentrations of peptide, the absorption energy of the nitrile located in the middle of the bilayer was ∼3 cm(-1) greater than that of the nitrile closest to the surface of the membrane. Taken together, the measured VSE shifts and nitrile orientations within the membrane resulted in an absolute magnitude of 8-11 MV/cm for the dipole field, at the high end of the range of possible values that have been accumulated from a variety of indirect measurements. Implications for this are discussed.
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
Lanthanide shift reagents, binding, shift mechanisms and exchange
International Nuclear Information System (INIS)
Boer, J.W.M. de
1977-01-01
Paramagnetic lanthanide shift reagents, when added to a solution of a substrate, induce shifts in the nuclear magnetic resonance (NMR) spectrum of the substrate molecules. The induced shifts contain information about the structure of the shift reagent substrate complex. The structural information, however, may be difficult to extract because of the following effects: (1) different complexes between shift reagent and substrate may be present in solution, e.g. 1:1 and 1:2 complexes, and the shift observed is a weighed average of the shifts of the substrate nuclei in the different complexes; (2) the Fermi contact interaction, arising from the spin density at the nucleus, contributes to the induced shift; (3) chemical exchange effects may complicate the NMR spectrum. In this thesis, the results of an investigation into the influence of these effects on the NMR spectra of solutions containing a substrate and LSR are presented. The equations describing the pseudo contact and the Fermi contact shift are derived. In addition, it is shown how the modified Bloch equations describing the effect of the chemical exchange processes occurring in the systems studied can be reduced to the familiar equations for a two-site exchange case. The binding of mono- and bifunctional ethers to the shift reagent are reported. An analysis of the induced shifts is given. Finally, the results of the experiments performed to study the exchange behavior of dimethoxyethane and heptafluorodimethyloctanedionato ligands are presented
Tang, Cheng; Zhang, Teng; Weiss, David S.
2018-03-01
We explore ways to use the ability to measure the populations of individual magnetic sublevels to improve the sensitivity of magnetic field measurements and measurements of atomic electric dipole moments (EDMs). When atoms are initialized in the m =0 magnetic sublevel, the shot-noise-limited uncertainty of these measurements is 1 /√{2 F (F +1 ) } smaller than that of a Larmor precession measurement. When the populations in the even (or odd) magnetic sublevels are combined, we show that these measurements are independent of the tensor Stark shift and the second order Zeeman shift. We discuss the complicating effect of a transverse magnetic field and show that when the ratio of the tensor Stark shift to the transverse magnetic field is sufficiently large, an EDM measurement with atoms initialized in the superposition of the stretched states can reach the optimal sensitivity.
International Nuclear Information System (INIS)
Rinkleff, R.H.
1977-01-01
Using the method of optical double resonance, the 5s5p 3 P 1 level tensor polarizability of Cadmium has been measured. For this state, various authors have published different results, using different experimental methods. The experimental result presented here is in excellent agreement with the value of Happer, based on level crossing investigations, and agrees well with the theoretical result of Robinson based on a modified Sternheimer approximation, and so gives a reliable value for the tensor polarizability. Furthermore the tensor polarizability of the 6s6p 3 P 1 - level of the even Ytterbium isotopes and the odd Ytterbium 171 nucleus have been measured with the optical double resonance method, and the Stark constant has been calculated based on a given theory and oscillator strengths. Using the methods of optical double resonance and level crossing, the tensor polarizability of 5 excited levels of the Thulium configurations 4f 13 6s6p + 4f 12 5d6s 2 have been measured. From the experimental Stark constants and the angular coefficients of the eigenfunctions calculated by Camus, the radial integrals I(5d, 5p) and I(6p, 5d) are calculated for electric dipole transitions between levels of the configurations 4f 12 5d6s 2 + 4f 13 6s6p and levels of the 4f 12 6p6s 2 + 4f 13 6s5d configurations. The tensor polarizability calculated with these radial integrals show very good agreement with the experimental values. (orig./LH) [de
Nuclear structure of {sup 231}Ac
Energy Technology Data Exchange (ETDEWEB)
Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)
2008-10-15
The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.
Statistical time lags in ac discharges
International Nuclear Information System (INIS)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F
2011-01-01
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Statistical time lags in ac discharges
Energy Technology Data Exchange (ETDEWEB)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)
2011-04-06
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Study on AC loss measurements of HTS power cable for standardizing
Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi
2017-09-01
High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..
a.c. conductance study of polycrystal C60
International Nuclear Information System (INIS)
Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin
1995-01-01
The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))
International Nuclear Information System (INIS)
Liu, Qian; Wang, Yang; He, Jianguo; Ji, Fang; Wang, Baorui
2014-01-01
An algorithm is proposed to deal with tilt-shift errors in temporal phase-shift interferometry (PSI). In the algorithm, the tilt shifts are detected with the spatial-carrier phase-shift (SCPS) method and then the tilt shifts are applied as priori information to the least-squares fittings of phase retrieval. The algorithm combines the best features of the SCPS and the temporal PSI. The algorithm could be applied to interferograms of arbitrary aperture without data extrapolation for the Fourier transform is not involved. Simulations and experiments demonstrate the effectiveness of the algorithm. The statistics of simulation results show a satisfied accuracy in detecting tilt-shift errors. Comparisons of the measurements with and without environmental vibration show that the proposed algorithm could compensate tilt-shift errors and retrieve wavefront phase accurately. The algorithm provides an approach to retrieve wavefront phase for the temporal PSI in vibrating environment. (paper)
Control of Power Converters in AC Microgrids
DEFF Research Database (Denmark)
Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede
2012-01-01
The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...
Droop-free Distributed Control for AC Microgrids
DEFF Research Database (Denmark)
Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.
2016-01-01
A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...
Effect of AC electric fields on the stabilization of premixed bunsen flames
Kim, Minkuk
2011-01-01
The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.
Objectives and status of development of AC600
International Nuclear Information System (INIS)
Zhao Chengkun
1997-01-01
AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600
Introduction of hvdc transmission into a predominantly ac network
Energy Technology Data Exchange (ETDEWEB)
Casson, W; Last, F H; Huddart, K W
1966-02-01
Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.
21 CFR 880.5510 - Non-AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...
Effect of temperature on the AC impedance of protein
Indian Academy of Sciences (India)
The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...
Directory of Open Access Journals (Sweden)
Vinod Kumar Singh
2016-09-01
Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.
Mahakarnchanakul, W; Beuchat, L R
1999-03-15
A study was done to determine the influence of temperature on growth and toxin production characteristics of psychrotrophic and mesophilic strains of Bacillus cereus when inoculated into mashed potatoes and chicken gravy containing various concentrations of sodium chloride and held at temperatures different from those at which cells had been cultured. Logarithmic growth phase cells (10 h, 30 degrees C) of psychrotrophic (F3802A/84) and mesophilic (B4ac-1) strains of Bacillus cereus were inoculated into rehydrated commercially processed instant mashed potatoes and chicken gravy supplemented with 0, 2, or 4% sodium chloride. Growth, survival, and diarrheal toxin production in potatoes and gravy held at 30, 37, and 10 degrees C (strain F3802A/84) or 30, 40, and 10 degrees C (strain B4ac-1) were monitored. Both strains grew in both foods containing no added sodium chloride or 2% sodium chloride when held at 30, 37, or 40 degrees C for 2 days. Strain B4ac-1 grew better than strain F3802A/84 in foods containing 4% sodium chloride. Maximum amounts of enterotoxin (1024 ng/g) were produced by strain B4ac-1 in chicken gravy held at 30 and 40 degrees C. Strain F3802A/84 grew to populations of 7 log10 CFU/g in foods containing no added sodium chloride or 2% sodium chloride at 10 degrees C. Strain F3802A/84 produced the highest amount of enterotoxin (1024 ng/g) at 30 degrees C in chicken gravy containing 0.7 or 2% sodium chloride; however, little or low amounts of toxin (4-16 ng/g) were produced in chicken gravy at 10 degrees C. Compared to strain B4ac-1, cells of strain F3802A/84 subjected to a downward shift in incubation temperature (10 degrees C) grew more rapidly in chicken gravy. Strain B4ac-1 produced the highest amount of toxin (1024 ng/g) at 30 degrees C in gravy containing 4% sodium chloride and at 40 degrees C in gravy containing 0.7% sodium chloride. Toxin was not detected in inoculated mashed potatoes. Results of this study indicate that shifts in incubation
International Nuclear Information System (INIS)
Schneider, Jochen M.; Music, Denis; Sun Zhimei
2005-01-01
We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion
Low ac loss geometries in YBCO coated conductors and impact on conductor stability
Energy Technology Data Exchange (ETDEWEB)
Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.
Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven
International Nuclear Information System (INIS)
Smedley, K.
1992-04-01
The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab
Energy Technology Data Exchange (ETDEWEB)
Zafar, A., E-mail: zafara@ornl.gov [Department of Nuclear Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States); Oak Ridge National Laboratory, Oak Ridge, Tennessee 37830 (United States); Martin, E. H.; Isler, R. C.; Caughman, J. B. O. [Oak Ridge National Laboratory, Oak Ridge, Tennessee 37830 (United States); Shannon, S. C. [Department of Nuclear Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States)
2016-11-15
An electron density diagnostic (≥10{sup 10} cm{sup −3}) capable of high temporal (ms) and spatial (mm) resolution is currently under development at Oak Ridge National Laboratory. The diagnostic is based on measuring the Stark broadened, Doppler-free spectral line profile of the n = 6–2 hydrogen Balmer series transition. The profile is then fit to a fully quantum mechanical model including the appropriate electric and magnetic field operators. The quasi-static approach used to calculate the Doppler-free spectral line profile is outlined here and the results from the model are presented for H-δ spectra for electron densities of 10{sup 10}–10{sup 13} cm{sup −3}. The profile shows complex behavior due to the interaction between the magnetic substates of the atom.
Völler, Jan-Stefan; Biava, Hernan; Hildebrandt, Peter; Budisa, Nediljko
2017-11-01
To find experimental validation for electrostatic interactions essential for catalytic reactions represents a challenge due to practical limitations in assessing electric fields within protein structures. This review examines the applications of non-canonical amino acids (ncAAs) as genetically encoded probes for studying the role of electrostatic interactions in enzyme catalysis. ncAAs constitute sensitive spectroscopic probes to detect local electric fields by exploiting the vibrational Stark effect (VSE) and thus have the potential to map the protein electrostatics. Mapping the electrostatics in proteins will improve our understanding of natural catalytic processes and, in beyond, will be helpful for biocatalyst engineering. This article is part of a Special Issue entitled "Biochemistry of Synthetic Biology - Recent Developments" Guest Editor: Dr. Ilka Heinemann and Dr. Patrick O'Donoghue. Copyright © 2017 Elsevier B.V. All rights reserved.
Flame spread over inclined electrical wires with AC electric fields
Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho
2017-01-01
Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field
DC and AC biasing of a transition edge sensor microcalorimeter
International Nuclear Information System (INIS)
Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.
2002-01-01
We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions
Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2016-06-01
Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.
Aragonite coating solutions (ACS) based on artificial seawater
International Nuclear Information System (INIS)
Tas, A. Cuneyt
2015-01-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry
Aragonite coating solutions (ACS) based on artificial seawater
Energy Technology Data Exchange (ETDEWEB)
Tas, A. Cuneyt, E-mail: c_tas@hotmail.com
2015-03-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
Design of a New Optical System for Alcator C-Mod Motional Stark Effect Diagnostic
International Nuclear Information System (INIS)
Ko, Jinseok; Scott, Steve; Bitter, Manfred; Lerner, Scott
2009-01-01
The motional Stark effect (MSE) diagnostic on Alcator C-Mod uses an in-vessel optical system (five lenses and three mirrors) to relay polarized light to an external polarimeter because port access limitations on Alcator C-Mod preclude a direct view of the diagnostic beam. The system experiences unacceptable, spurious drifts of order several degrees in measured pitch angle over the course of a run day. Recent experiments illuminated the MSE diagnostic with polarized light of fixed orientation as heat was applied to various optical elements. A large change in measured angle was observed as two particular lenses were heated, indicating that thermal-stress-induced birefringence is a likely cause of the spurious variability. Several new optical designs have been evaluated to eliminate the affected in-vessel lenses and to replace the focusing they provide with curved mirrors; however, ray tracing calculations imply that this method is not feasible. A new approach is under consideration that utilizes in situ calibrations with in-vessel reference polarized light sources. 2008 American Institute of Physics.
Dong, Zhijun; Yu, Yanwen; Li, Shenghui; Wang, Juan; Tang, Saijun; Huang, Rongfeng
2016-01-04
Increasing evidence has revealed that abscisic acid (ABA) negatively modulates ethylene biosynthesis, although the underlying mechanism remains unclear. To identify the factors involved, we conducted a screen for ABA-insensitive mutants with altered ethylene production in Arabidopsis. A dominant allele of ABI4, abi4-152, which produces a putative protein with a 16-amino-acid truncation at the C-terminus of ABI4, reduces ethylene production. By contrast, two recessive knockout alleles of ABI4, abi4-102 and abi4-103, result in increased ethylene evolution, indicating that ABI4 negatively regulates ethylene production. Further analyses showed that expression of the ethylene biosynthesis genes ACS4, ACS8, and ACO2 was significantly decreased in abi4-152 but increased in the knockout mutants, with partial dependence on ABA. Chromatin immunoprecipitation-quantitative PCR assays showed that ABI4 directly binds the promoters of these ethylene biosynthesis genes and that ABA enhances this interaction. A fusion protein containing the truncated ABI4-152 peptide accumulated to higher levels than its full-length counterpart in transgenic plants, suggesting that ABI4 is destabilized by its C terminus. Therefore, our results demonstrate that ABA negatively regulates ethylene production through ABI4-mediated transcriptional repression of the ethylene biosynthesis genes ACS4 and ACS8 in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.
D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.
2016-07-01
The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC particle rejection efficiency.
Development of low AC loss windings for superconducting traction transformer
International Nuclear Information System (INIS)
Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K
2010-01-01
We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.
Hybrid AC-High Voltage DC Grid Stability and Controls
Yu, Jicheng
The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient
Energy Technology Data Exchange (ETDEWEB)
Wu, Tian-Li, E-mail: Tian-Li.Wu@imec.be; Groeseneken, Guido [imec, Kapeldreef 75, 3001 Leuven (Belgium); Department of Electrical Engineering, KU Leuven, Leuven (Belgium); Marcon, Denis; De Jaeger, Brice; Lin, H. C.; Franco, Jacopo; Stoffels, Steve; Van Hove, Marleen; Decoutere, Stefaan [imec, Kapeldreef 75, 3001 Leuven (Belgium); Bakeroot, Benoit [imec, Kapeldreef 75, 3001 Leuven (Belgium); Centre for Microsystems Technology, Ghent University, 9052 Gent (Belgium); Roelofs, Robin [ASM, Kapeldreef 75, 3001 Leuven (Belgium)
2015-08-31
In this paper, three electrical techniques (frequency dependent conductance analysis, AC transconductance (AC-g{sub m}), and positive gate bias stress) were used to evaluate three different gate dielectrics (Plasma-Enhanced Atomic Layer Deposition Si{sub 3}N{sub 4}, Rapid Thermal Chemical Vapor Deposition Si{sub 3}N{sub 4}, and Atomic Layer Deposition (ALD) Al{sub 2}O{sub 3}) for AlGaN/GaN Metal-Insulator-Semiconductor High-Electron-Mobility Transistors. From these measurements, the interface state density (D{sub it}), the amount of border traps, and the threshold voltage (V{sub TH}) shift during a positive gate bias stress can be obtained. The results show that the V{sub TH} shift during a positive gate bias stress is highly correlated to not only interface states but also border traps in the dielectric. A physical model is proposed describing that electrons can be trapped by both interface states and border traps. Therefore, in order to minimize the V{sub TH} shift during a positive gate bias stress, the gate dielectric needs to have a lower interface state density and less border traps. However, the results also show that the commonly used frequency dependent conductance analysis technique to extract D{sub it} needs to be cautiously used since the resulting value might be influenced by the border traps and, vice versa, i.e., the g{sub m} dispersion commonly attributed to border traps might be influenced by interface states.
AC Calorimetric Design for Dynamic of Biological Materials
Shigeo Imaizumi
2006-01-01
We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...
Study of dielectric relaxation and AC conductivity of InP:S single crystal
El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.
2012-07-01
The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.
Self-field AC losses in Bi-2223 superconducting tapes
International Nuclear Information System (INIS)
Mueller, K. H.; Leslie, K.E.
1996-01-01
Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed
AC susceptibility of thin Pb films in intermediate and mixed state
Energy Technology Data Exchange (ETDEWEB)
Janu, Zdenek, E-mail: janu@fzu.cz [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Svindrych, Zdenek [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Trunecek, Otakar [Charles University in Prague, Faculty of Mathematics and Physics, Ke Karlovu 3, CZ-121 16 Prague 2 (Czech Republic); Kus, Peter; Plecenik, Andrej [Komenius University in Bratislava, Faculty of Mathematics, Physics, and Informatics, Mlynska dolina, 842 48 Bratislava 4 (Slovakia)
2011-12-15
Thickness dependent transition in AC susceptibility between intermediate and mixed state in type-I superconducting films. The temperature induced crossover between reversible and irreversible behavior was observed in the thicker film. The temperature dependence of the AC susceptibility in mixed state follows prediction of model based on Bean critical state. The temperature dependence of the harmonics of the complex AC susceptibility in the intermediate state is explained. Thin films of type I superconductors of a thickness comparable or less than a flux penetration length behave like type II superconductors in a mixed state. With decreasing film thickness normal domains carrying a magnetic flux get smaller with smaller number of flux quanta per domain and finally transform into single quantum flux lines, i.e. quantum vortices similar to those found in type II superconductors. We give an evidence of this behavior from the measurements of the nonlinear response of a total magnetic moment to an applied AC magnetic field, directly from the temperature dependence of an AC susceptibility.
Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.
2010-11-01
AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.
Flexible AC transmission systems: the state of the art
Energy Technology Data Exchange (ETDEWEB)
Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division
1994-12-31
Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.
Operation of AC Adapters Visualized Using Light-Emitting Diodes
Regester, Jeffrey
2016-01-01
A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…
A.C. losses in current-carrying superconductors
International Nuclear Information System (INIS)
Reuver, J.L. de.
1985-01-01
The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)
A New Analysis of Stark and Zeeman Effects on Hydrogen Lines in Magnetized DA White Dwarfs
Directory of Open Access Journals (Sweden)
Ny Kieu
2017-11-01
Full Text Available White dwarfs with magnetic field strengths larger than 10 T are understood to represent more than 10% of the total population of white dwarfs. The presence of such strong magnetic fields is clearly indicated by the Zeeman triplet structure visible on absorption lines. In this work, we discuss the line broadening mechanisms and focus on the sensitivity of hydrogen lines on the magnetic field. We perform new calculations in conditions relevant to magnetized DA stellar atmospheres using models inspired from magnetic fusion plasma spectroscopy. A white dwarf spectrum from the Sloan Digital Sky Survey (SDSS database is analyzed. An effective temperature is provided by an adjustment of the background radiation with a Planck function, and the magnetic field is inferred from absorption lines presenting a Zeeman triplet structure. An order-of-magnitude estimate for the electron density is also performed from Stark broadening analysis.
Logistics Reduction: Advanced Clothing System (ACS)
National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...
Early function of the Abutilon mosaic virus AC2 gene as a replication brake.
Krenz, Björn; Deuschle, Kathrin; Deigner, Tobias; Unseld, Sigrid; Kepp, Gabi; Wege, Christina; Kleinow, Tatjana; Jeske, Holger
2015-04-01
The C2/AC2 genes of monopartite/bipartite geminiviruses of the genera Begomovirus and Curtovirus encode important pathogenicity factors with multiple functions described so far. A novel function of Abutilon mosaic virus (AbMV) AC2 as a replication brake is described, utilizing transgenic plants with dimeric inserts of DNA B or with a reporter construct to express green fluorescent protein (GFP). Their replicational release upon AbMV superinfection or the individual and combined expression of epitope-tagged AbMV AC1, AC2, and AC3 was studied. In addition, the effects were compared in the presence and in the absence of an unrelated tombusvirus suppressor of silencing (P19). The results show that AC2 suppresses replication reproducibly in all assays and that AC3 counteracts this effect. Examination of the topoisomer distribution of supercoiled DNA, which indicates changes in the viral minichromosome structure, did not support any influence of AC2 on transcriptional gene silencing and DNA methylation. The geminiviral AC2 protein has been detected here for the first time in plants. The experiments revealed an extremely low level of AC2, which was slightly increased if constructs with an intron and a hemagglutinin (HA) tag in addition to P19 expression were used. AbMV AC2 properties are discussed with reference to those of other geminiviruses with respect to charge, modification, and size in order to delimit possible reasons for the different behaviors. The (A)C2 genes encode a key pathogenicity factor of begomoviruses and curtoviruses in the plant virus family Geminiviridae. This factor has been implicated in the resistance breaking observed in agricultural cotton production. AC2 is a multifunctional protein involved in transcriptional control, gene silencing, and regulation of basal biosynthesis. Here, a new function of Abutilon mosaic virus AC2 in replication control is added as a feature of this protein in viral multiplication, providing a novel finding on
Monolithic blue LED series arrays for high-voltage AC operation
Energy Technology Data Exchange (ETDEWEB)
Ao, Jin-Ping [Satellite Venture Business Laboratory, University of Tokushima, Tokushima 770-8506 (Japan); Sato, Hisao; Mizobuchi, Takashi; Morioka, Kenji; Kawano, Shunsuke; Muramoto, Yoshihiko; Sato, Daisuke; Sakai, Shiro [Nitride Semiconductor Co. Ltd., Naruto, Tokushima 771-0360 (Japan); Lee, Young-Bae; Ohno, Yasuo [Department of Electrical and Electronic Engineering, University of Tokushima, Tokushima 770-8506 (Japan)
2002-12-16
Design and fabrication of monolithic blue LED series arrays that can be operated under high ac voltage are described. Several LEDs, such as 3, 7, and 20, are connected in series and in parallel to meet ac operation. The chip size of a single device is 150 {mu}m x 120 {mu}m and the total size is 1.1 mm x 1 mm for a 40(20+20) LED array. Deep dry etching was performed as device isolation. Two-layer interconnection and air bridge are utilized to connect the devices in an array. The monolithic series array exhibit the expected operation function under dc and ac bias. The output power and forward voltage are almost proportional to LED numbers connected in series. On-wafer measurement shows that the output power is 40 mW for 40(20+20) LED array under ac 72 V. (Abstract Copyright [2002], Wiley Periodicals, Inc.)
pH sensing via bicarbonate-regulated ‘soluble’ adenylyl cyclase (sAC
Directory of Open Access Journals (Sweden)
Nawreen eRahman
2013-11-01
Full Text Available Soluble adenylyl cyclase (sAC is a source of the second messenger cyclic adenosine 3',5' monophosphate (cAMP. sAC is directly regulated by bicarbonate (HCO3- ions. In living cells, HCO3- ions are in nearly instantaneous equilibrium with carbon dioxide (CO2 and pH due to the ubiquitous presence of carbonic anhydrases. Numerous biological processes are regulated by CO2, HCO3-, and/or pH, and in a number of these, sAC has been shown to function as a physiological CO2/HCO3/pH sensor. In this review, we detail the known pH sensing functions of sAC, and we discuss two highly-studied, pH-dependent pathways in which sAC might play a role.
Efficient relaxations for joint chance constrained AC optimal power flow
Energy Technology Data Exchange (ETDEWEB)
Baker, Kyri; Toomey, Bridget
2017-07-01
Evolving power systems with increasing levels of stochasticity call for a need to solve optimal power flow problems with large quantities of random variables. Weather forecasts, electricity prices, and shifting load patterns introduce higher levels of uncertainty and can yield optimization problems that are difficult to solve in an efficient manner. Solution methods for single chance constraints in optimal power flow problems have been considered in the literature, ensuring single constraints are satisfied with a prescribed probability; however, joint chance constraints, ensuring multiple constraints are simultaneously satisfied, have predominantly been solved via scenario-based approaches or by utilizing Boole's inequality as an upper bound. In this paper, joint chance constraints are used to solve an AC optimal power flow problem while preventing overvoltages in distribution grids under high penetrations of photovoltaic systems. A tighter version of Boole's inequality is derived and used to provide a new upper bound on the joint chance constraint, and simulation results are shown demonstrating the benefit of the proposed upper bound. The new framework allows for a less conservative and more computationally efficient solution to considering joint chance constraints, specifically regarding preventing overvoltages.
Normal form of particle motion under the influence of an ac dipole
Directory of Open Access Journals (Sweden)
R. Tomás
2002-05-01
Full Text Available ac dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the ac dipole is adiabatically turned on and off. Therefore the ac dipole seems to be an adequate tool for nonlinear diagnostics provided the particle motion is well described in the presence of the ac dipole and nonlinearities. Normal forms and Lie algebra are powerful tools to study the nonlinear content of an accelerator lattice. In this article a way to obtain the normal form of the Hamiltonian of an accelerator with an ac dipole is described. The particle motion to first order in the nonlinearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the ac dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn motion and the Hamiltonian terms.
Analysis of Input and Output Ripples of PWM AC Choppers
Directory of Open Access Journals (Sweden)
Pekik Argo Dahono
2008-11-01
Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.
Schrabback, T.; Erben, T.; Simon, P.; Miralles, J.-M.; Schneider, P.; Heymans, C.; Eifler, T.; Fosbury, R. A. E.; Freudling, W.; Hetterscheidt, M.; Hildebrandt, H.; Pirzkal, N.
2007-06-01
Context: This is the first paper of a series describing our measurement of weak lensing by large-scale structure, also termed “cosmic shear”, using archival observations from the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope (HST). Aims: In this work we present results from a pilot study testing the capabilities of the ACS for cosmic shear measurements with early parallel observations and presenting a re-analysis of HST/ACS data from the GEMS survey and the GOODS observations of the Chandra Deep Field South (CDFS). Methods: We describe the data reduction and, in particular, a new correction scheme for the time-dependent ACS point-spread-function (PSF) based on observations of stellar fields. This is currently the only technique which takes the full time variation of the PSF between individual ACS exposures into account. We estimate that our PSF correction scheme reduces the systematic contribution to the shear correlation functions due to PSF distortions to MUSIC sample, we determine a local single field estimate for the mass power spectrum normalisation σ8, CDFS=0.52+0.11-0.15 (stat) ± 0.07(sys) (68% confidence assuming Gaussian cosmic variance) at a fixed matter density Ω_m=0.3 for a ΛCDM cosmology marginalising over the uncertainty of the Hubble parameter and the redshift distribution. We interpret this exceptionally low estimate to be due to a local under-density of the foreground structures in the CDFS. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archives at the Space Telescope European Coordinating Facility and the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.
Pantallas acústicas submarinas de material compuesto multilaminar con matriz metálica
Gallego, V.; Laguna, M.; Vázquez, A. J.
1999-01-01
7 pp.-- PACS nr.: 43.30.Ky.-- Comunicación presentada en los siguientes congresos: XXX Jornadas Nacionales de Acústica – TecniAcústica 1999. Encuentro Ibérico de Acústica (Ávila, 20-22 Octubre 1999).
International Nuclear Information System (INIS)
Meyerhoff, R.W.
1977-01-01
A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface
Autonomous Operation of Hybrid Microgrid with AC and DC Sub-Grids
DEFF Research Database (Denmark)
Loh, Poh Chiang; Blaabjerg, Frede
2011-01-01
the power flow among all the sources distributed throughout the two types of sub-grids, which certainly is tougher than previous efforts developed for only either ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc...... sources, ac sources and interlinking converters. Suitable control and normalization schemes are therefore developed for controlling them with results presented for showing the overall performance of the hybrid microgrid.......This paper investigates on the active and reactive power sharing of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac sub-grids, interconnected by power electronic interfaces. The main challenge here is to manage...
A Floquet-Green's function approach to mesoscopic transport under ac bias
International Nuclear Information System (INIS)
Wu, B H; Cao, J C
2008-01-01
The current response of a mesoscopic system under a periodic ac bias is investigated by combining the Floquet theorem and the nonequilibrium Green's function method. The band structure of the lead under ac bias is fully taken into account by using appropriate self-energies in an enlarged Floquet space. Both the retarded and lesser Green's functions are obtained in the Floquet basis to account for the interference and interaction effects. In addition to the external ac bias, the time-varying Coulomb interaction, which is treated at the self-consistent Hartree-Fock level, provides another internal ac field. The numerical results show that the time-varying Coulomb field yields decoherence and reduces the ringing behavior of the current response to a harmonic bias
Tangi, Malleswararao; Mishra, Pawan; Janjua, Bilal; Prabaswara, Aditya; Zhao, Chao; Priante, Davide; Min, Jung-Wook; Ng, Tien Khee; Ooi, Boon S.
2018-03-01
We study the impact of quantum-confined stark effect (QCSE) on bias dependent micro-photoluminescence emission of the quantum disk (Q-disk) based nanowires light emitting diodes (NWs-LED) exhibiting the amber colored emission. The NWs are found to be nitrogen polar (N-polar) verified using KOH wet chemical etching and valence band spectrum analysis of high-resolution X-ray photoelectron spectroscopy. The crystal structure and quality of the NWs were investigated by high-angle annular dark field - scanning transmission electron microscopy. The LEDs were fabricated to acquire the bias dependent micro-photoluminescence spectra. We observe a redshift and a blueshift of the μPL peak in the forward and reverse bias conditions, respectively, with reference to zero bias, which is in contrast to the metal-polar InGaN well-based LEDs in the literature. Such opposite shifts of μPL peak emission observed for N-polar NWs-LEDs, in our study, are due to the change in the direction of the internal piezoelectric field. The quenching of PL intensity, under the reverse bias conditions, is ascribed to the reduction of electron-hole overlap. Furthermore, the blueshift of μPL emission with increasing excitation power reveals the suppression of QCSE resulting from the photo-generated carriers. Thereby, our study confirms the presence of QCSE for NWs-LEDs from both bias and power dependent μPL measurements. Thus, this study serves to understand the QCSE in N-polar InGaN Q-disk NWs-LEDs and other related wide-bandgap nitride nanowires, in general.
Tangi, Malleswararao
2018-03-09
We study the impact of quantum-confined stark effect (QCSE) on bias dependent micro-photoluminescence emission of the quantum disk (Q-disk) based nanowires light emitting diodes (NWs-LED) exhibiting the amber colored emission. The NWs are found to be nitrogen polar (N-polar) verified using KOH wet chemical etching and valence band spectrum analysis of high-resolution X-ray photoelectron spectroscopy. The crystal structure and quality of the NWs were investigated by high-angle annular dark field - scanning transmission electron microscopy. The LEDs were fabricated to acquire the bias dependent micro-photoluminescence spectra. We observe a redshift and a blueshift of the μPL peak in the forward and reverse bias conditions, respectively, with reference to zero bias, which is in contrast to the metal-polar InGaN well-based LEDs in the literature. Such opposite shifts of μPL peak emission observed for N-polar NWs-LEDs, in our study, are due to the change in the direction of the internal piezoelectric field. The quenching of PL intensity, under the reverse bias conditions, is ascribed to the reduction of electron-hole overlap. Furthermore, the blueshift of μPL emission with increasing excitation power reveals the suppression of QCSE resulting from the photo-generated carriers. Thereby, our study confirms the presence of QCSE for NWs-LEDs from both bias and power dependent μPL measurements. Thus, this study serves to understand the QCSE in N-polar InGaN Q-disk NWs-LEDs and other related wide-bandgap nitride nanowires, in general.
Optimal football strategies: AC Milan versus FC Barcelona
Papahristodoulou, Christos
2012-01-01
In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.
Preliminary design of reactor coolant pump canned motor for AC600
International Nuclear Information System (INIS)
Deng Shaowen
1998-01-01
The reactor coolant pump canned motor of AC600 PWR is the kind of shielded motors with high moment of inertia, high reliability, high efficiency and nice starting performance. The author briefly presents the main feature, design criterion and technical requirements, preliminary design, computation results and analysis of performance of AC600 reactor coolant pump canned motor, and proposes some problems to be solved for study and design of AC600 reactor coolant pump canned motor
Analytical theory and possible detection of the ac quantum spin Hall effect.
Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y
2017-07-11
We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.
The Hubble Legacy Archive ACS grism data
Kümmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.
2011-06-01
A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 μm, with a dispersion of 40 Å/pixel and a resolution of ~80 Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47 919 datasets (65% of the total number of extracted spectra) for 32 149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2 - 4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects
International Nuclear Information System (INIS)
Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.
2004-01-01
Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the
Reducing AC-Winding Losses in High-Current High-Power Inductors
DEFF Research Database (Denmark)
Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.
2009-01-01
Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...
Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2017-11-01
Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.
Strong quantum-confined stark effect in germanium quantum-well structures on silicon
International Nuclear Information System (INIS)
Kuo, Y.; Lee, Y. K.; Gei, Y.; Ren, S; Roth, J. E.; Miller, D. A.; Harris, J. S.
2006-01-01
Silicon is the dominant semiconductor for electronics, but there is now a growing need to integrate such component with optoelectronics for telecommunications and computer interconnections. Silicon-based optical modulators have recently been successfully demonstrated but because the light modulation mechanisms in silicon are relatively weak, long (for example, several millimeters) devices or sophisticated high-quality-factor resonators have been necessary. Thin quantum-well structures made from III-V semiconductors such as GaAs, InP and their alloys exhibit the much stronger Quantum-Confined Stark Effect (QCSE) mechanism, which allows modulator structures with only micrometers of optical path length. Such III-V materials are unfortunately difficult to integrate with silicon electronic devices. Germanium is routinely integrated with silicon in electronics, but previous silicon-germanium structures have also not shown strong modulation effects. Here we report the discovery of the QCSE, at room temperature, in thin germanium quantum-well structures grown on silicon. The QCSE here has strengths comparable to that in III-V materials. Its clarity and strength are particularly surprising because germanium is an indirect gap semiconductor, such semiconductors often display much weak optical effects than direct gap materials (such as the III-V materials typically used for optoelectronics). This discovery is very promising for small, high-speed, low-power optical output devices fully compatible with silicon electronics manufacture. (author)
On-Chip AC self-test controller
Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY
2009-09-29
A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.
Ac-driven vortex-antivortex dynamics in nanostructured superconductor-ferromagnetic hybrids
Energy Technology Data Exchange (ETDEWEB)
Lima, Clessio L.S., E-mail: clsl@df.ufpe.br [Nucleo de Tecnologia, Centro Academico do Agreste, Universidade Federal de Pernambuco, 55002-970 Caruaru-PE (Brazil); Souza Silva, Clecio C. de; Aguiar, J. Albino [Departamento de Fisica, Universidade Federal de Pernambuco, 50670-901 Recife-PE (Brazil)
2012-09-15
The dynamics of ac-driven vortices and antivortices in a superconducting film interacting with an array of magnetic dipoles on top is investigated via hybrid molecular dynamics-Monte Carlo simulations. The dipole array considered in this study is capable to stabilize in equilibrium vortex-antivortex pairs. The appearance of a net electric field out of the ac excitation demonstrates that this system behaves as a voltage rectifier. Because of the asymmetric nature of the effective pinning potential generated by the dipole array, the ac-driven vortices and antivortices are ratcheted in opposite directions, thereby contributing additively to the observed net voltage. In addition, for high frequency values, the dc electric field-ac amplitude curves present a series of steps. A careful analysis of the time series of the electric field and number of vortex-antivortex (v-av) pairs reveals that these steps are related to mode-locking between the drive frequency and the number of v-av creation-annihilation events.
McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante
The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.
International Nuclear Information System (INIS)
Bagus, P S; Pacchioni, G
2008-01-01
We report a detailed analysis of the electronic mechanisms which determine the bond strength and the vibrational frequency of CO molecules adsorbed on neutral or charged gold nanoparticles. To this end we have considered a simple cluster model, Au 5 CO q (q = +1, 0, -1), and decomposed the Au-CO interaction energy into the sum of various contributions according to a Constrained Space Orbital Variation approach. While the adsorption energy is relatively insensitive to the value of q, the C-O stretch frequency, ω e (CO), changes substantially, and allows the use of this molecule as a direct probe of the gold oxidation state. The results show that two major terms contribute to the red or blue shift of ω e (CO) as a function of q: the interaction with the electric field associated to the charged nanoparticle (Stark effect) and the Au → CO Φ back donation. The CO → Au σ donation is about half as important as the Φ back-donation and all other terms are much less important
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.
2008-02-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
International Nuclear Information System (INIS)
Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C
2008-01-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability
AC conductivity for a holographic Weyl semimetal
Energy Technology Data Exchange (ETDEWEB)
Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)
2017-03-23
We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.
Tools for spectral data analysis of arbitrary emitters in edge plasma
International Nuclear Information System (INIS)
Marandet, Y.; Genesio, P.; Godbert-Mouret, L.; Koubiti, M.; Stamm, R.; Felts, B.; Capes, H.; Guirlet, R.; Lotte, P.; Lowry, C.
2003-01-01
A line shape code including Stark, Zeeman and Doppler effects has been upgraded to include atomic fine structure effects and the motional Stark effect (MST). Genetic algorithms provide an efficient and robust tool for automated analysis of edge plasma line shapes. Such an algorithm has been used to fit Doppler-broadened Zeeman D α /H α spectra observed in Tore-Supra. Spectra were analyzed from 2 different machine configurations, corresponding to: 1) recycling from the ergodic divertor (ED), with lines of sight tangential to the magnetic field; 2) recycling at the toroidal pump limiter (TPL) with vertical lines of sight perpendicular to the magnetic field. Preliminary results indicate that the plasma above the TPL contains a larger fraction of warm particles than the ED plasma. (A.C.)
Ghylin, Trevor W; Garcia, Sarahi L; Moya, Francisco; Oyserman, Ben O; Schwientek, Patrick; Forest, Katrina T; Mutschler, James; Dwulit-Smith, Jeffrey; Chan, Leong-Keat; Martinez-Garcia, Manuel; Sczyrba, Alexander; Stepanauskas, Ramunas; Grossart, Hans-Peter; Woyke, Tanja; Warnecke, Falk; Malmstrom, Rex; Bertilsson, Stefan; McMahon, Katherine D
2014-12-01
Members of the acI lineage of Actinobacteria are the most abundant microorganisms in most freshwater lakes; however, our understanding of the keys to their success and their role in carbon and nutrient cycling in freshwater systems has been hampered by the lack of pure cultures and genomes. We obtained draft genome assemblies from 11 single cells representing three acI tribes (acI-A1, acI-A7, acI-B1) from four temperate lakes in the United States and Europe. Comparative analysis of acI SAGs and other available freshwater bacterial genomes showed that acI has more gene content directed toward carbohydrate acquisition as compared to Polynucleobacter and LD12 Alphaproteobacteria, which seem to specialize more on carboxylic acids. The acI genomes contain actinorhodopsin as well as some genes involved in anaplerotic carbon fixation indicating the capacity to supplement their known heterotrophic lifestyle. Genome-level differences between the acI-A and acI-B clades suggest specialization at the clade level for carbon substrate acquisition. Overall, the acI genomes appear to be highly streamlined versions of Actinobacteria that include some genes allowing it to take advantage of sunlight and N-rich organic compounds such as polyamines, di- and oligopeptides, branched-chain amino acids and cyanophycin. This work significantly expands the known metabolic potential of the cosmopolitan freshwater acI lineage and its ecological and genetic traits.
Effect of temperature on the AC impedance of protein and ...
Indian Academy of Sciences (India)
2016-08-26
Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...
Calculation of single phase AC and monopolar DC hybrid corona effects
International Nuclear Information System (INIS)
Zhao, T.; Sebo, S.A.; Kasten, D.G.
1996-01-01
Operating a hybrid HVac and HVdc line is an option for increasing the efficiency of power transmission and overcoming the difficulties in obtaining a new right-of-way. This paper proposes a new calculation method for the study of hybrid line corona. The proposed method can be used to calculate dc corona losses and corona currents in dc or ac conductors for single phase ac and monopolar dc hybrid lines. Profiles of electric field strength and ion current density at ground level can be estimated. The effects of the presence of an energized ac conductor on dc conductor corona and dc voltage on ac conductor corona are included in the method. Full-scale and reduced-scale experiments were utilized to investigate the hybrid line corona effects. Verification of the proposed calculation method is given
Power Controllability of Three-phase Converter with Unbalanced AC Source
DEFF Research Database (Denmark)
Ma, Ke; Chen, Wenjie; Liserre, Marco
2015-01-01
Three-phase DC-AC power converters suffer from power oscillation and overcurrent problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zerosequence components are proposed to enhance the power control ability under this adverse condition. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC voltage....
Stix Award: The ponderomotive effect beyond the ponderomotive force
Dodin, I. Y.
2014-10-01
The classical ponderomotive effect (PE) is typically understood as the nonlinear time-average force produced by a rapidly oscillating electromagnetic field on a nonresonant particle. It is instructive to contrast this understanding with the common quantum interpretation of the PE as the ac Stark shift, i.e., phase modulation, or a Kerr effect experienced by the wave function. Then the PE is naturally extended from particles to waves and can be calculated efficiently in general settings, including for strongly nonlinear interactions and resonant dynamics. In particular, photons (plasmons, etc.) are hence seen to have polarizability and contribute to the linear dielectric tensor exactly like ``true'' particles such as electrons and ions. The talk will briefly review the underlying variational theory and some nonintuitive PE-based techniques of wave and particle manipulation that the theory predicts. It will also be shown that the PE can be understood as the cause for the basic properties of both linear and nonlinear waves in plasma, including their dispersion, energy-momentum transport, and various modulational instabilities. Linear collisionless dissipation (both on particles and classical waves, treated on the same footing) also appears merely as a special case of the modulational dynamics. The work was supported by NNSA grant DE274-FG52-08NA28553, DOE contract DE-AC02-09CH11466, and DTRA grant HDTRA1-11-1-0037.
A direct power conversion topology for grid integrations of hybrid AC/DC resources
DEFF Research Database (Denmark)
Liu, Xiong; Loh, Poh Chiang; Wang, Peng
2012-01-01
and modulation schemes are proposed to extract the commanded current from the input ac/dc sources to the grid and guarantee high quality ac/dc inputs and ac output current waveforms with unity power factors. The proposed modulation scheme for sinusoidal outputs of the VMC is mathematically proved...
Position- and time-resolved Stark broadening diagnostics of a non-thermal laser-induced plasma
International Nuclear Information System (INIS)
Liu, Hao; Truscott, Benjamin S; Ashfold, Michael N R
2016-01-01
We present an analysis of the Stark-broadened line shapes of silicon ions in a laser-induced plasma using a model constructed, without assuming local thermodynamic equilibrium (LTE), using a Druyvesteyn electron energy distribution function (EEDF). The method is applied to temporally and spatially resolved measurements of Si 2+ and Si 3+ emissions from a transient plasma expanding into vacuum, produced by 1064 nm, nanosecond pulsed laser ablation of a Si (1 0 0) target. The best-fitting simulated line shapes and the corresponding electron number densities and temperatures (or equivalently, Druyvesteyn average energies) are compared with those returned assuming LTE (i.e. for a Maxwellian EEDF). Non-thermal behavior is found to dominate at all but the very earliest stages of expansion close to the target surface, consistent with McWhirter’s criterion for the establishment of LTE. The Druyvesteyn EEDF always yields an equivalent or better model of the experimental measurements, and the observed increasingly strong departure from the Maxwellian case with time and distance from the ablation event highlights the essential invalidity of the LTE assumption for moderate-power, nanosecond laser-induced plasma expanding in vacuo. (paper)
Low frequency ac conduction and dielectric relaxation in poly(N ...
Indian Academy of Sciences (India)
The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.
Productos «Celotex» para acondicionamientos Acústicos
Directory of Open Access Journals (Sweden)
Editorial, Equipo
1958-02-01
Full Text Available Not availableBajo la denominación general «Celotex», que es un nombre registrado, la Casa Americana The Celotex Corporation, cuyo domicilio social es 120 South, La Salle Street, Chicago J. lllinois, fabrica diversos materiales para fines de acondicionamiento acústico elaborados, según los tipos de que se trate, con fibra de caña de azúcar, lanas minerales, acero, amianto, etc., perforados o no y de acuerdo con el efecto estético y acústico que se desee obtener.
CTE Corrections for WFPC2 and ACS
Dolphin, Andrew
2003-07-01
The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.
Energy Technology Data Exchange (ETDEWEB)
Foley, E. L.; Levinton, F. M. [Nova Photonics, Inc., Princeton, New Jersey 08540 (United States)
2013-04-15
The motional Stark effect with laser-induced fluorescence diagnostic (MSE-LIF) has been installed and tested on the National Spherical Torus Experiment (NSTX) at the Princeton Plasma Physics Lab. The MSE-LIF diagnostic will be capable of measuring radially resolved profiles of magnetic field magnitude or pitch angle in NSTX plasmas. The system includes a diagnostic neutral hydrogen beam and a laser which excites the n = 2 to n = 3 transition. A viewing system has been implemented which will support up to 38 channels from the plasma edge to past the magnetic axis. First measurements of MSE-LIF signals in the presence of small applied magnetic fields in neutral gas are reported.
Foley, E. L.; Levinton, F. M.
2013-04-01
The motional Stark effect with laser-induced fluorescence diagnostic (MSE-LIF) has been installed and tested on the National Spherical Torus Experiment (NSTX) at the Princeton Plasma Physics Lab. The MSE-LIF diagnostic will be capable of measuring radially resolved profiles of magnetic field magnitude or pitch angle in NSTX plasmas. The system includes a diagnostic neutral hydrogen beam and a laser which excites the n = 2 to n = 3 transition. A viewing system has been implemented which will support up to 38 channels from the plasma edge to past the magnetic axis. First measurements of MSE-LIF signals in the presence of small applied magnetic fields in neutral gas are reported.
Schmidt, F.
1980-11-01
The components of a superconducting 110 kV ac cable for power ratings or = 2000 MVA were developed. The cable design is of the semiflexible type, with a rigid cryogenic envelope containing a flexible hollow coaxial cable core. The cable core consists of spirally wound Nb-A1 composite wires electrically insulated by high pressure polyethylene tape wrappings. A 35 m long single phase test cable with full load terminals rated at 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of this cable design.
International Nuclear Information System (INIS)
Schmidt, F.
1980-01-01
The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de
Diode-rectified multiphase AC arc for the improvement of electrode erosion characteristics
Tanaka, Manabu; Hashizume, Taro; Saga, Koki; Matsuura, Tsugio; Watanabe, Takayuki
2017-11-01
An innovative multiphase AC arc (MPA) system was developed on the basis of a diode-rectification technique to improve electrode erosion characteristics. Conventionally, electrode erosion in AC arc is severer than that in DC arc. This originated from the fact that the required properties for the cathode and anode are different, although an AC electrode works as the cathode and the anode periodically. To solve this problem, a separation of AC electrodes into pairs of thoriated tungsten cathode and copper anode by diode-rectification was attempted. A diode-rectified multiphase AC arc (DRMPA) system was then successfully established, resulting in a drastic improvement of the erosion characteristics. The electrode erosion rate in the DRMPA was less than one-third of that in the conventional MPA without the diode rectification. In order to clarify its erosion mechanism, electrode phenomena during discharge were visualized by a high-speed camera system with appropriate band-pass filters. Fluctuation characteristics of the electrode temperature in the DRMPA were revealed.
Complex study of transport AC loss in various 2G HTS racetrack coils
Energy Technology Data Exchange (ETDEWEB)
Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)
2013-04-15
Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.
a.c. conductance study of polycrystal C{sub 60}
Energy Technology Data Exchange (ETDEWEB)
Yan Feng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Wang Yening [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Huang Yineng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Gu Min [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Zhang Qingming [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Shen Huimin [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure
1995-06-05
The a.c. (1
Faradaic AC Electrokinetic Flow and Particle Traps
Ben, Yuxing; Chang, Hsueh-Chia
2004-11-01
Faradaic reaction at higher voltages can produce co-ion polarization at AC electrodes instead of counter-ion polarization due to capacitive charging from the bulk. The Faradaic co-ion polarization also does not screen the external field and hence can produce large net electro-kinetic flows at frequencies lower than the inverse RC time of the double layer. Due to the opposite polarization of capacitve and Faradaic charging, we can reverse the direction of AC flows on electrodes by changing the voltage and frequency. Particles and bacteria are trapped and then dispersed at stagnation lines, at locations predicted by our theory, by using these two flows sequentially. This technique offers a good way to concentrate and detect bacteria.
AC application of second generation HTS wire
Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.
2008-02-01
For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.
AC Losses and Their Thermal Effect in High Temperature Superconducting Machines
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan
2015-01-01
In transient operations or fault conditions, high temperature superconducting (HTS) machines suffer AC losses which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate AC losses and their thermal effect in HTS machines is presented....... The method consists of three sub-models that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an AC loss model which has...
AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan
2016-01-01
In transient operations or fault conditions, hightemperature superconducting (HTS) machines suffer ac losses, which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate ac losses and their thermal effect in HTS machines is presented....... The method consists of three submodels that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an ac loss model that has a homogeneous...
ELECTRONIC SYSTEM FOR EXPERIMENTATION IN AC ELECTROGRAVIMETRY I: TECHNIQUE FUNDAMENTALS
Directory of Open Access Journals (Sweden)
Róbinson Torres
Full Text Available Basic fundamentals of AC electrogravimetry are introduced. Their main requirements and characteristics are detailed to establish the design of an electronic system that allows the appropriate extraction of data needed to determine the electrogravimetric transfer function (EGTF and electrochemical impedance (EI, in an experimental set-up for the AC electrogravimetry technique.
AC Conductivity Studies of Lithium Based Phospho Vanadate Glasses
International Nuclear Information System (INIS)
Nagendra, K.; Babu, G. Satish; Gowda, Veeranna; Reddy, C. Narayana
2011-01-01
Glasses in the system xLi 2 SO 4 -20Li 2 O-(80-x) [80P 2 O 5 -20V 2 O 5 ](5≥x≥20 mol%) has been prepared by melt quenching method. Dc and ac conductivity has been studied over a wide range of frequency (10 Hz to 10 MHz) and temperature (298 K-523 K). The dc conductivity found to increase with increase of Li 2 SO 4 concentration. The ac conductivities have been fitted to the Almond-West type single power law equation σ(ω) = σ(0)+Aω s where 's' is the power law exponent. The ac conductivity found to increase with increase of Li 2 SO 4 concentration. An attempt is made to elucidate the enhancement of lithium ion conduction in phosphor-vanadate glasses by considering the expansion of network structure.
Non-Federal participation in AC Intertie: Final environmental impact statement
International Nuclear Information System (INIS)
1994-01-01
Bonneville Power Administration (BPA) is considering action in two areas: (1) non-Federal access to the AC Intertie, and, (2) BPA Intertie marketing. BPA's preferred alternative for non-Federal access is the Capacity Ownership alternative combined with the Increased Assured Delivery -- Access for Non-Scheduling Utilities alternative; the preferred alternative for BPA Intertie marketing is the Federal Marketing and Joint Ventures alternative. BPA considered these two areas previously in its Intertie Development and Use EIS of April 1988. The EIS resulted in BPA decisions to participate in the construction of the Third AC Intertie, to allow non-Federal access to BPA's share of the Pacific Northwest-Pacific Southwest (PNW-PSW) Intertie (AC and DC lines) pursuant to a Long-Term Intertie Access Policy (LTIAP), and to pursue BPA's export marketing alternative. The decision on allowing direct financial non-Federal participation in the Third AC line was deferred to a later, separate process, examined here. Also, BPA's export marketing objectives must now be examined in view of changed operations of Columbia River hydro facilities for improved fish survival
AC-loss considerations of a pulse SMES for an accelerator
International Nuclear Information System (INIS)
Lyly, M; Hiltunen, I; Jaervelae, J; Korpela, A; Lehti, L; Stenvall, A; Mikkonen, R
2010-01-01
In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.
Energy Technology Data Exchange (ETDEWEB)
Perez, C; De la Rosa, M I; Gruetzmacher, K, E-mail: concha@opt.uva.e [Universidad de Valladolid, Facultad de Ciencias, 47071 Valladolid (Spain)
2010-05-01
Doppler-free two-photon optogalvanic spectroscopy has been applied to measure the strong electric field strength and the cathode fall characteristics of hollow cathode discharges operated in hydrogen and deuterium via the Stark splitting of the 2S level of atomic hydrogen isotopes. In this paper we show similarities and differences in the tendencies of the cathode fall characteristics of hydrogen and deuterium in a wide range of identical discharge parameters.
International Nuclear Information System (INIS)
Perez, C; De la Rosa, M I; Gruetzmacher, K
2010-01-01
Doppler-free two-photon optogalvanic spectroscopy has been applied to measure the strong electric field strength and the cathode fall characteristics of hollow cathode discharges operated in hydrogen and deuterium via the Stark splitting of the 2S level of atomic hydrogen isotopes. In this paper we show similarities and differences in the tendencies of the cathode fall characteristics of hydrogen and deuterium in a wide range of identical discharge parameters.
International Nuclear Information System (INIS)
Holcomb, C; Makowski, M; Allen, S; Meyer, W; Van Zeeland, M
2008-01-01
Motional Stark effect (MSE) measurements constrain equilibrium reconstruction of DIII-D tokamak plasmas using the equilibrium code EFIT. In 2007, two new MSE arrays were brought online, bringing the system to three core arrays, two edge arrays, and 64 total channels. We present the first EFIT reconstructions using this expanded system. Safety factor and E R profiles produced by fitting to data from the two new arrays and one of the other three agree well with independent measurements. Comparison of the data from the three arrays that view the core shows that one of the older arrays is inconsistent with the other two unless the measured calibration factors for this array are adjusted. The required adjustments depend on toroidal field and plasma current direction, and on still other uncertain factors that change as the plasma evolves. We discuss possible sources of calibration error for this array
A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation
Directory of Open Access Journals (Sweden)
Cuidong Xu
2015-09-01
Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.
Lamin A/C mutations with lipodystrophy, cardiac abnormalities, and muscular dystrophy
van der Kooi, A. J.; Bonne, G.; Eymard, B.; Duboc, D.; Talim, B.; van der Valk, M.; Reiss, P.; Richard, P.; Demay, L.; Merlini, L.; Schwartz, K.; Busch, H. F. M.; de Visser, M.
2002-01-01
Mutations in the lamin A/C gene are found in Emery-Dreifuss muscular dystrophy, limb girdle muscular dystrophy with cardiac conduction disturbances, dilated cardiomyopathy with conduction system disease, and familial partial lipodystrophy. Cases with lamin A/C mutations presenting with lipodystrophy
Power Controllability of Three-phase Converter with Unbalanced AC Source
DEFF Research Database (Denmark)
Ma, Ke; Liserre, Marco; Blaabjerg, Frede
2013-01-01
Three-phase DC-AC power converters suffer from power oscillation and overcurrentt problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zero-sequence components are proposed to enhance the power control ability under this adverse conditions. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC sources....
AC Application of HTS Conductors in Highly Dynamic Electric Motors
International Nuclear Information System (INIS)
Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K
2006-01-01
Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit
Sobota, A.; Kanters, J.H.M.; Manders, F.; Veldhuizen, van E.M.; Haverlag, M.
2010-01-01
Our aim was to examine the starting behaviour of mid-pressure argon discharges in pin-pin (point-to-point) geometry, typically used in HID lamps. We focused our work on AC ignition of 300 and 700 mbar Ar discharges in Philips 70W standard burners. Frequency was varied between 200 kHz and 1 MHz. In
AC-Induced Bias Potential Effect on Corrosion of Steels
2009-02-05
induction, variable conduction Experimental Setup Super- martensitic stainless steel composition Analysis: C Mn Si Cr Ni Mo Cu N Typical 13 Cr ɘ.01 0.6... stainless steel used in pipelines. •Low carbon (ɘ.01): allows the formation of a “soft” martensite that is more resistant than standard martensitic ...Proposed AC Corrosion Models AC Simulated Corrosion testing Stainless steel pipe and coating Cathodic protection Experimental Setup Preliminary
AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications
Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.
2017-12-01
This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.
The effect of ac magnetic fields on the lifting power of levitating superconductors
International Nuclear Information System (INIS)
Smolyak, B M; Ermakov, G V; Chubraeva, L I
2007-01-01
This study deals with the decrease in the levitation force under the action of an ac field up to the frequency at which oscillations of the superconducting suspension are limited by inertia. The lifting force was measured as a function of the ac field amplitude and the exposure time. It was shown that the force quickly decreased at the moment the ac field was applied and then continued diminishing, but at a lower rate. A qualitative model was proposed, taking into account two effects of the ac field on the magnetization of the levitating superconductor: a complete destruction of the critical state in some section of the superconductor (to a depth λ ac ) and the initiation of a faster magnetic relaxation in the region where the induction gradient is preserved
AC Electric Field Communication for Human-Area Networking
Kado, Yuichi; Shinagawa, Mitsuru
We have proposed a human-area networking technology that uses the surface of the human body as a data transmission path and uses an AC electric field signal below the resonant frequency of the human body. This technology aims to achieve a “touch and connect” intuitive form of communication by using the electric field signal that propagates along the surface of the human body, while suppressing both the electric field radiating from the human body and mutual interference. To suppress the radiation field, the frequency of the AC signal that excites the transmitter electrode must be lowered, and the sensitivity of the receiver must be raised while reducing transmission power to its minimally required level. We describe how we are developing AC electric field communication technologies to promote the further evolution of a human-area network in support of ubiquitous services, focusing on three main characteristics, enabling-transceiver technique, application-scenario modeling, and communications quality evaluation. Special attention is paid to the relationship between electro-magnetic compatibility evaluation and regulations for extremely low-power radio stations based on Japan's Radio Law.
AC Conductivity and Dielectric Properties of Borotellurite Glass
Taha, T. A.; Azab, A. A.
2016-10-01
Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.
Directory of Open Access Journals (Sweden)
Yuanwei Zhu
2018-06-01
Full Text Available Based on the existing acknowledgment that space charge modulates AC and DC breakdown of insulating materials, this investigation promotes the related investigation into the situations of more complex electrical stress, i.e., AC-DC combined voltages. Experimentally, the AC-DC breakdown characteristics of oil impregnated paper insulation were systematically investigated. The effects of pre-applied voltage waveform, AC component ratio, and sample thickness on AC-DC breakdown characteristics were analyzed. After that, based on an improved bipolar charge transport model, the space charge profiles and the space charge induced electric field distortion during AC-DC breakdown were numerically simulated to explain the differences in breakdown characteristics between the pre-applied AC and pre-applied DC methods under AC-DC combined voltages. It is concluded that large amounts of homo-charges are accumulated during AC-DC breakdown, which results in significantly distorted inner electric field, leading to variations of breakdown characteristics of oil impregnated paper insulation. Therefore, space charges under AC-DC combined voltages must be considered in the design of converter transformers. In addition, this investigation could provide supporting breakdown data for insulation design of converter transformers and could promote better understanding on the breakdown mechanism of insulating materials subjected to AC-DC combined voltages.
Induced AC voltages on pipelines may present a serious hazard
International Nuclear Information System (INIS)
Kirkpatrick, E.L.
1997-01-01
The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP
System and Battery Charge Control for PV-Powered AC Lighting Systems
Energy Technology Data Exchange (ETDEWEB)
Kern, G.
1999-04-01
This report reviews a number of issues specific to stand-alone AC lighting systems. A review of AC lighting technology is presented, which discusses the advantages and disadvantages of various lamps. The best lamps for small lighting systems are compact fluorescent. The best lamps for intermediate-size systems are high- or low-pressure sodium. Specifications for battery charging and load control are provided with the goal of achieving lamp lifetimes on the order of 16,000 to 24,000 hours and battery lifetimes of 4 to 5 years. A rough estimate of the potential domestic and global markets for stand-alone AC lighting systems is presented. DC current injection tests were performed on high-pressure sodium lamps and the test results are presented. Finally, a prototype system was designed and a prototype system controller (with battery charger and DC/AC inverter) was developed and built.
Photovoltaic system with improved AC connections and method of making same
Energy Technology Data Exchange (ETDEWEB)
Cioffi, Philip Michael; Todorovic, Maja Harfman; Herzog, Michael Scott; Korman, Charles Steven; Doherty, Donald M.; Johnson, Neil Anthony
2018-02-13
An alternating current (AC) harness for a photovoltaic (PV) system includes a wire assembly having a first end and a second end, the wire assembly having a plurality of lead wires, and at least one AC connection module positioned at a location along a length of the wire assembly between the first end and the second end. Further, the at least one AC connection module includes a first connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a first PV module of the PV system. The at least one AC connection module also includes a second connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a second PV module of the PV system.
A decomposition method for network-constrained unit commitment with AC power flow constraints
International Nuclear Information System (INIS)
Bai, Yang; Zhong, Haiwang; Xia, Qing; Kang, Chongqing; Xie, Le
2015-01-01
To meet the increasingly high requirement of smart grid operations, considering AC power flow constraints in the NCUC (network-constrained unit commitment) is of great significance in terms of both security and economy. This paper proposes a decomposition method to solve NCUC with AC power flow constraints. With conic approximations of the AC power flow equations, the master problem is formulated as a MISOCP (mixed integer second-order cone programming) model. The key advantage of this model is that the active power and reactive power are co-optimised, and the transmission losses are considered. With the AC optimal power flow model, the AC feasibility of the UC result of the master problem is checked in subproblems. If infeasibility is detected, feedback constraints are generated based on the sensitivity of bus voltages to a change in the unit reactive power generation. They are then introduced into the master problem in the next iteration until all AC violations are eliminated. A 6-bus system, a modified IEEE 30-bus system and the IEEE 118-bus system are used to validate the performance of the proposed method, which provides a satisfactory solution with approximately 44-fold greater computational efficiency. - Highlights: • A decomposition method is proposed to solve the NCUC with AC power flow constraints • The master problem considers active power, reactive power and transmission losses. • OPF-based subproblems check the AC feasibility using parallel computing techniques. • An effective feedback constraint interacts between the master problem and subproblem. • Computational efficiency is significantly improved with satisfactory accuracy