WorldWideScience

Sample records for ac propulsion project

  1. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  2. Thrust distribution for attitude control in a variable thrust propulsion system with four ACS nozzles

    Science.gov (United States)

    Lim, Yeerang; Lee, Wonsuk; Bang, Hyochoong; Lee, Hosung

    2017-04-01

    A thrust distribution approach is proposed in this paper for a variable thrust solid propulsion system with an attitude control system (ACS) that uses a reduced number of nozzles for a three-axis attitude maneuver. Although a conventional variable thrust solid propulsion system needs six ACS nozzles, this paper proposes a thrust system with four ACS nozzles to reduce the complexity and mass of the system. The performance of the new system was analyzed with numerical simulations, and the results show that the performance of the system with four ACS nozzles was similar to the original system while the mass of the whole system was simultaneously reduced. Moreover, a feasibility analysis was performed to determine whether a thrust system with three ACS nozzles is possible.

  3. Janus particle microshuttle: 1D directional self-propulsion modulated by AC electrical field

    Directory of Open Access Journals (Sweden)

    Jiliang Chen

    2014-03-01

    Full Text Available A catalytic Janus particle is capable of gaining energy from the surrounding fuel solution to drive itself to move continuously, which has an important impact in different fields, especially the field of micro-systems. However, the randomness of self-propulsion at the microscale restricts its use in practice. Achieving a directed self-propelled movement would greatly promote the application of the Janus particle. We proved experimentally that an AC electric field was an effective way to suppress Brownian motion and control the direction of self-propelled movement. The self-propulsion and dielectrophoretic response of a 2μm Janus particle were observed and the related basic data were collected. Interdigital electrodes, 20 μm in width, were energized in pulsed style to modulate the self-propulsion, which resulted in a shuttle-style motion in which a single Janus particle moved to and fro inside the strip electrode. The change of direction depends on its unique position: the catalyst side is always pointed outward and the orientation angle relative to the electrode is about 60°. Numerical simulation also proved that this position is reasonable. The present study could be beneficial with regard to self-propulsion and AC electrokinetics of the Janus particle.

  4. Breakthrough Propulsion Physics Project: Project Management Methods

    Science.gov (United States)

    Millis, Marc G.

    2004-01-01

    To leap past the limitations of existing propulsion, the NASA Breakthrough Propulsion Physics (BPP) Project seeks further advancements in physics from which new propulsion methods can eventually be derived. Three visionary breakthroughs are sought: (1) propulsion that requires no propellant, (2) propulsion that circumvents existing speed limits, and (3) breakthrough methods of energy production to power such devices. Because these propulsion goals are presumably far from fruition, a special emphasis is to identify credible research that will make measurable progress toward these goals in the near-term. The management techniques to address this challenge are presented, with a special emphasis on the process used to review, prioritize, and select research tasks. This selection process includes these key features: (a) research tasks are constrained to only address the immediate unknowns, curious effects or critical issues, (b) reliability of assertions is more important than the implications of the assertions, which includes the practice where the reviewers judge credibility rather than feasibility, and (c) total scores are obtained by multiplying the criteria scores rather than by adding. Lessons learned and revisions planned are discussed.

  5. NASA's Nuclear Thermal Propulsion Project

    Science.gov (United States)

    Houts, Michael G.; Mitchell, Doyce P.; Kim, Tony; Emrich, William J.; Hickman, Robert R.; Gerrish, Harold P.; Doughty, Glen; Belvin, Anthony; Clement, Steven; Borowski, Stanley K.; hide

    2015-01-01

    The fundamental capability of Nuclear Thermal Propulsion (NTP) is game changing for space exploration. A first generation NTP system could provide high thrust at a specific impulse above 900 s, roughly double that of state of the art chemical engines. Characteristics of fission and NTP indicate that useful first generation systems will provide a foundation for future systems with extremely high performance. The role of a first generation NTP in the development of advanced nuclear propulsion systems could be analogous to the role of the DC- 3 in the development of advanced aviation. Progress made under the NTP project could also help enable high performance fission power systems and Nuclear Electric Propulsion (NEP).

  6. Nuclear electric propulsion: An integral part of NASA's nuclear propulsion project

    International Nuclear Information System (INIS)

    Stone, J.R.

    1992-01-01

    NASA has initiated a technology program to establish the readiness of nuclear propulsion technology for the Space Exploration Initiative (SEI). This program was initiated with a very modest effort identified with nuclear thermal propulsion (NTP); however, nuclear electric propulsion (NEP) is also an integral part of this program and builds upon NASA's Base Research and Technology Program in power and electric propulsion as well as the SP-100 space nuclear power program. Although the Synthesis Group On America's SEI has identified NEP only as an option for cargo missions, recent studies conducted by NASA-Lewis show that NEP offers the potential for early manned Mars missions as well. Lower power NEP is also of current interest for outer planetary robotic missions. Current plans are reviewed for the overall nuclear propulsion project, with emphasis on NEP and those elements of NTP program which have synergism with NEP

  7. Status and Mission Applicability of NASA's In-Space Propulsion Technology Project

    Science.gov (United States)

    Anderson, David J.; Munk, Michelle M.; Dankanich, John; Pencil, Eric; Liou, Larry

    2009-01-01

    The In-Space Propulsion Technology (ISPT) project develops propulsion technologies that will enable or enhance NASA robotic science missions. Since 2001, the ISPT project developed and delivered products to assist technology infusion and quantify mission applicability and benefits through mission analysis and tools. These in-space propulsion technologies are applicable, and potentially enabling for flagship destinations currently under evaluation, as well as having broad applicability to future Discovery and New Frontiers mission solicitations. This paper provides status of the technology development, near-term mission benefits, applicability, and availability of in-space propulsion technologies in the areas of advanced chemical thrusters, electric propulsion, aerocapture, and systems analysis tools. The current chemical propulsion investment is on the high-temperature Advanced Material Bipropellant Rocket (AMBR) engine providing higher performance for lower cost. Investments in electric propulsion technologies focused on completing NASA's Evolutionary Xenon Thruster (NEXT) ion propulsion system, a 0.6-7 kW throttle-able gridded ion system, and the High Voltage Hall Accelerator (HiVHAC) thruster, which is a mid-term product specifically designed for a low-cost electric propulsion option. Aerocapture investments developed a family of thermal protections system materials and structures; guidance, navigation, and control models of blunt-body rigid aeroshells; atmospheric models for Earth, Titan, Mars and Venus; and models for aerothermal effects. In 2009 ISPT started the development of propulsion technologies that would enable future sample return missions. The paper describes the ISPT project's future focus on propulsion for sample return missions. The future technology development areas for ISPT is: Planetary Ascent Vehicles (PAV), with a Mars Ascent Vehicle (MAV) being the initial development focus; multi-mission technologies for Earth Entry Vehicles (MMEEV) needed

  8. The NASA In-Space Propulsion Technology Project, Products, and Mission Applicability

    Science.gov (United States)

    Anderson, David J.; Pencil, Eric; Liou, Larry; Dankanich, John; Munk, Michelle M.; Kremic, Tibor

    2009-01-01

    The In-Space Propulsion Technology (ISPT) Project, funded by NASA s Science Mission Directorate (SMD), is continuing to invest in propulsion technologies that will enable or enhance NASA robotic science missions. This overview provides development status, near-term mission benefits, applicability, and availability of in-space propulsion technologies in the areas of aerocapture, electric propulsion, advanced chemical thrusters, and systems analysis tools. Aerocapture investments improved: guidance, navigation, and control models of blunt-body rigid aeroshells; atmospheric models for Earth, Titan, Mars, and Venus; and models for aerothermal effects. Investments in electric propulsion technologies focused on completing NASA s Evolutionary Xenon Thruster (NEXT) ion propulsion system, a 0.6 to 7 kW throttle-able gridded ion system. The project is also concluding its High Voltage Hall Accelerator (HiVHAC) mid-term product specifically designed for a low-cost electric propulsion option. The primary chemical propulsion investment is on the high-temperature Advanced Material Bipropellant Rocket (AMBR) engine providing higher performance for lower cost. The project is also delivering products to assist technology infusion and quantify mission applicability and benefits through mission analysis and tools. In-space propulsion technologies are applicable, and potentially enabling for flagship destinations currently under evaluation, as well as having broad applicability to future Discovery and New Frontiers mission solicitations.

  9. Static Measurements on HTS Coils of Fully Superconducting AC Electric Machines for Aircraft Electric Propulsion System

    Science.gov (United States)

    Choi, Benjamin B.; Hunker, Keith R.; Hartwig, Jason; Brown, Gerald V.

    2017-01-01

    The NASA Glenn Research Center (GRC) has been developing the high efficiency and high-power density superconducting (SC) electric machines in full support of electrified aircraft propulsion (EAP) systems for a future electric aircraft. A SC coil test rig has been designed and built to perform static and AC measurements on BSCCO, (RE)BCO, and YBCO high temperature superconducting (HTS) wire and coils at liquid nitrogen (LN2) temperature. In this paper, DC measurements on five SC coil configurations of various geometry in zero external magnetic field are measured to develop good measurement technique and to determine the critical current (Ic) and the sharpness (n value) of the super-to-normal transition. Also, standard procedures for coil design, fabrication, coil mounting, micro-volt measurement, cryogenic testing, current control, and data acquisition technique were established. Experimentally measured critical currents are compared with theoretical predicted values based on an electric-field criterion (Ec). Data here are essential to quantify the SC electric machine operation limits where the SC begins to exhibit non-zero resistance. All test data will be utilized to assess the feasibility of using HTS coils for the fully superconducting AC electric machine development for an aircraft electric propulsion system.

  10. NASA's nuclear electric propulsion technology project

    International Nuclear Information System (INIS)

    Stone, J.R.; Sovey, J.S.

    1992-07-01

    The National Aeronautics and Space Administration (NASA) has initiated a program to establish the readiness of nuclear electric propulsion (NEP) technology for relatively near-term applications to outer planet robotic science missions with potential future evolution to system for piloted Mars vehicles. This program was initiated in 1991 with a very modest effort identified with nuclear thermal propulsion (NTP); however, NEP is also an integral part of this program and builds upon NASA's Base Research and Technology Program in power and electric propulsion as well as the SP-100 space nuclear power program. The NEP Program will establish the feasibility and practicality of electric propulsion for robotic and piloted solar system exploration. The performance objectives are high specific impulse (200 greater than I(sub sp) greater than 10000 s), high efficiency (over 0.50), and low specific mass. The planning for this program was initially focussed on piloted Mars missions, but has since been redirected to first focus on 100-kW class systems for relatively near-term robotic missions, with possible future evolution to megawatt-and multi-megawatt-class systems applicable to cargo vehicles supporting human missions as well as to the piloted vehicles. This paper reviews current plans and recent progress for the overall nuclear electric propulsion project and closely related activities. 33 refs

  11. Nuclear propulsion technology development - A joint NASA/Department of Energy project

    Science.gov (United States)

    Clark, John S.

    1992-01-01

    NASA-Lewis has undertaken the conceptual development of spacecraft nuclear propulsion systems with DOE support, in order to establish the bases for Space Exploration Initiative lunar and Mars missions. This conceptual evolution project encompasses nuclear thermal propulsion (NTP) and nuclear electric propulsion (NEP) systems. A technology base exists for NTP in the NERVA program files; more fundamental development efforts are entailed in the case of NEP, but this option is noted to offer greater advantages in the long term.

  12. Propulsion Noise Reduction Research in the NASA Advanced Air Transport Technology Project

    Science.gov (United States)

    Van Zante, Dale; Nark, Douglas; Fernandez, Hamilton

    2017-01-01

    The Aircraft Noise Reduction (ANR) sub-project is focused on the generation, development, and testing of component noise reduction technologies progressing toward the NASA far term noise goals while providing associated near and mid-term benefits. The ANR sub-project has efforts in airframe noise reduction, propulsion (including fan and core) noise reduction, acoustic liner technology, and propulsion airframe aeroacoustics for candidate conventional and unconventional aircraft configurations. The current suite of propulsion specific noise research areas is reviewed along with emerging facility and measurement capabilities. In the longer term, the changes in engine and aircraft configuration will influence the suite of technologies necessary to reduce noise in next generation systems.

  13. MSFC Propulsion Systems Department Knowledge Management Project

    Science.gov (United States)

    Caraccioli, Paul A.

    2007-01-01

    This slide presentation reviews the Knowledge Management (KM) project of the Propulsion Systems Department at Marshall Space Flight Center. KM is needed to support knowledge capture, preservation and to support an information sharing culture. The presentation includes the strategic plan for the KM initiative, the system requirements, the technology description, the User Interface and custom features, and a search demonstration.

  14. Accounting Early for Life Long Learning: The AcE Project.

    Science.gov (United States)

    University Coll. Worcester (England). Centre for Research in Early Childhood Education.

    Building upon the work of the Effective Early Learning (EEL) Project in raising the quality of early learning for young children in the United Kingdom, the 3-year Accounting Early for Life Long Learning Project (AcE Project) focuses on enhancing in 3- to 6-year-olds those attitudes and dispositions that are important to life-long learning. This…

  15. SNL software manual for the ACS Data Analytics Project.

    Energy Technology Data Exchange (ETDEWEB)

    Stearley, Jon R.; McLendon, William Clarence, III; Rodrigues, Arun F.; Williams, Aaron S.; Hooper, Russell Warren; Robinson, David Gerald; Stickland, Michael G.

    2011-10-01

    In the ACS Data Analytics Project (also known as 'YumYum'), a supercomputer is modeled as a graph of components and dependencies, jobs and faults are simulated, and component fault rates are estimated using the graph structure and job pass/fail outcomes. This report documents the successful completion of all SNL deliverables and tasks, describes the software written by SNL for the project, and presents the data it generates. Readers should understand what the software tools are, how they fit together, and how to use them to reproduce the presented data and additional experiments as desired. The SNL YumYum tools provide the novel simulation and inference capabilities desired by ACS. SNL also developed and implemented a new algorithm, which provides faster estimates, at finer component granularity, on arbitrary directed acyclic graphs.

  16. In-Space Propulsion (346620) Technology Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Technologies include, but are not limited to, electric and advanced chemical propulsion, propellantless propulsion such as aerocapture and solar sails, sample return...

  17. An Overview of the NASA FAP Hypersonics Project Airbreathing Propulsion Research

    Science.gov (United States)

    Auslender, A. H.; Suder, Kenneth L.; Thomas, Scott R.

    2009-01-01

    The propulsion research portfolio of the National Aeronautics and Space Administration Fundamental Aeronautics Program Hypersonics Project encompasses a significant number of technical tasks that are aligned to achieve mastery and intellectual stewardship of the core competencies in the hypersonic-flight regime. An overall coordinated programmatic and technical effort has been structured to advance the state-of-the-art, via both experimental and analytical efforts. A subset of the entire hypersonics propulsion research portfolio is presented in this overview paper. To this end, two programmatic research disciplines are discussed; namely, (1) the Propulsion Discipline, including three associated research elements: the X-51A partnership, the HIFiRE-2 partnership, and the Durable Combustor Rig, and (2) the Turbine-Based Combine Cycle Discipline, including three associated research elements: the Combined Cycle Engine Large Scale Inlet Mode Transition Experiment, the small-scale Inlet Mode Transition Experiment, and the High-Mach Fan Rig.

  18. Overview of the NASA Environmentally Responsible Aviation Project's Propulsion Technology Portfolio

    Science.gov (United States)

    Suder, Kenneth L.

    2012-01-01

    The NASA Environmentally Responsible Aviation (ERA) Project is focused on developing and demonstrating integrated systems technologies to TRL 4-6 by 2020 that enable reduced fuel burn, emissions, and noise for futuristic air vehicles. The specific goals aim to simultaneously reduce fuel burn by 50%, reduce Landing and Take-off Nitrous Oxides emissions by 75% relative to the CAEP 6 guidelines, and reduce cumulative noise by 42 Decibels relative to the Stage 4 guidelines. These goals apply to the integrated vehicle and propulsion system and are based on a reference mission of 3000nm flight of a Boeing 777-200 with GE90 engines. This paper will focus primarily on the ERA propulsion technology portfolio, which consists of advanced combustion, propulsor, and core technologies to enable these integrated air vehicle systems goals. An overview of the ERA propulsion technologies will be described and the status and results to date will be presented.

  19. Recent Advances in Airframe-Propulsion Concepts with Distributed Propulsion

    OpenAIRE

    Isikveren , A.T.; Seitz , A.; Bijewitz , J.; Hornung , M.; Mirzoyan , A.; Isyanov , A.; Godard , J.L.; Stückl , S.; Van Toor , J.

    2014-01-01

    International audience; This paper discusses design and integration associated with distributed propulsion as a means of providing motive power for future aircraft concepts. The technical work reflects activities performed within a European Commission funded Framework 7 project entitled Distributed Propulsion and Ultra-high By-Pass Rotor Study at Aircraft Level, or, DisPURSAL. In this instance, the approach of distributed propulsion includes one unique solution that integrates the fuselage wi...

  20. Enabling Electric Propulsion for Flight

    Science.gov (United States)

    Ginn, Starr Renee

    2015-01-01

    Team Seedling project AFRC and LaRC 31ft distributed electric propulsion wing on truck bed up 75 miles per hour for coefficient of lift validation. Convergent Aeronautic Solutions project, sub-project Convergent Electric Propulsion Technologies AFRC, LaRC and GRC, re-winging a 4 passenger Tecnam aircraft with a 31ft distributed electric propulsion wing. Advanced Air Transport Technologies (Fixed Wing), Hybrid Electric Research Theme, developing a series hybrid ironbird and flight sim to study integration and performance challenges in preparation for a 1-2 MW flight project.

  1. NASA Fixed Wing Project Propulsion Research and Technology Development Activities to Reduce Thrust Specific Energy Consumption

    Science.gov (United States)

    Hathaway, Michael D.; DelRasario, Ruben; Madavan, Nateri K.

    2013-01-01

    This paper presents an overview of the propulsion research and technology portfolio of NASA Fundamental Aeronautics Program Fixed Wing Project. The research is aimed at significantly reducing the thrust specific fuel/energy consumption of notional advanced fixed wing aircraft (by 60 % relative to a baseline Boeing 737-800 aircraft with CFM56-7B engines) in the 2030-2035 time frame. The research investments described herein are aimed at improving propulsive efficiency through higher bypass ratio fans, improving thermal efficiency through compact high overall pressure ratio gas generators, and exploring the potential benefits of boundary layer ingestion propulsion and hybrid gas-electric propulsion concepts.

  2. Propulsion of magnetically levitated trains

    Energy Technology Data Exchange (ETDEWEB)

    Wipf, S L

    1976-05-01

    A propulsion system for magnetically levitated trains is proposed. A method of periodically energizing magnetic loops on a train moving over a periodically undulating track allows the net repulsive magnetic force to tilt forward or backward for either propulsion or braking. The principle is explained and a specific example discussed. Approximate calculations show feasibility. Problems requiring technical solutions which cannot be considered present state-of-the-art are AC losses at frequencies up to 20 Hz and mechanical fatigue properties at low temperatures. Suitable primary power could be derived from hydrogen-fueled turbines yet to be developed.

  3. Distributed propulsion and future aerospace technologies

    OpenAIRE

    Ameyugo, Gregorio

    2007-01-01

    This thesis describes an Engineering Doctorate project in Distributed Propulsion carried out from 2004 to 2007 at Cranfield University. Distributed propulsion is a propulsion system arrangement that consists in spreading the engine thrust along the aircraft span. This can be accomplished by distributing a series of driven fans or the engines themselves. The aim of this project is to determine the feasibility of ...

  4. Progress on advanced dc and ac induction drives for electric vehicles

    Science.gov (United States)

    Schwartz, H. J.

    1982-01-01

    Progress is reported in the development of complete electric vehicle propulsion systems, and the results of tests on the Road Load Simulator of two such systems representative of advanced dc and ac drive technology are presented. One is the system used in the DOE's ETV-1 integrated test vehicle which consists of a shunt wound dc traction motor under microprocessor control using a transistorized controller. The motor drives the vehicle through a fixed ratio transmission. The second system uses an ac induction motor controlled by transistorized pulse width modulated inverter which drives through a two speed automatically shifted transmission. The inverter and transmission both operate under the control of a microprocessor. The characteristics of these systems are also compared with the propulsion system technology available in vehicles being manufactured at the inception of the DOE program and with an advanced, highly integrated propulsion system upon which technology development was recently initiated.

  5. Miniaturized Power Processing Unit Study: A Cubesat Electric Propulsion Technology Enabler Project

    Science.gov (United States)

    Ghassemieh, Shakib M.

    2014-01-01

    This study evaluates High Voltage Power Processing Unit (PPU) technology and driving requirements necessary to enable the Microfluidic Electric Propulsion technology research and development by NASA and university partners. This study provides an overview of the state of the art PPU technology with recommendations for technology demonstration projects and missions for NASA to pursue.

  6. CubeSat High Impulse Propulsion System (CHIPS), Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — CU Aerospace proposes the ground test validation of a nanosat primary propulsion subsystem using non-toxic propellant with 3-axis ACS for orbit change and/or...

  7. Control Demonstration of Multiple Doubly-Fed Induction Motors for Hybrid Electric Propulsion

    Science.gov (United States)

    Sadey, David J.; Bodson, Marc; Csank, Jeffrey T.; Hunker, Keith R.; Theman, Casey J.; Taylor, Linda M.

    2017-01-01

    The Convergent Aeronautics Solutions (CAS) High Voltage-Hybrid Electric Propulsion (HVHEP) task was formulated to support the move into future hybrid-electric aircraft. The goal of this project is to develop a new AC power architecture to support the needs of higher efficiency and lower emissions. This proposed architecture will adopt the use of the doubly-fed induction machine (DFIM) for propulsor drive motor application.The Convergent Aeronautics Solutions (CAS) High Voltage-Hybrid Electric Propulsion (HVHEP) task was formulated to support the move into future hybrid-electric aircraft. The goal of this project is to develop a new AC power architecture to support the needs of higher efficiency and lower emissions. This proposed architecture will adopt the use of the doubly-fed induction machine (DFIM) for propulsor drive motor application. DFIMs are attractive for several reasons, including but not limited to the ability to self-start, ability to operate sub- and super-synchronously, and requiring only fractionally rated power converters on a per-unit basis depending on the required range of operation. The focus of this paper is based specifically on the presentation and analysis of a novel strategy which allows for independent operation of each of the aforementioned doubly-fed induction motors. This strategy includes synchronization, soft-start, and closed loop speed control of each motor as a means of controlling output thrust; be it concurrently or differentially. The demonstration of this strategy has recently been proven out on a low power test bed using fractional horsepower machines. Simulation and hardware test results are presented in the paper.

  8. MW-Class Electric Propulsion System Designs

    Science.gov (United States)

    LaPointe, Michael R.; Oleson, Steven; Pencil, Eric; Mercer, Carolyn; Distefano, Salvador

    2011-01-01

    Electric propulsion systems are well developed and have been in commercial use for several years. Ion and Hall thrusters have propelled robotic spacecraft to encounters with asteroids, the Moon, and minor planetary bodies within the solar system, while higher power systems are being considered to support even more demanding future space science and exploration missions. Such missions may include orbit raising and station-keeping for large platforms, robotic and human missions to near earth asteroids, cargo transport for sustained lunar or Mars exploration, and at very high-power, fast piloted missions to Mars and the outer planets. The Advanced In-Space Propulsion Project, High Efficiency Space Power Systems Project, and High Power Electric Propulsion Demonstration Project were established within the NASA Exploration Technology Development and Demonstration Program to develop and advance the fundamental technologies required for these long-range, future exploration missions. Under the auspices of the High Efficiency Space Power Systems Project, and supported by the Advanced In-Space Propulsion and High Power Electric Propulsion Projects, the COMPASS design team at the NASA Glenn Research Center performed multiple parametric design analyses to determine solar and nuclear electric power technology requirements for representative 300-kW class and pulsed and steady-state MW-class electric propulsion systems. This paper describes the results of the MW-class electric power and propulsion design analysis. Starting with the representative MW-class vehicle configurations, and using design reference missions bounded by launch dates, several power system technology improvements were introduced into the parametric COMPASS simulations to determine the potential system level benefits such technologies might provide. Those technologies providing quantitative system level benefits were then assessed for technical feasibility, cost, and time to develop. Key assumptions and primary

  9. Project Icarus: Nuclear Fusion Propulsion Concept Comparison

    Science.gov (United States)

    Stanic, M.

    Project Icarus will use nuclear fusion as the primary propulsion, since achieving breakeven is imminent within the next decade. Therefore, fusion technology provides confidence in further development and fairly high technological maturity by the time the Icarus mission would be plausible. Currently there are numerous (over 2 dozen) different fusion approaches that are simultaneously being developed around the World and it is difficult to predict which of the concepts is going to be the most successful one. This study tried to estimate current technological maturity and possible technological extrapolation of fusion approaches for which appropriate data could be found. Figures of merit that were assessed include: current technological state, mass and volume estimates, possible gain values, main advantages and disadvantages of the concept and an attempt to extrapolate current technological state for the next decade or two. Analysis suggests that Magnetic Confinement Fusion (MCF) concepts are not likely to deliver sufficient performance due to size, mass, gain and large technological barriers of the concept. However, ICF and PJMIF did show potential for delivering necessary performance, assuming appropriate techno- logical advances. This paper is a submission of the Project Icarus Study Group.

  10. Reduced Toxicity Fuel Satellite Propulsion System Including Fuel Cell Reformer with Alcohols Such as Methanol

    Science.gov (United States)

    Schneider, Steven J. (Inventor)

    2001-01-01

    A reduced toxicity fuel satellite propulsion system including a reduced toxicity propellant supply for consumption in an axial class thruster and an ACS class thruster. The system includes suitable valves and conduits for supplying the reduced toxicity propellant to the ACS decomposing element of an ACS thruster. The ACS decomposing element is operative to decompose the reduced toxicity propellant into hot propulsive gases. In addition the system includes suitable valves and conduits for supplying the reduced toxicity propellant to an axial decomposing element of the axial thruster. The axial decomposing element is operative to decompose the reduced toxicity propellant into hot gases. The system further includes suitable valves and conduits for supplying a second propellant to a combustion chamber of the axial thruster, whereby the hot gases and the second propellant auto-ignite and begin the combustion process for producing thrust.

  11. Superconducting DC homopolar motors for ship propulsion

    Energy Technology Data Exchange (ETDEWEB)

    Heiberger, M.; Reed, M.R.; Creedon, W.P.; O' Hea, B.J. [General Atomic (United States)

    2000-07-01

    Superconducting DC homopolar motors have undergone recent advances in technology, warranting serious consideration of their use for ship propulsion. Homopolar motor propulsion is now practical because of two key technology developments: cryogen-free superconducting refrigeration and high performance motor fiber brushes. These compact motors are ideal for podded applications, where reduced drag and fuel consumption are predicted. In addition, the simple DC motor controller is more efficient and reliable compared with AC motor controllers. Military ships also benefit from increased stealth implicit in homopolar DC excitation, which also allows the option for direct hull or pod mounting. (authors)

  12. AC Loss Analysis of MgB2-Based Fully Superconducting Machines

    Science.gov (United States)

    Feddersen, M.; Haran, K. S.; Berg, F.

    2017-12-01

    Superconducting electric machines have shown potential for significant increase in power density, making them attractive for size and weight sensitive applications such as offshore wind generation, marine propulsion, and hybrid-electric aircraft propulsion. Superconductors exhibit no loss under dc conditions, though ac current and field produce considerable losses due to hysteresis, eddy currents, and coupling mechanisms. For this reason, many present machines are designed to be partially superconducting, meaning that the dc field components are superconducting while the ac armature coils are conventional conductors. Fully superconducting designs can provide increases in power density with significantly higher armature current; however, a good estimate of ac losses is required to determine the feasibility under the machines intended operating conditions. This paper aims to characterize the expected losses in a fully superconducting machine targeted towards aircraft, based on an actively-shielded, partially superconducting machine from prior work. Various factors are examined such as magnet strength, operating frequency, and machine load to produce a model for the loss in the superconducting components of the machine. This model is then used to optimize the design of the machine for minimal ac loss while maximizing power density. Important observations from the study are discussed.

  13. Diesel fueled ship propulsion fuel cell demonstration project

    Energy Technology Data Exchange (ETDEWEB)

    Kumm, W.H. [Arctic Energies Ltd., Severna Park, MD (United States)

    1996-12-31

    The paper describes the work underway to adapt a former US Navy diesel electric drive ship as a 2.4 Megawatt fuel cell powered, US Coast Guard operated, demonstrator. The Project will design the new configuration, and then remove the four 600 kW diesel electric generators and auxiliaries. It will design, build and install fourteen or more nominal 180 kW diesel fueled molten carbonate internal reforming direct fuel cells (DFCs). The USCG cutter VINDICATOR has been chosen. The adaptation will be carried out at the USCG shipyard at Curtis Bay, MD. A multi-agency (state and federal) cooperative project is now underway. The USCG prime contractor, AEL, is performing the work under a Phase III Small Business Innovation Research (SBIR) award. This follows their successful completion of Phases I and II under contract to the US Naval Sea Systems (NAVSEA) from 1989 through 1993 which successfully demonstrated the feasibility of diesel fueled DFCs. The demonstrated marine propulsion of a USCG cutter will lead to commercial, naval ship and submarine applications as well as on-land applications such as diesel fueled locomotives.

  14. New propulsion components for electric vehicles

    Science.gov (United States)

    Secunde, R. R.

    1983-01-01

    Improved component technology is described. This includes electronically commutated permanent magnet motors of both drum and disk configurations, an unconventional brush commutated motor, ac induction motors, various controllers, transmissions and complete systems. One or more of these approaches to electric vehicle propulsion may eventually displace presently used controllers and brush commutated dc motors. Previously announced in STAR as N83-25982

  15. THE FUTURE OF SPACECRAFT NUCLEAR PROPULSION

    OpenAIRE

    Jansen, Frank

    2014-01-01

    This paper summarizes the advantages of space nuclear power and propulsion systems. It describes the actual status of international power level dependent spacecraft nuclear propulsion missions, especially the high power EU-Russian MEGAHIT study including the Russian Megawatt-Class Nuclear Power Propulsion System, the NASA GRC project and the low and medium power EU DiPoP study. Space nuclear propulsion based mission scenarios of these studies are sketched as well.

  16. Aircraft Nuclear Propulsion Project Quarterly Progress Report for Period Ending December 31, 1956

    Energy Technology Data Exchange (ETDEWEB)

    NA, NA [ORNL

    1957-03-12

    This quarterly progress report of the Aircraft Nuclear Propulsion Project at ORNL records the technical progress of research on circulating-fuel reactors and other ANP research at the Laboratory. The report is divided into five major parts: 1) Aircraft Reactor Engineering, 2) Chemistry, and 3) Metallurgy, 4) Heat Transfer and Physical Properties, Radiation Damage, and Fuel Recovery and Reprocessing, and 5) Reactor Shielding.

  17. Catalyzed Combustion In Micro-Propulsion Devices: Project Status

    Science.gov (United States)

    Sung, C. J.; Schneider, S. J.

    2003-01-01

    In recent years, there has been a tendency toward shrinking the size of spacecraft. New classes of spacecraft called micro-spacecraft have been defined by their mass, power, and size ranges. Spacecraft in the range of 20 to 100 kg represent the class most likely to be utilized by most small sat users in the near future. There are also efforts to develop 10 to 20 kg class spacecraft for use in satellite constellations. More ambitious efforts will be to develop spacecraft less than 10 kg, in which MEMS fabrication technology is required. These new micro-spacecraft will require new micro-propulsion technology. Although micro-propulsion includes electric propulsion approaches, the focus of this proposed program is micro-chemical propulsion which requires the development of microcombustors. As combustors are scaled down, the surface to volume ratio increases. The heat release rate in the combustor scales with volume, while heat loss rate scales with surface area. Consequently, heat loss eventually dominates over heat release when the combustor size becomes smaller, thereby leading to flame quenching. The limitations imposed on chamber length and diameter has an immediate impact on the degree of miniaturization of a micro-combustor. Before micro-combustors can be realized, such a difficulty must be overcome. One viable combustion alternative is to take advantage of surface catalysis. Micro-chemical propulsion for small spacecraft can be used for primary thrust, orbit insertion, trajectory-control, and attitude control. Grouping micro-propulsion devices in arrays will allow their use for larger thrust applications. By using an array composed of hundreds or thousands of micro-thruster units, a particular configuration can be arranged to be best suited for a specific application. Moreover, different thruster sizes would provide for a range of thrust levels (from N s to mN s) within the same array. Several thrusters could be fired simultaneously for thrust levels higher than

  18. Propulsion System and Orbit Maneuver Integration in CubeSats: Trajectory Control Strategies Using Micro Ion Propulsion

    Science.gov (United States)

    Hudson, Jennifer; Martinez, Andres; Petro, Andrew

    2015-01-01

    The Propulsion System and Orbit Maneuver Integration in CubeSats project aims to solve the challenges of integrating a micro electric propulsion system on a CubeSat in order to perform orbital maneuvers and control attitude. This represents a fundamentally new capability for CubeSats, which typically do not contain propulsion systems and cannot maneuver far beyond their initial orbits.

  19. Low AC Loss in a 3 kA HTS Cable of the Dutch Project

    Science.gov (United States)

    Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan; Willén, Dag; Lentge, Heidi; Thidemann, Carsten; Traeholt, Chresten; Melnik, Irina; Geschiere, Alex

    Requirements for a 6 km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160 mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in the cable, potentially affecting public acceptance of the project. A way out would be to substantially reduce AC losses from 1 down to about 0.1 W/m per phase at rated current of 3 kArms, frequency of 50 Hz and temperature of 77 K. In this paper we discuss a strategy towards this ambitious goal, a concept design of the single phase cable 3 kA conductor made of YBCO tapes and present corresponding experimental and simulation data supporting the developed approach leading directly to this goal. HTS cable model was made that show a drastically reduced AC loss. The low loss was achieved by using appropriate pitch angles for two-layer cable conductor of relatively large diameter, by minimizing the gaps between the HTS tapes, and by using narrow HTS tapes that conform well to the roundness of the underlying former. AC loss of 0.12 W/m at 3 kArms was measured at a frequency of 60 Hz and at a temperature of 77 K.

  20. Distributed Propulsion Vehicles

    Science.gov (United States)

    Kim, Hyun Dae

    2010-01-01

    Since the introduction of large jet-powered transport aircraft, the majority of these vehicles have been designed by placing thrust-generating engines either under the wings or on the fuselage to minimize aerodynamic interactions on the vehicle operation. However, advances in computational and experimental tools along with new technologies in materials, structures, and aircraft controls, etc. are enabling a high degree of integration of the airframe and propulsion system in aircraft design. The National Aeronautics and Space Administration (NASA) has been investigating a number of revolutionary distributed propulsion vehicle concepts to increase aircraft performance. The concept of distributed propulsion is to fully integrate a propulsion system within an airframe such that the aircraft takes full synergistic benefits of coupling of airframe aerodynamics and the propulsion thrust stream by distributing thrust using many propulsors on the airframe. Some of the concepts are based on the use of distributed jet flaps, distributed small multiple engines, gas-driven multi-fans, mechanically driven multifans, cross-flow fans, and electric fans driven by turboelectric generators. This paper describes some early concepts of the distributed propulsion vehicles and the current turboelectric distributed propulsion (TeDP) vehicle concepts being studied under the NASA s Subsonic Fixed Wing (SFW) Project to drastically reduce aircraft-related fuel burn, emissions, and noise by the year 2030 to 2035.

  1. The Nuclear Cryogenic Propulsion Stage

    Science.gov (United States)

    Houts, Michael G.; Kim, Tony; Emrich, William J.; Hickman, Robert R.; Broadway, Jeramie W.; Gerrish, Harold P.; Doughty, Glen; Belvin, Anthony; Borowski, Stanley K.; Scott, John

    2014-01-01

    The fundamental capability of Nuclear Thermal Propulsion (NTP) is game changing for space exploration. A first generation Nuclear Cryogenic Propulsion Stage (NCPS) based on NTP could provide high thrust at a specific impulse above 900 s, roughly double that of state of the art chemical engines. Characteristics of fission and NTP indicate that useful first generation systems will provide a foundation for future systems with extremely high performance. The role of the NCPS in the development of advanced nuclear propulsion systems could be analogous to the role of the DC-3 in the development of advanced aviation. Progress made under the NCPS project could help enable both advanced NTP and advanced Nuclear Electric Propulsion (NEP). Nuclear propulsion can be affordable and viable compared to other propulsion systems and must overcome a biased public fear due to hyper-environmentalism and a false perception of radiation and explosion risk.

  2. Space Transportation Technology Workshop: Propulsion Research and Technology

    Science.gov (United States)

    2000-01-01

    This viewgraph presentation gives an overview of the Space Transportation Technology Workshop topics, including Propulsion Research and Technology (PR&T) project level organization, FY 2001 - 2006 project roadmap, points of contact, foundation technologies, auxiliary propulsion technology, PR&T Low Cost Turbo Rocket, and PR&T advanced reusable technologies RBCC test bed.

  3. Nuclear propulsion: to go to the moon in 24 hours; Propulsion nucleaire: aller sur la lune en 24 heures

    Energy Technology Data Exchange (ETDEWEB)

    Freeman, M

    1999-10-01

    Nuclear propulsion is a necessary step to give to man the opportunity of developing activities in space. This technique enables rockets to go farther, more quickly and to transport more load than the classical chemical propulsion. Space travel requires huge quantities of energy. An equivalent quantity of energy can be extracted from 13 tons of liquid hydrogen-oxygen, from 20 g of uranium (fission), from 0.5 g of deuterium (fusion) and from 0.02 g of anti-hydrogen-hydrogen (annihilation). The concept of nuclear thermal rocket (NTR) is based on an embarked nuclear reactor whose purpose is to heat hydrogen to 3000 K temperature. The thrust can be increased by injecting liquid oxygen in the nozzle to react with supersonic hydrogen. (A.C.)

  4. Legal Implications of Nuclear Propulsion for Space Objects

    Science.gov (United States)

    Pop, V.

    2002-01-01

    This paper is intended to examine nuclear propulsion concepts such as "Project Orion", "Project Daedalus", NERVA, VASIMIR, from the legal point of view. The UN Principles Relevant to the Use of Nuclear Power Sources in Outer Space apply to nuclear power sources in outer space devoted to the generation of electric power on board space objects for non-propulsive purposes, and do not regulate the use of nuclear energy as a means of propulsion. However, nuclear propulsion by means of detonating atomic bombs (ORION) is, in principle, banned under the 1963 Treaty Banning Nuclear Weapon Tests in the Atmosphere, in Outer Space, and Under Water. The legality of use of nuclear propulsion will be analysed from different approaches - historical (i.e. the lawfulness of these projects at the time of their proposal, at the present time, and in the future - in the light of the mutability and evolution of international law), spatial (i.e. the legal regime governing peaceful nuclear explosions in different spatial zones - Earth atmosphere, Earth orbit, Solar System, and interstellar space), and technical (i.e, the legal regime applicable to different nuclear propulsion techniques, and to the various negative effects - e.g. damage to other space systems as an effect of the electromagnetic pulse, etc). The paper will analyse the positive law, and will also come with suggestions "de lege ferenda".

  5. An Overview of the CNES Propulsion Program for Spacecraft

    Science.gov (United States)

    Cadiou, A.; Darnon, F.; Gibek, I.; Jolivet, L.; Pillet, N.

    2004-10-01

    This paper presents an overview of the CNES spacecraft propulsion activities. The main existing and future projects corresponding to low earth orbit and geostationary platforms are described. These projects cover various types of propulsion subsystems: monopropellant, bipropellant and electric. Monopropellant is mainly used for low earth orbit applications such as earth observation (SPOT/Helios, PLEIADES) or scientific applications (minisatellite PROTEUS line and micro satellites MYRIADE line). Bipropellant is used for geostationary telecommunications satellites (@BUS). The field of application of electric propulsion is the station keeping of geostationary telecommunication satellites (@BUS), main propulsion for specific probes (SMART 1) and fine attitude control for dedicated micro satellites (MICROSCOPE). The preparation of the future and the associated Research and Technology program are also described in the paper. The future developments are mainly dedicated to the performance improvements of electric propulsion which leads to the development of thrusters with higher thrust and higher specific impulse than those existing today, the evaluation of the different low thrust technologies for formation flying applications, the development of new systems to pressurize the propellants (volatile liquid, micro pump), the research on green propellants and different actions concerning components such as over wrapped pressure vessels, valves, micro propulsion. A constant effort is also put on plume effect in chemical and electrical propulsion area (improvement of tools and test activities) in the continuity of the previous work. These different R &T activities are described in detail after a presentation of the different projects and of their propulsion subsystems. The scientific activity supporting the development of Hall thrusters is going on in the frame of the GDR (Groupement de Recherche) CNRS / Universities / CNES / SNECMA on Plasma Propulsion.

  6. In-Space Propulsion Technology Program Solar Electric Propulsion Technologies

    Science.gov (United States)

    Dankanich, John W.

    2006-01-01

    NASA's In-space Propulsion (ISP) Technology Project is developing new propulsion technologies that can enable or enhance near and mid-term NASA science missions. The Solar Electric Propulsion (SEP) technology area has been investing in NASA s Evolutionary Xenon Thruster (NEXT), the High Voltage Hall Accelerator (HiVHAC), lightweight reliable feed systems, wear testing, and thruster modeling. These investments are specifically targeted to increase planetary science payload capability, expand the envelope of planetary science destinations, and significantly reduce the travel times, risk, and cost of NASA planetary science missions. Status and expected capabilities of the SEP technologies are reviewed in this presentation. The SEP technology area supports numerous mission studies and architecture analyses to determine which investments will give the greatest benefit to science missions. Both the NEXT and HiVHAC thrusters have modified their nominal throttle tables to better utilize diminished solar array power on outbound missions. A new life extension mechanism has been implemented on HiVHAC to increase the throughput capability on low-power systems to meet the needs of cost-capped missions. Lower complexity, more reliable feed system components common to all electric propulsion (EP) systems are being developed. ISP has also leveraged commercial investments to further validate new ion and hall thruster technologies and to potentially lower EP mission costs.

  7. Theoretical and FEM analysis of suspension and propulsion system with HTS hybrid electromagnets in an EMS Maglev model

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Y.D., E-mail: ydchung@suwon.ac.kr [Department of Electrical Engineering, Suwon University, Bongdang Eup, Hwaseong Si 445-743 (Korea, Republic of); Lee, C.Y. [Korea Railroad Research Institute, Woram Dong, Uiwang Si 437-757 (Korea, Republic of); Jang, J.Y. [Department of Electrical Engineering, Ansan College of Technology, Choji-Dong, Ansan Si 425-792 (Korea, Republic of); Yoon, Y.S. [Department of Electrical and Electronic Engineering, Yonsei University, Sinchon-dong, Seoul 120-749 (Korea, Republic of); Ko, T.K. [Department of Electrical Engineering, Ansan College of Technology, Choji-Dong, Ansan Si 425-792 (Korea, Republic of)

    2011-11-15

    We examine levitation and propulsion forces of the proto-type maglev vehicle system based on 3D FEM. The levitation force increases over 15% due to AC current of the guideway. The levitation force by HTS electromagnet (EM) and AC current is larger over 30% than that of only HTS EM. We have been constructed a proto-type electromagnetic suspension (EMS) based maglev vehicle system. The maglev concept utilizes magnetic forces for noncontact suspension, guidance and propulsion. The suspension system with high temperature superconducting (HTS) hybrid electromagnet (EM) is composed of HTS coils and normal coils, which consume little power to keep large suspension gap. The magnetic forces realize to guide the vehicle, propel the vehicle along the guide-way and assist in braking action. The proto-type EMS-based Maglev model is designed to keep the suspension gap of 20 mm. This paper presents the theoretical analysis of the maglev vehicle based on the EMS model to obtain the designing parameters for levitation and propulsion forces. The magnetic field distributions of the electromagnetic forces with hybrid EM and propulsion stator coils are analyzed based on three dimension (3D) finite element method (FEM) analysis. From the simulation results, appropriately design parameters of the suspension, guidance and propulsion were obtained.

  8. Theoretical and FEM analysis of suspension and propulsion system with HTS hybrid electromagnets in an EMS Maglev model

    International Nuclear Information System (INIS)

    Chung, Y.D.; Lee, C.Y.; Jang, J.Y.; Yoon, Y.S.; Ko, T.K.

    2011-01-01

    We examine levitation and propulsion forces of the proto-type maglev vehicle system based on 3D FEM. The levitation force increases over 15% due to AC current of the guideway. The levitation force by HTS electromagnet (EM) and AC current is larger over 30% than that of only HTS EM. We have been constructed a proto-type electromagnetic suspension (EMS) based maglev vehicle system. The maglev concept utilizes magnetic forces for noncontact suspension, guidance and propulsion. The suspension system with high temperature superconducting (HTS) hybrid electromagnet (EM) is composed of HTS coils and normal coils, which consume little power to keep large suspension gap. The magnetic forces realize to guide the vehicle, propel the vehicle along the guide-way and assist in braking action. The proto-type EMS-based Maglev model is designed to keep the suspension gap of 20 mm. This paper presents the theoretical analysis of the maglev vehicle based on the EMS model to obtain the designing parameters for levitation and propulsion forces. The magnetic field distributions of the electromagnetic forces with hybrid EM and propulsion stator coils are analyzed based on three dimension (3D) finite element method (FEM) analysis. From the simulation results, appropriately design parameters of the suspension, guidance and propulsion were obtained.

  9. Low AC Loss in a 3 kA HTS Cable of the Dutch Project

    DEFF Research Database (Denmark)

    Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan

    2012-01-01

    Requirements for a 6km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in th...

  10. Authentication for Propulsion Test Streaming Video

    Data.gov (United States)

    National Aeronautics and Space Administration — A streaming video system was developed and implemented at SSC to support various propulsion projects at SSC. These projects included J-2X and AJ-26 rocket engine...

  11. FY2015 Propulsion Materials Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2016-12-30

    The Propulsion Materials Program actively supports the energy security and reduction of greenhouse emissions goals of VTO by investigating and identifying the materials properties that are most essential for continued development of cost-effective, highly efficient, and environmentally friendly next-generation heavy and light-duty powertrains. The technical approaches available to enhance propulsion systems focus on improvements in both vehicle efficiency and fuel substitution, both of which must overcome the performance limitations of the materials currently in use. Propulsion Materials Program activities work with national laboratories, industry experts, and VTO powertrain systems (e.g., Advanced Combustion Engines [ACE], Advanced Power Electronics and Electrical Machines [APEEM], and fuels) teams to develop strategies that overcome materials limitations in future powertrain performance. The technical maturity of the portfolio of funded projects ranges from basic science to subsystem prototype validation. Projects within a Propulsion Materials Program activity address materials concerns that directly impact critical technology barriers within each of the above programs, including barriers that impact fuel efficiency, thermal management, emissions reduction, improved reliability, and reduced manufacturing costs. The program engages only the barriers that result from material property limitations and represent fundamental, high-risk materials issues.

  12. Advanced hybrid vehicle propulsion system study

    Science.gov (United States)

    Schwarz, R.

    1982-01-01

    Results are presented of a study of an advanced heat engine/electric automotive hybrid propulsion system. The system uses a rotary stratified charge engine and ac motor/controller in a parallel hybrid configuration. The three tasks of the study were (1) parametric studies involving five different vehicle types, (2) design trade-off studies to determine the influence of various vehicle and propulsion system paramaters on system performance fuel economy and cost, and (3) a conceptual design establishing feasibility at the selected approach. Energy consumption for the selected system was .034 1/km (61.3 mpg) for the heat engine and .221 kWh/km (.356 kWh/mi) for the electric power system over a modified J227 a schedule D driving cycle. Life cycle costs were 7.13 cents/km (11.5 cents/mi) at $2/gal gasoline and 7 cents/kWh electricity for 160,000 km (100,000 mi) life.

  13. Nuclear rocket propulsion

    International Nuclear Information System (INIS)

    Clark, J.S.; Miller, T.J.

    1991-01-01

    NASA has initiated planning for a technology development project for nuclear rocket propulsion systems for Space Exploration Initiative (SEI) human and robotic missions to the Moon and to Mars. An Interagency project is underway that includes the Department of Energy National Laboratories for nuclear technology development. This paper summarizes the activities of the project planning team in FY 1990 and FY 1991, discusses the progress to date, and reviews the project plan. Critical technology issues have been identified and include: nuclear fuel temperature, life, and reliability; nuclear system ground test; safety; autonomous system operation and health monitoring; minimum mass and high specific impulse

  14. Low AC-Loss Superconducting Cable Technology for Electric Aircraft Propulsion, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — The availability of low AC loss magnesium diboride (MgB2) superconducting wires enables much lighter weight superconducting stator coils than with any other metal or...

  15. Nuclear thermal propulsion technology: Results of an interagency panel in FY 1991

    International Nuclear Information System (INIS)

    Clark, J.S.; Mcdaniel, P.; Howe, S.; Helms, I.; Stanley, M.

    1993-04-01

    NASA LeRC was selected to lead nuclear propulsion technology development for NASA. Also participating in the project are NASA MSFC and JPL. The U.S. Department of Energy will develop nuclear technology and will conduct nuclear component, subsystem, and system testing at appropriate DOE test facilities. NASA program management is the responsibility of NASA/RP. The project includes both nuclear electric propulsion (NEP) and nuclear thermal propulsion (NTP) technology development. This report summarizes the efforts of an interagency panel that evaluated NTP technology in 1991. Other panels were also at work in 1991 on other aspects of nuclear propulsion, and the six panels worked closely together. The charters for the other panels and some of their results are also discussed. Important collaborative efforts with other panels are highlighted. The interagency (NASA/DOE/DOD) NTP Technology Panel worked in 1991 to evaluate nuclear thermal propulsion concepts on a consistent basis. Additionally, the panel worked to continue technology development project planning for a joint project in nuclear propulsion for the Space Exploration Initiative (SEI). Five meetings of the panel were held in 1991 to continue the planning for technology development of nuclear thermal propulsion systems. The state-of-the-art of the NTP technologies was reviewed in some detail. The major technologies identified were as follows: fuels, coatings, and other reactor technologies; materials; instrumentation, controls, health monitoring and management, and associated technologies; nozzles; and feed system technology, including turbopump assemblies

  16. Chemistry and propulsion; Chimie et propulsions

    Energy Technology Data Exchange (ETDEWEB)

    Potier, P [Maison de la Chimie, 75 - Paris (France); Davenas, A [societe Nationale des Poudres et des Explosifs - SNPE (France); Berman, M [Air Force Office of Scientific Research, Arlington, VA (United States); and others

    2002-07-01

    During the colloquium on chemistry and propulsion, held in march 2002, ten papers have been presented. The proceedings are brought in this document: ramjet, scram-jet and Pulse Detonation Engine; researches and applications on energetic materials and propulsion; advances in poly-nitrogen chemistry; evolution of space propulsion; environmental and technological stakes of aeronautic propulsion; ramjet engines and pulse detonation engines, automobiles thermal engines for 2015, high temperature fuel cells for the propulsion domain, the hydrogen and the fuel cells in the future transports. (A.L.B.)

  17. Fusion propulsion systems

    International Nuclear Information System (INIS)

    Haloulakos, V.E.; Bourque, R.F.

    1989-01-01

    The continuing and expanding national efforts in both the military and commercial sectors for exploration and utilization of space will require launch, assembly in space, and orbital transfer of large payloads. The currently available delivery systems, utilizing various forms of chemical propulsion, do not have the payload capacity to fulfill the planned missions. National planning documents such as Air Force Project Forecast II and the National Commission on Space Report to the President contain numerous missions and payload delivery schedules that are beyond the present capabilities of the available systems, such as the Space Shuttle and the Expendable Launch Vehicles (ELVs). The need, therefore, is very pressing to design, develop, and deploy propulsion systems that offer a quantum level increase in delivered performance. One such potential system is fusion propulsion. This paper summarizes the result of an Air Force Astronautics Laboratory (AFAL) sponsored study of fusion propulsion conducted by the McDonnell Douglas Astronautics Company (MDAC), and its subcontractor General Atomics This study explored the potential of fusion propulsion for Air Force missions. Fusion fuels and existing confinement concepts were evaluated according to elaborate criteria. Two fuels, deuterium-tritium and deuterium-helium 3 (D- 3 He) were considered worthy of further consideration. D- 3 He was selected as the most attractive for this Air Force study. The colliding translating compact torus confinement concept was evaluated in depth and found to possibly possess the low mass and compactness required. Another possible concept is inertial confinement with the propellant surrounding the target. 5 refs., 5 figs., 8 tabs

  18. Nuclear propulsion: to go to the moon in 24 hours

    International Nuclear Information System (INIS)

    Freeman, M.

    1999-01-01

    Nuclear propulsion is a necessary step to give to man the opportunity of developing activities in space. This technique enables rockets to go farther, more quickly and to transport more load than the classical chemical propulsion. Space travel requires huge quantities of energy. An equivalent quantity of energy can be extracted from 13 tons of liquid hydrogen-oxygen, from 20 g of uranium (fission), from 0.5 g of deuterium (fusion) and from 0.02 g of anti-hydrogen-hydrogen (annihilation). The concept of nuclear thermal rocket (NTR) is based on an embarked nuclear reactor whose purpose is to heat hydrogen to 3000 K temperature. The thrust can be increased by injecting liquid oxygen in the nozzle to react with supersonic hydrogen. (A.C.)

  19. FY2016 Propulsion Materials Annual Progress Report

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2017-05-01

    The Propulsion Materials Program actively supports the energy security and reduction of greenhouse emissions goals of VTO by investigating and identifying the materials properties that are most essential for continued development of cost-effective, highly efficient, and environmentally friendly next-generation heavy and light-duty powertrains. The technical approaches available to enhance propulsion systems focus on improvements in both vehicle efficiency and fuel substitution, both of which must overcome the performance limitations of the materials currently in use. Propulsion Materials Program activities work with national laboratories, industry experts, and VTO powertrain systems (e.g., Advanced Combustion Engines and Fuels) teams to develop strategies that overcome materials limitations in future powertrain performance. The technical maturity of the portfolio of funded projects ranges from basic science to subsystem prototype validation. Projects within a Propulsion Materials Program activity address materials concerns that directly impact critical technology barriers within each of the above programs, including barriers that impact fuel efficiency, thermal management, emissions reduction, improved reliability, and reduced manufacturing costs. The program engages only the barriers that result from material property limitations and represent fundamental, high-risk materials issues.

  20. Nuclear thermal propulsion workshop overview

    International Nuclear Information System (INIS)

    Clark, J.S.

    1991-01-01

    NASA is planning an Exploration Technology Program as part of the Space Exploration Initiative to return U.S. astronauts to the moon, conduct intensive robotic exploration of the moon and Mars, and to conduct a piloted mission to Mars by 2019. Nuclear Propulsion is one of the key technology thrust for the human mission to Mars. The workshop addresses NTP (Nuclear Thermal Rocket) technologies with purpose to: assess the state-of-the-art of nuclear propulsion concepts; assess the potential benefits of the concepts for the mission to Mars; identify critical, enabling technologies; lay-out (first order) technology development plans including facility requirements; and estimate the cost of developing these technologies to flight-ready status. The output from the workshop will serve as a data base for nuclear propulsion project planning

  1. FY2009 Annual Progress Report for Propulsion Materials

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2010-01-16

    The Propulsion Materials program focuses on enabling and innovative materials technologies that are critical in improving the efficiency of advanced engines. Projects within the Propulsion Materials Program address materials concerns that directly impact the critical technical barriers in each of these programs—barriers such as fuel efficiency, thermal management, emissions reduction, and reduced manufacturing costs.

  2. Advanced Chemical Propulsion for Science Missions

    Science.gov (United States)

    Liou, Larry

    2008-01-01

    The advanced chemical propulsion technology area of NASA's In-Space Technology Project is investing in systems and components for increased performance and reduced cost of chemical propulsion technologies applicable to near-term science missions. Presently the primary investment in the advanced chemical propulsion technology area is in the AMBR high temperature storable bipropellant rocket engine. Scheduled to be available for flight development starting in year 2008, AMBR engine shows a 60 kg payload gain in an analysis for the Titan-Enceladus orbiter mission and a 33 percent manufacturing cost reduction over its baseline, state-of-the-art counterpart. Other technologies invested include the reliable lightweight tanks for propellant and the precision propellant management and mixture ratio control. Both technologies show significant mission benefit, can be applied to any liquid propulsion system, and upon completion of the efforts described in this paper, are at least in parts ready for flight infusion. Details of the technologies are discussed.

  3. Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

    Directory of Open Access Journals (Sweden)

    Evi Ploumpidou

    2017-12-01

    Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

  4. Nuclear propulsion: the way to mars is open

    International Nuclear Information System (INIS)

    Jamet, Ph.

    2005-01-01

    A manned mission to mars will require the use of nuclear propulsion because of the efficiency of this technique in terms of high values for the momentum/weight ratio and the thrust. A period of 10 years will be necessary to develop nuclear-thermal or nuclear-electric propulsion systems able to bring a 5 member crew on mars. The go and return trip has to be optimized in terms of energy consumption: it may last 250 days and a time period of about 500 days, spent on mars, may be necessary before undertaking the return trip. The long stay on mars implies the existence of important structure so that life may be possible for the astronauts. The weight of equipment needed to be carried is assessed to reach 20 or 30 tonnes. Different scenarios have been considered by the Nasa in order to reduce the constraints on the launching: launching from either a lunar station or a space station has been proposed. (A.C.)

  5. Materials Advance Chemical Propulsion Technology

    Science.gov (United States)

    2012-01-01

    In the future, the Planetary Science Division of NASA's Science Mission Directorate hopes to use better-performing and lower-cost propulsion systems to send rovers, probes, and observers to places like Mars, Jupiter, and Saturn. For such purposes, a new propulsion technology called the Advanced Materials Bipropellant Rocket (AMBR) was developed under NASA's In-Space Propulsion Technology (ISPT) project, located at Glenn Research Center. As an advanced chemical propulsion system, AMBR uses nitrogen tetroxide oxidizer and hydrazine fuel to propel a spacecraft. Based on current research and development efforts, the technology shows great promise for increasing engine operation and engine lifespan, as well as lowering manufacturing costs. In developing AMBR, ISPT has several goals: to decrease the time it takes for a spacecraft to travel to its destination, reduce the cost of making the propulsion system, and lessen the weight of the propulsion system. If goals like these are met, it could result in greater capabilities for in-space science investigations. For example, if the amount (and weight) of propellant required on a spacecraft is reduced, more scientific instruments (and weight) could be added to the spacecraft. To achieve AMBR s maximum potential performance, the engine needed to be capable of operating at extremely high temperatures and pressure. To this end, ISPT required engine chambers made of iridium-coated rhenium (strong, high-temperature metallic elements) that allowed operation at temperatures close to 4,000 F. In addition, ISPT needed an advanced manufacturing technique for better coating methods to increase the strength of the engine chamber without increasing the costs of fabricating the chamber.

  6. Experimental approach of plasma supersonic expansion physics and of Hall effect propulsion systems

    International Nuclear Information System (INIS)

    Mazouffre, Stephane

    2009-01-01

    This report for accreditation to supervise research (HDR) proposes a synthesis of scientific and research works performed by the author during about ten years. Thus, a first part addresses studies on plasma rarefied supersonic flows: expansion through a sonic hole and through a Laval nozzle. The next part addresses the study of plasma propulsion for spacecraft, and more particularly electric propulsion based on the Hall effect: phenomena of ionic and atomic transport, characteristics of the electric field, energy deposition on walls, basic scale laws, related works, hybrid Hall-RF propulsion systems. The third part presents perspectives and projects related to propulsion by Hall effect (research topics, planned researches, a European project on high power, hybrid Hall-RF propulsion) and to ions-ions plasma (the PEGASES concept, the NExET test installation, RF source of negative ions and magnetic trap)

  7. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  8. Antennas Designed for Advanced Communications for Air Traffic Management (AC/ATM) Project

    Science.gov (United States)

    Zakrajsek, Robert J.

    2000-01-01

    The goal of the Advanced Communications for Air Traffic Management (AC/ATM) Project at the NASA Glenn Research Center at Lewis Field is to enable a communications infrastructure that provides the capacity, efficiency, and flexibility necessary to realize a mature free-flight environment. The technical thrust of the AC/ATM Project is targeted at the design, development, integration, test, and demonstration of enabling technologies for global broadband aeronautical communications. Since Ku-band facilities and equipment are readily available, one of the near-term demonstrations involves a link through a Kuband communications satellite. Two conformally mounted antennas will support the initial AC/ATM communications links. Both of these are steered electronically through monolithic microwave integrated circuit (MMIC) amplifiers and phase shifters. This link will be asymmetrical with the downlink to the aircraft (mobile vehicle) at a throughput rate of greater than 1.5 megabits per second (Mbps), whereas the throughput rate of the uplink from the aircraft will be greater than 100 kilobits per second (kbps). The data on the downlink can be narrow-band, wide-band, or a combination of both, depending on the requirements of the experiment. The AC/ATM project is purchasing a phased-array Ku-band transmitting antenna for the uplink from the test vehicle. Many Ku-band receiving antennas have been built, and one will be borrowed for a short time to perform the initial experiments at the NASA Glenn Research Center at Lewis Field. The Ku-band transmitting antenna is a 254-element MMIC phased-array antenna being built by Boeing Phantom Works. Each element can radiate 100 mW. The antenna is approximately 43-cm high by 24-cm wide by 3.3-cm thick. It can be steered beyond 60 from broadside. The beamwidth varies from 6 at broadside to 12 degrees at 60 degrees, which is typical of phased-array antennas. When the antenna is steered to 60 degrees, the beamwidth will illuminate

  9. Space Nuclear Thermal Propulsion (SNTP) Air Force facility

    Science.gov (United States)

    Beck, David F.

    The Space Nuclear Thermal Propulsion (SNTP) Program is an initiative within the US Air Force to acquire and validate advanced technologies that could be used to sustain superior capabilities in the area or space nuclear propulsion. The SNTP Program has a specific objective of demonstrating the feasibility of the particle bed reactor (PBR) concept. The term PIPET refers to a project within the SNTP Program responsible for the design, development, construction, and operation of a test reactor facility, including all support systems, that is intended to resolve program technology issues and test goals. A nuclear test facility has been designed that meets SNTP Facility requirements. The design approach taken to meet SNTP requirements has resulted in a nuclear test facility that should encompass a wide range of nuclear thermal propulsion (NTP) test requirements that may be generated within other programs. The SNTP PIPET project is actively working with DOE and NASA to assess this possibility.

  10. An Analysis of Rocket Propulsion Testing Costs

    Science.gov (United States)

    Ramirez, Carmen; Rahman, Shamim

    2010-01-01

    The primary mission at NASA Stennis Space Center (SSC) is rocket propulsion testing. Such testing is commonly characterized as one of two types: production testing for certification and acceptance of engine hardware, and developmental testing for prototype evaluation or research and development (R&D) purposes. For programmatic reasons there is a continuing need to assess and evaluate the test costs for the various types of test campaigns that involve liquid rocket propellant test articles. Presently, in fact, there is a critical need to provide guidance on what represents a best value for testing and provide some key economic insights for decision-makers within NASA and the test customers outside the Agency. Hence, selected rocket propulsion test databases and references have been evaluated and analyzed with the intent to discover correlations of technical information and test costs that could help produce more reliable and accurate cost projections in the future. The process of searching, collecting, and validating propulsion test cost information presented some unique obstacles which then led to a set of recommendations for improvement in order to facilitate future cost information gathering and analysis. In summary, this historical account and evaluation of rocket propulsion test cost information will enhance understanding of the various kinds of project cost information; identify certain trends of interest to the aerospace testing community.

  11. Hybrid Electric Propulsion Technologies for Commercial Transports

    Science.gov (United States)

    Bowman, Cheryl; Jansen, Ralph; Jankovsky, Amy

    2016-01-01

    NASA Aeronautics Research Mission Directorate has set strategic research thrusts to address the major drivers of aviation such as growth in demand for high-speed mobility, addressing global climate and capitalizing in the convergence of technological advances. Transitioning aviation to low carbon propulsion is one of the key strategic research thrust and drives the search for alternative and greener propulsion system for advanced aircraft configurations. This work requires multidisciplinary skills coming from multiple entities. The Hybrid Gas-Electric Subproject in the Advanced Air Transportation Project is energizing the transport class landscape by accepting the technical challenge of identifying and validating a transport class aircraft with net benefit from hybrid propulsion. This highly integrated aircraft of the future will only happen if airframe expertise from NASA Langley, modeling and simulation expertise from NASA Ames, propulsion expertise from NASA Glenn, and the flight research capabilities from NASA Armstrong are brought together to leverage the rich capabilities of U.S. Industry and Academia.

  12. Volume Dynamics Propulsion System Modeling for Supersonics Vehicle Research

    Science.gov (United States)

    Kopasakis, George; Connolly, Joseph W.; Paxson, Daniel E.; Ma, Peter

    2010-01-01

    Under the NASA Fundamental Aeronautics Program the Supersonics Project is working to overcome the obstacles to supersonic commercial flight. The proposed vehicles are long slim body aircraft with pronounced aero-servo-elastic modes. These modes can potentially couple with propulsion system dynamics; leading to performance challenges such as aircraft ride quality and stability. Other disturbances upstream of the engine generated from atmospheric wind gusts, angle of attack, and yaw can have similar effects. In addition, for optimal propulsion system performance, normal inlet-engine operations are required to be closer to compressor stall and inlet unstart. To study these phenomena an integrated model is needed that includes both airframe structural dynamics as well as the propulsion system dynamics. This paper covers the propulsion system component volume dynamics modeling of a turbojet engine that will be used for an integrated vehicle Aero-Propulso-Servo-Elastic model and for propulsion efficiency studies.

  13. FY2014 Propulsion Materials R&D Annual Progress Report

    Energy Technology Data Exchange (ETDEWEB)

    None

    2015-05-01

    The Propulsion Materials Program actively supports the energy security and reduction of greenhouse emissions goals of VTO by investigating and identifying the materials properties that are most essential for continued development of cost-effective, highly efficient, and environmentally friendly next-generation heavy and light-duty powertrains. The technical approaches available to enhance propulsion systems focus on improvements in both vehicle efficiency and fuel substitution, both of which must overcome the performance limitations of the materials currently in use. Propulsion Materials Program activities work with national laboratories, industry experts, and VTO powertrain systems (e.g., Advanced Combustion Engines [ACE], Advanced Power Electronics and Electrical Machines [APEEM], and fuels) teams to develop strategies that overcome materials limitations in future powertrain performance. The technical maturity of the portfolio of funded projects ranges from basic science to subsystem prototype validation. Projects within a Propulsion Materials Program activity address materials concerns that directly impact critical technology barriers within each of the above programs, including barriers that impact fuel efficiency, thermal management, emissions reduction, improved reliability, and reduced manufacturing costs. The program engages only the barriers that result from material property limitations and represent fundamental, high-risk materials issues.

  14. Primary electric propulsion thrust subsystem definition

    Science.gov (United States)

    Masek, T. D.; Ward, J. W.; Kami, S.

    1975-01-01

    A review is presented of the current status of primary propulsion thrust subsystem (TSS) performance, packaging considerations, and certain operational characteristics. Thrust subsystem related work from recent studies by Jet Propulsion Laboratories (JPL), Rockwell and Boeing is discussed. Existing performance for 30-cm thrusters, power processors and TSS is present along with projections for future improvements. Results of analyses to determine (1) magnetic field distributions resulting from an array of thrusters, (2) thruster emitted particle flux distributions from an array of thrusters, and (3) TSS element failure rates are described to indicate the availability of analytical tools for evaluation of TSS designs.

  15. NASA's nuclear thermal propulsion technology project

    International Nuclear Information System (INIS)

    Peecook, K.M.; Stone, J.R.

    1992-07-01

    The nonnuclear subsystem technologies required for incorporating nuclear thermal propulsion (NTP) into space-exploration missions are discussed. Of particular interest to planned missions are such technologies as materials, instrumentation and controls, turbomachinery, CFD modeling, nozzle extension designs and models, and analyses of exhaust plumes. NASA studies are described and/or proposed for refractory metals and alloys, robotic NTP controls, and turbopump materials candidates. Alternative nozzle concepts such as aerospikes and truncated plugs are proposed, and numerical simulations are set forth for studying heavy molecules and the backstreaming of highly reactive free-radical hydrogen in the exhaust plume. The critical technologies described in the paper are central to the development of NTP, and NTP has the potential to facilitate a range of space exploration activities. 3 refs

  16. In-Space Propulsion (ISP) Solar Sail Propulsion Technology Development

    Science.gov (United States)

    Montgomery, Edward E., IV

    2004-01-01

    An overview of the rationale and content for Solar Sail Propulsion (SSP), the on-going project to advance solar technology from technology readiness level 3 to 6 will be provided. A descriptive summary of the major and minor component efforts underway will include identification of the technology providers and a listing of anticipated products Recent important results from major system ground demonstrators will be provided. Finally, a current status of all activities will provided along with the most recent roadmap for the SSP technology development program.

  17. 28th Joint Propulsion Conference and Exhibit

    International Nuclear Information System (INIS)

    Stone, J.R.; Sovey, J.S.

    1992-07-01

    The National Aeronautics and Space Administration (NASA) has initiated a program to establish the readiness of nuclear electric propulsion (NEP) technology for relatively near-term applications to outer planet robotic science missions with potential future evolution to system for piloted Mars vehicles. This program was initiated in 1991 with a very modest effort identified with nuclear thermal propulsion (NTP); however, NEP is also an integral part of this program and builds upon NASA's Base Research and Technology Program in power and electric propulsion as well as the SP-100 space nuclear power program. The NEP Program will establish the feasibility and practicality of electric propulsion for robotic and piloted solar system exploration. The performance objectives are high specific impulse (200 greater than I(sub sp) greater than 10000 s), high efficiency (over 0.50), and low specific mass. The planning for this program was initially focussed on piloted Mars missions, but has since been redirected to first focus on 100-kW class systems for relatively near-term robotic missions, with possible future evolution to megawatt- and multi-megawatt-class systems applicable to cargo vehicles supporting human missions as well as to the piloted vehicles. This paper reviews current plans and recent progress for the overall nuclear electric propulsion project and closely related activities

  18. Sputter-Resistant Materials for Electric Propulsion, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — This SBIR Phase 2 project shall develop sputter-resistant materials for use in electric propulsion test facilities and for plume shields on spacecraft using electric...

  19. Integrated Main Propulsion System Performance Reconstruction Process/Models

    Science.gov (United States)

    Lopez, Eduardo; Elliott, Katie; Snell, Steven; Evans, Michael

    2013-01-01

    The Integrated Main Propulsion System (MPS) Performance Reconstruction process provides the MPS post-flight data files needed for postflight reporting to the project integration management and key customers to verify flight performance. This process/model was used as the baseline for the currently ongoing Space Launch System (SLS) work. The process utilizes several methodologies, including multiple software programs, to model integrated propulsion system performance through space shuttle ascent. It is used to evaluate integrated propulsion systems, including propellant tanks, feed systems, rocket engine, and pressurization systems performance throughout ascent based on flight pressure and temperature data. The latest revision incorporates new methods based on main engine power balance model updates to model higher mixture ratio operation at lower engine power levels.

  20. High-Power Hall Propulsion Development at NASA Glenn Research Center

    Science.gov (United States)

    Kamhawi, Hani; Manzella, David H.; Smith, Timothy D.; Schmidt, George R.

    2014-01-01

    The NASA Office of the Chief Technologist Game Changing Division is sponsoring the development and testing of enabling technologies to achieve efficient and reliable human space exploration. High-power solar electric propulsion has been proposed by NASA's Human Exploration Framework Team as an option to achieve these ambitious missions to near Earth objects. NASA Glenn Research Center (NASA Glenn) is leading the development of mission concepts for a solar electric propulsion Technical Demonstration Mission. The mission concepts are highlighted in this paper but are detailed in a companion paper. There are also multiple projects that are developing technologies to support a demonstration mission and are also extensible to NASA's goals of human space exploration. Specifically, the In-Space Propulsion technology development project at NASA Glenn has a number of tasks related to high-power Hall thrusters including performance evaluation of existing Hall thrusters; performing detailed internal discharge chamber, near-field, and far-field plasma measurements; performing detailed physics-based modeling with the NASA Jet Propulsion Laboratory's Hall2De code; performing thermal and structural modeling; and developing high-power efficient discharge modules for power processing. This paper summarizes the various technology development tasks and progress made to date

  1. AC/CRC adjacent lane surfacing : construction report.

    Science.gov (United States)

    1991-06-01

    Asphaltic Concrete (AC) and Portland Cement Concrete (PCC) are common roadway materials used in Oregon. In a recent construction project -- Poverty Flats/Mecham Section -- the Oregon State Highway Division (OSHD) designed, as part of the project, a "...

  2. An Analysis of Rocket Propulsion Testing Costs

    Science.gov (United States)

    Ramirez-Pagan, Carmen P.; Rahman, Shamim A.

    2009-01-01

    The primary mission at NASA Stennis Space Center (SSC) is rocket propulsion testing. Such testing is generally performed within two arenas: (1) Production testing for certification and acceptance, and (2) Developmental testing for prototype or experimental purposes. The customer base consists of NASA programs, DOD programs, and commercial programs. Resources in place to perform on-site testing include both civil servants and contractor personnel, hardware and software including data acquisition and control, and 6 test stands with a total of 14 test positions/cells. For several business reasons there is the need to augment understanding of the test costs for all the various types of test campaigns. Historical propulsion test data was evaluated and analyzed in many different ways with the intent to find any correlation or statistics that could help produce more reliable and accurate cost estimates and projections. The analytical efforts included timeline trends, statistical curve fitting, average cost per test, cost per test second, test cost timeline, and test cost envelopes. Further, the analytical effort includes examining the test cost from the perspective of thrust level and test article characteristics. Some of the analytical approaches did not produce evidence strong enough for further analysis. Some other analytical approaches yield promising results and are candidates for further development and focused study. Information was organized for into its elements: a Project Profile, Test Cost Timeline, and Cost Envelope. The Project Profile is a snap shot of the project life cycle on a timeline fashion, which includes various statistical analyses. The Test Cost Timeline shows the cumulative average test cost, for each project, at each month where there was test activity. The Test Cost Envelope shows a range of cost for a given number of test(s). The supporting information upon which this study was performed came from diverse sources and thus it was necessary to

  3. Recent Electric Propulsion Development Activities for NASA Science Missions

    Science.gov (United States)

    Pencil, Eric J.

    2009-01-01

    (The primary source of electric propulsion development throughout NASA is managed by the In-Space Propulsion Technology Project at the NASA Glenn Research Center for the Science Mission Directorate. The objective of the Electric Propulsion project area is to develop near-term electric propulsion technology to enhance or enable science missions while minimizing risk and cost to the end user. Major hardware tasks include developing NASA s Evolutionary Xenon Thruster (NEXT), developing a long-life High Voltage Hall Accelerator (HIVHAC), developing an advanced feed system, and developing cross-platform components. The objective of the NEXT task is to advance next generation ion propulsion technology readiness. The baseline NEXT system consists of a high-performance, 7-kW ion thruster; a high-efficiency, 7-kW power processor unit (PPU); a highly flexible advanced xenon propellant management system (PMS); a lightweight engine gimbal; and key elements of a digital control interface unit (DCIU) including software algorithms. This design approach was selected to provide future NASA science missions with the greatest value in mission performance benefit at a low total development cost. The objective of the HIVHAC task is to advance the Hall thruster technology readiness for science mission applications. The task seeks to increase specific impulse, throttle-ability and lifetime to make Hall propulsion systems applicable to deep space science missions. The primary application focus for the resulting Hall propulsion system would be cost-capped missions, such as competitively selected, Discovery-class missions. The objective of the advanced xenon feed system task is to demonstrate novel manufacturing techniques that will significantly reduce mass, volume, and footprint size of xenon feed systems over conventional feed systems. This task has focused on the development of a flow control module, which consists of a three-channel flow system based on a piezo-electrically actuated

  4. Direct Energy Conversion for Nuclear Propulsion at Low Specific Mass Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Low specific mass (< 3  kg/kW) in-space electric power and propulsion can drastically alter the paradigm for exploration of the Solar System, changing human...

  5. High Voltage Hybrid Electric Propulsion - Multilayered Functional Insulation System (MFIS) NASA-GRC

    Science.gov (United States)

    Lizcano, M.

    2017-01-01

    High power transmission cables pose a key challenge in future Hybrid Electric Propulsion Aircraft. The challenge arises in developing safe transmission lines that can withstand the unique environment found in aircraft while providing megawatts of power. High voltage AC, variable frequency cables do not currently exist and present particular electrical insulation challenges since electrical arcing and high heating are more prevalent at higher voltages and frequencies. Identifying and developing materials that maintain their dielectric properties at high voltage and frequencies is crucial.

  6. Project CHECO Southeast Asia Report. OV-1/AC-119 Hunter-Killer Team

    Science.gov (United States)

    1972-10-10

    between Phan Rang, Phu Cat , and Danang in order to provide best coverage of the Vietnamese conflict. -- On 16 February 1970, three AC -ll9Ks and 70...SOUTHEAST ASIA D D DDiv AY/XDOSQA I OV-1/ AC -119 " i IWB I HUNTER-KILLER TEAM 19’.1’ CONTINUING REPORT CLASSIFIED Ey 7AFIDOOC DOWNGRADE TjU SECRET...xamination of C urrent, 0 per’tions I~ I fF!lr T I TII TIIII I OV=1/ AC -119 HUNTER-KILLER TEAMI 1 10 OCTOBER 1972 HQ PACAF Directorate of Operations

  7. Improved SCR ac Motor Controller for Battery Powered Urban Electric Vehicles

    Science.gov (United States)

    Latos, T. S.

    1982-01-01

    An improved ac motor controller, which when coupled to a standard ac induction motor and a dc propulsion battery would provide a complete electric vehicle power train with the exception of the mechanical transmission and drive wheels was designed. In such a system, the motor controller converts the dc electrical power available at the battery terminals to ac electrical power for the induction motor in response to the drivers commands. The performance requirements of a hypothetical electric vehicle with an upper weight bound of 1590 kg (3500 lb) were used to determine the power rating of the controller. Vehicle acceleration capability, top speed, and gradeability requisites were contained in the Society of Automotive Engineers (SAE) Schedule 227a(d) driving cycle. The important capabilities contained in this driving cycle are a vehicle acceleration requirement of 0 to 72.4 kmph (0 to 45 mph) in 28 seconds a top speed of 88.5 kmph (55 mph), and the ability to negotiate a 10% grade at 48 kmph (30 mph). A 10% grade is defined as one foot of vertical rise per 10 feet of horizontal distance.

  8. Logistics Reduction: Advanced Clothing System (ACS)

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

  9. Cooling of Electric Motors Used for Propulsion on SCEPTOR

    Science.gov (United States)

    Christie, Robert J.; Dubois, Arthur; Derlaga, Joseph M.

    2017-01-01

    NASA is developing a suite of hybrid-electric propulsion technologies for aircraft. These technologies have the benefit of lower emissions, diminished noise, increased efficiency, and reduced fuel burn. These will provide lower operating costs for aircraft operators. Replacing internal combustion engines with distributed electric propulsion is a keystone of this technology suite, but presents many new problems to aircraft system designers. One of the problems is how to cool these electric motors without adding significant aerodynamic drag, cooling system weight or fan power. This paper discusses the options evaluated for cooling the motors on SCEPTOR (Scalable Convergent Electric Propulsion Technology and Operations Research): a project that will demonstrate Distributed Electric Propulsion technology in flight. Options for external and internal cooling, inlet and exhaust locations, ducting and adjustable cowling, and axial and centrifugal fans were evaluated. The final design was based on a trade between effectiveness, simplicity, robustness, mass and performance over a range of ground and flight operation environments.

  10. Propulsion Systems Panel deliberations

    Science.gov (United States)

    Bianca, Carmelo J.; Miner, Robert; Johnston, Lawrence M.; Bruce, R.; Dennies, Daniel P.; Dickenson, W.; Dreshfield, Robert; Karakulko, Walt; Mcgaw, Mike; Munafo, Paul M.

    1993-01-01

    The Propulsion Systems Panel was established because of the specialized nature of many of the materials and structures technology issues related to propulsion systems. This panel was co-chaired by Carmelo Bianca, MSFC, and Bob Miner, LeRC. Because of the diverse range of missions anticipated for the Space Transportation program, three distinct propulsion system types were identified in the workshop planning process: liquid propulsion systems, solid propulsion systems and nuclear electric/nuclear thermal propulsion systems.

  11. Propulsion of space ships by nuclear explosion

    Science.gov (United States)

    Linhart, J. G.; Kravárik, J.

    2005-01-01

    Recent progress in the research on deuterium-tritium (D-T) inertially confined microexplosions encourages one to reconsider the nuclear propulsion of spaceships based on the concept originally proposed in the Orion project. We discuss first the acceleration of medium-sized spaceships by D-T explosions whose output is in the range of 0.1 10 t of TNT. The launching of such a ship into an Earth orbit or beyond by a large nuclear explosion in an underground cavity is sketched out in the second section of the paper, and finally we consider a hypothetical Mars mission based on these concepts. In the conclusion it is argued that propulsion based on the Orion concept only is not the best method for interplanetary travel owing to the very large number of nuclear explosion required. A combination of a super gun and subsequent rocket propulsion using advanced chemical fuels appears to be the best solution for space flights of the near future.

  12. A novel propulsion method for high-Tc superconducting maglev vehicle

    International Nuclear Information System (INIS)

    Ma Guangtong; Wang Jiasu; Wang Suyu; Liu Minxian; Jing Hua; Lu Yiyun; Lin Qunxu

    2008-01-01

    High-Tc superconducting (HTS) maglev is considered as a perfect transportation type because of its unique inherent stability. A direct current (DC) linear motor using the permanent magnet guideway (PMG) as the stator and the on-board coil as the rotor instead of the present inductive or synchronous alternate current (AC) linear motor which has an economic disadvantage due to the necessity to lay primary coil along the guideway is proposed in this paper. In order to modulate the magnetic field under the PMG, an inverse E shape ferromagnetic device (IESFD) core is designed. The possible winding method for the on-board coil is listed, and the analytical result shows that a considerable net ampere force and thus the propulsion force can be generated by this special structure. The influence of the concentrated effect of the IESFD on the maglev performance of HTS bulk is studied by a numerical program, and the results show that the levitation force with the IESFD is 90% of that without. It is also indicated that the load capability and lateral performance of the maglev vehicle combined this propulsion method can be improved thanks to the attractive effect between the IESFD and PMG. The cost of the HTS maglev vehicle will be remarkably reduced and then shorten the distance to practical application with this propulsion method

  13. A novel propulsion method for high- Tc superconducting maglev vehicle

    Science.gov (United States)

    Ma, Guangtong; Wang, Jiasu; Wang, Suyu; Liu, Minxian; Jing, Hua; Lu, Yiyun; Lin, Qunxu

    2008-01-01

    High-Tc superconducting (HTS) maglev is considered as a perfect transportation type because of its unique inherent stability. A direct current (DC) linear motor using the permanent magnet guideway (PMG) as the stator and the on-board coil as the rotor instead of the present inductive or synchronous alternate current (AC) linear motor which has an economic disadvantage due to the necessity to lay primary coil along the guideway is proposed in this paper. In order to modulate the magnetic field under the PMG, an inverse E shape ferromagnetic device (IESFD) core is designed. The possible winding method for the on-board coil is listed, and the analytical result shows that a considerable net ampere force and thus the propulsion force can be generated by this special structure. The influence of the concentrated effect of the IESFD on the maglev performance of HTS bulk is studied by a numerical program, and the results show that the levitation force with the IESFD is 90% of that without. It is also indicated that the load capability and lateral performance of the maglev vehicle combined this propulsion method can be improved thanks to the attractive effect between the IESFD and PMG. The cost of the HTS maglev vehicle will be remarkably reduced and then shorten the distance to practical application with this propulsion method.

  14. Antimatter Requirements and Energy Costs for Near-Term Propulsion Applications

    Science.gov (United States)

    Schmidt, G. R.; Gerrish, H. P.; Martin, J. J.; Smith, G. A.; Meyer, K. J.

    1999-01-01

    The superior energy density of antimatter annihilation has often been pointed to as the ultimate source of energy for propulsion. However, the limited capacity and very low efficiency of present-day antiproton production methods suggest that antimatter may be too costly to consider for near-term propulsion applications. We address this issue by assessing the antimatter requirements for six different types of propulsion concepts, including two in which antiprotons are used to drive energy release from combined fission/fusion. These requirements are compared against the capacity of both the current antimatter production infrastructure and the improved capabilities that could exist within the early part of next century. Results show that although it may be impractical to consider systems that rely on antimatter as the sole source of propulsive energy, the requirements for propulsion based on antimatter-assisted fission/fusion do fall within projected near-term production capabilities. In fact, a new facility designed solely for antiproton production but based on existing technology could feasibly support interstellar precursor missions and omniplanetary spaceflight with antimatter costs ranging up to $6.4 million per mission.

  15. NASA's Vision for Potential Energy Reduction from Future Generations of Propulsion Technology

    Science.gov (United States)

    Haller, Bill

    2015-01-01

    Through a robust partnership with the aviation industry, over the past 50 years NASA programs have helped foster advances in propulsion technology that enabled substantial reductions in fuel consumption for commercial transports. Emerging global trends and continuing environmental concerns are creating challenges that will very likely transform the face of aviation over the next 20-40 years. In recognition of this development, NASA Aeronautics has established a set of Research Thrusts that will help define the future direction of the agency's research technology efforts. Two of these thrusts, Ultra-Efficient Commercial Vehicles and Transition to Low-Carbon Propulsion, serve as cornerstones for the Advanced Air Transport Technology (AATT) project. The AATT project is exploring and developing high-payoff technologies and concepts that are key to continued improvement in energy efficiency and environmental compatibility for future generations of fixed-wing, subsonic transports. The AATT project is primarily focused on the N+3 timeframe, or 3 generations from current technology levels. As should be expected, many of the propulsion system architectures technologies envisioned for N+3 vary significantly from todays engines. The use of batteries in a hybrid-electric configuration or deploying multiple fans distributed across the airframe to enable higher bypass ratios are just two examples of potential advances that could enable substantial energy reductions over current propulsion systems.

  16. Propulsion Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Propulsion Lab simulates field test conditions in a controlled environment, using standardized or customized test procedures. The Propulsion Lab's 11 cells can...

  17. Heavy Vehicle Propulsion Materials Program: Progress and Highlights

    International Nuclear Information System (INIS)

    D. Ray Johnson; Sidney Diamond

    2000-01-01

    The Heavy Vehicle Propulsion Materials Program was begun in 1997 to support the enabling materials needs of the DOE Office of Heavy Vehicle Technologies (OHVT). The technical agenda for the program grew out of the technology roadmap for the OHVT and includes efforts in materials for: fuel systems, exhaust aftertreatment, valve train, air handling, structural components, electrochemical propulsion, natural gas storage, and thermal management. A five-year program plan was written in early 2000, following a stakeholders workshop. The technical issues and planned and ongoing projects are discussed. Brief summaries of several technical highlights are given

  18. Comparison of High-Fidelity Computational Tools for Wing Design of a Distributed Electric Propulsion Aircraft

    Science.gov (United States)

    Deere, Karen A.; Viken, Sally A.; Carter, Melissa B.; Viken, Jeffrey K.; Derlaga, Joseph M.; Stoll, Alex M.

    2017-01-01

    A variety of tools, from fundamental to high order, have been used to better understand applications of distributed electric propulsion to aid the wing and propulsion system design of the Leading Edge Asynchronous Propulsion Technology (LEAPTech) project and the X-57 Maxwell airplane. Three high-fidelity, Navier-Stokes computational fluid dynamics codes used during the project with results presented here are FUN3D, STAR-CCM+, and OVERFLOW. These codes employ various turbulence models to predict fully turbulent and transitional flow. Results from these codes are compared for two distributed electric propulsion configurations: the wing tested at NASA Armstrong on the Hybrid-Electric Integrated Systems Testbed truck, and the wing designed for the X-57 Maxwell airplane. Results from these computational tools for the high-lift wing tested on the Hybrid-Electric Integrated Systems Testbed truck and the X-57 high-lift wing presented compare reasonably well. The goal of the X-57 wing and distributed electric propulsion system design achieving or exceeding the required ?? (sub L) = 3.95 for stall speed was confirmed with all of the computational codes.

  19. Multilayered Functional Insulation System (MFIS) for AC Power Transmission in High Voltage Hybrid Electrical Propulsion

    Science.gov (United States)

    Lizcano, Maricela

    2017-01-01

    High voltage hybrid electric propulsion systems are now pushing new technology development efforts for air transportation. A key challenge in hybrid electric aircraft is safe high voltage distribution and transmission of megawatts of power (>20 MW). For the past two years, a multidisciplinary materials research team at NASA Glenn Research Center has investigated the feasibility of distributing high voltage power on future hybrid electric aircraft. This presentation describes the team's approach to addressing this challenge, significant technical findings, and next steps in GRC's materials research effort for MW power distribution on aircraft.

  20. Nuclear Cryogenic Propulsion Stage Affordable Development Strategy

    Science.gov (United States)

    Doughty, Glen E.; Gerrish, H. P.; Kenny, R. J.

    2014-01-01

    The development of nuclear power for space use in nuclear thermal propulsion (NTP) systems will involve significant expenditures of funds and require major technology development efforts. The development effort must be economically viable yet sufficient to validate the systems designed. Efforts are underway within the National Aeronautics and Space Administration's (NASA) Nuclear Cryogenic Propulsion Stage Project (NCPS) to study what a viable program would entail. The study will produce an integrated schedule, cost estimate and technology development plan. This will include the evaluation of various options for test facilities, types of testing and use of the engine, components, and technology developed. A "Human Rating" approach will also be developed and factored into the schedule, budget and technology development approach.

  1. The Ion Propulsion System for the Solar Electric Propulsion Technology Demonstration Mission

    Science.gov (United States)

    Herman, Daniel A.; Santiago, Walter; Kamhawi, Hani; Polk, James E.; Snyder, John Steven; Hofer, Richard R.; Parker, J. Morgan

    2015-01-01

    The Asteroid Redirect Robotic Mission is a candidate Solar Electric Propulsion Technology Demonstration Mission whose main objectives are to develop and demonstrate a high-power solar electric propulsion capability for the Agency and return an asteroidal mass for rendezvous and characterization in a companion human-crewed mission. The ion propulsion system must be capable of operating over an 8-year time period and processing up to 10,000 kg of xenon propellant. This high-power solar electric propulsion capability, or an extensible derivative of it, has been identified as a critical part of an affordable, beyond-low-Earth-orbit, manned-exploration architecture. Under the NASA Space Technology Mission Directorate the critical electric propulsion and solar array technologies are being developed. The ion propulsion system being co-developed by the NASA Glenn Research Center and the Jet Propulsion Laboratory for the Asteroid Redirect Vehicle is based on the NASA-developed 12.5 kW Hall Effect Rocket with Magnetic Shielding (HERMeS0 thruster and power processing technologies. This paper presents the conceptual design for the ion propulsion system, the status of the NASA in-house thruster and power processing activity, and an update on flight hardware.

  2. Coordination and propulsion and non-propulsion phases in 100 meter breaststroke swimming.

    Science.gov (United States)

    Strzała, Marek; Krężałek, Piotr; Kucia-Czyszczoń, Katarzyna; Ostrowski, Andrzej; Stanula, Arkadiusz; Tyka, Anna K; Sagalara, Andrzej

    2014-01-01

    The main purpose of this study was to analyze the coordination, propulsion and non-propulsion phases in the 100 meter breaststroke race. Twenty-seven male swimmers (15.7 ± 1.98 years old) with the total body length (TBL) of 247.0 ± 10.60 [cm] performed an all-out 100 m breaststroke bout. The bouts were recorded with an underwater camera installed on a portable trolley. The swimming kinematic parameters, stroke rate (SR) and stroke length (SL), as well as the coordination indices based on propulsive or non-propulsive movement phases of the arms and legs were distinguished. Swimming speed (V100surface breast) was associated with SL (R = 0.41, p study were measured using partial correlations with controlled age. SL interplayed negatively with the limbs propulsive phase Overlap indicator (R = -0.46, p propulsion Glide indicator. The propulsion in-sweep (AP3) phase of arms and their non-propulsion partial air recovery (ARair) phase interplayed with V100surface breast (R = 0.51, p < 0.05 and 0.48 p < 0.05) respectively, displaying the importance of proper execution of this phase (AP3) and in reducing the resistance recovery phases in consecutive ones.

  3. Nuclear propulsion for orbital transfer

    International Nuclear Information System (INIS)

    Beale, G.A.; Lawrence, T.J.

    1989-01-01

    The state of the art in nuclear propulsion for orbital transfer is discussed. Cryogenic propulsion, electric propulsion, solar-thermal propulsion and direct nuclear propulsion are examined in this context. New technologies with exceptional promise are addressed, emphasizing the particle test bed nuclear engine

  4. Max Launch Abort System (MLAS) Pad Abort Test Vehicle (PATV) II Attitude Control System (ACS) Integration and Pressurization Subsystem Dynamic Random Vibration Analysis

    Science.gov (United States)

    Ekrami, Yasamin; Cook, Joseph S.

    2011-01-01

    In order to mitigate catastrophic failures on future generation space vehicles, engineers at the National Aeronautics and Space Administration have begun to integrate a novel crew abort systems that could pull a crew module away in case of an emergency at the launch pad or during ascent. The Max Launch Abort System (MLAS) is a recent test vehicle that was designed as an alternative to the baseline Orion Launch Abort System (LAS) to demonstrate the performance of a "tower-less" LAS configuration under abort conditions. The MLAS II test vehicle will execute a propulsive coast stabilization maneuver during abort to control the vehicles trajectory and thrust. To accomplish this, the spacecraft will integrate an Attitude Control System (ACS) with eight hypergolic monomethyl hydrazine liquid propulsion engines that are capable of operating in a quick pulsing mode. Two main elements of the ACS include a propellant distribution subsystem and a pressurization subsystem to regulate the flow of pressurized gas to the propellant tanks and the engines. The CAD assembly of the Attitude Control System (ACS) was configured and integrated into the Launch Abort Vehicle (LAV) design. A dynamic random vibration analysis was conducted on the Main Propulsion System (MPS) helium pressurization panels to assess the response of the panel and its components under increased gravitational acceleration loads during flight. The results indicated that the panels fundamental and natural frequencies were farther from the maximum Acceleration Spectral Density (ASD) vibrations which were in the range of 150-300 Hz. These values will direct how the components will be packaged in the vehicle to reduce the effects high gravitational loads.

  5. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  6. Propulsion for CubeSats

    Science.gov (United States)

    Lemmer, Kristina

    2017-05-01

    At present, very few CubeSats have flown in space featuring propulsion systems. Of those that have, the literature is scattered, published in a variety of formats (conference proceedings, contractor websites, technical notes, and journal articles), and often not available for public release. This paper seeks to collect the relevant publically releasable information in one location. To date, only two missions have featured propulsion systems as part of the technology demonstration. The IMPACT mission from the Aerospace Corporation launched several electrospray thrusters from Massachusetts Institute of Technology, and BricSAT-P from the United States Naval Academy had four micro-Cathode Arc Thrusters from George Washington University. Other than these two missions, propulsion on CubeSats has been used only for attitude control and reaction wheel desaturation via cold gas propulsion systems. As the desired capability of CubeSats increases, and more complex missions are planned, propulsion is required to accomplish the science and engineering objectives. This survey includes propulsion systems that have been designed specifically for the CubeSat platform and systems that fit within CubeSat constraints but were developed for other platforms. Throughout the survey, discussion of flight heritage and results of the mission are included where publicly released information and data have been made available. Major categories of propulsion systems that are in this survey are solar sails, cold gas propulsion, electric propulsion, and chemical propulsion systems. Only systems that have been tested in a laboratory or with some flight history are included.

  7. Effect of workload setting on propulsion technique in handrim wheelchair propulsion.

    Science.gov (United States)

    van Drongelen, Stefan; Arnet, Ursina; Veeger, Dirkjan H E J; van der Woude, Lucas H V

    2013-03-01

    To investigate the influence of workload setting (speed at constant power, method to impose power) on the propulsion technique (i.e. force and timing characteristics) in handrim wheelchair propulsion. Twelve able-bodied men participated in this study. External forces were measured during handrim wheelchair propulsion on a motor driven treadmill at different velocities and constant power output (to test the forced effect of speed) and at power outputs imposed by incline vs. pulley system (to test the effect of method to impose power). Outcome measures were the force and timing variables of the propulsion technique. FEF and timing variables showed significant differences between the speed conditions when propelling at the same power output (p propulsion technique parameters despite an overall constant power output. Copyright © 2012 IPEM. Published by Elsevier Ltd. All rights reserved.

  8. Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

    Science.gov (United States)

    Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

    One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

  9. Economic effects of propulsion system technology on existing and future transport aircraft

    Science.gov (United States)

    Sallee, G. P.

    1974-01-01

    The results of an airline study of the economic effects of propulsion system technology on current and future transport aircraft are presented. This report represents the results of a detailed study of propulsion system operating economics. The study has four major parts: (1) a detailed analysis of current propulsion system maintenance with respect to the material and labor costs encountered versus years in service and the design characteristics of the major elements of the propulsion system of the B707, b727, and B747. (2) an analysis of the economic impact of a future representative 1979 propulsion system is presented with emphasis on depreciation of investment, fuel costs and maintenance costs developed on the basis of the analysis of the historical trends observed. (3) recommendations concerning improved methods of forecasting the maintenance cost of future propulsion systems are presented. A detailed method based on the summation of the projected labor and material repair costs for each major engine module and its installation along with a shorter form suitable for quick, less detailed analysis are presented, and (4) recommendations concerning areas where additional technology is needed to improve the economics of future commercial propulsion systems are presented along with the suggested economic benefits available from such advanced technology efforts.

  10. Centralized versus distributed propulsion

    Science.gov (United States)

    Clark, J. P.

    1982-01-01

    The functions and requirements of auxiliary propulsion systems are reviewed. None of the three major tasks (attitude control, stationkeeping, and shape control) can be performed by a collection of thrusters at a single central location. If a centralized system is defined as a collection of separated clusters, made up of the minimum number of propulsion units, then such a system can provide attitude control and stationkeeping for most vehicles. A distributed propulsion system is characterized by more numerous propulsion units in a regularly distributed arrangement. Various proposed large space systems are reviewed and it is concluded that centralized auxiliary propulsion is best suited to vehicles with a relatively rigid core. These vehicles may carry a number of flexible or movable appendages. A second group, consisting of one or more large flexible flat plates, may need distributed propulsion for shape control. There is a third group, consisting of vehicles built up from multiple shuttle launches, which may be forced into a distributed system because of the need to add additional propulsion units as the vehicles grow. The effects of distributed propulsion on a beam-like structure were examined. The deflection of the structure under both translational and rotational thrusts is shown as a function of the number of equally spaced thrusters. When two thrusters only are used it is shown that location is an important parameter. The possibility of using distributed propulsion to achieve minimum overall system weight is also examined. Finally, an examination of the active damping by distributed propulsion is described.

  11. Power processing for electric propulsion

    Science.gov (United States)

    Finke, R. C.; Herron, B. G.; Gant, G. D.

    1975-01-01

    The potential of achieving up to 30 per cent more spacecraft payload or 50 per cent more useful operating life by the use of electric propulsion in place of conventional cold gas or hydrazine systems in science, communications, and earth applications spacecraft is a compelling reason to consider the inclusion of electric thruster systems in new spacecraft design. The propulsion requirements of such spacecraft dictate a wide range of thruster power levels and operational lifetimes, which must be matched by lightweight, efficient, and reliable thruster power processing systems. This paper will present electron bombardment ion thruster requirements; review the performance characteristics of present power processing systems; discuss design philosophies and alternatives in areas such as inverter type, arc protection, and control methods; and project future performance potentials for meeting goals in the areas of power processor weight (10 kg/kW), efficiency (approaching 92 per cent), reliability (0.96 for 15,000 hr), and thermal control capability (0.3 to 5 AU).

  12. Propulsion System Dynamic Modeling for the NASA Supersonic Concept Vehicle: AeroPropulsoServoElasticity

    Science.gov (United States)

    Kopasakis, George; Connolly, Joseph; Seidel, Jonathan

    2014-01-01

    A summary of the propulsion system modeling under NASA's High Speed Project (HSP) AeroPropulsoServoElasticity (APSE) task is provided with a focus on the propulsion system for the low-boom supersonic configuration developed by Lockheed Martin and referred to as the N+2 configuration. This summary includes details on the effort to date to develop computational models for the various propulsion system components. The objective of this paper is to summarize the model development effort in this task, while providing more detail in the modeling areas that have not been previously published. The purpose of the propulsion system modeling and the overall APSE effort is to develop an integrated dynamic vehicle model to conduct appropriate unsteady analysis of supersonic vehicle performance. This integrated APSE system model concept includes the propulsion system model, and the vehicle structural-aerodynamics model. The development to date of such a preliminary integrated model will also be summarized in this report.propulsion system dynamics, the structural dynamics, and aerodynamics.

  13. Manual wheelchair propulsion patterns on natural surfaces during start-up propulsion.

    Science.gov (United States)

    Koontz, Alicia M; Roche, Bailey M; Collinger, Jennifer L; Cooper, Rory A; Boninger, Michael L

    2009-11-01

    To classify propulsion patterns over surfaces encountered in the natural environment during start-up and compare selected biomechanical variables between pattern types. Case series. National Veterans Wheelchair Games, Minneapolis, MN, 2005. Manual wheelchair users (N=29). Subjects pushed their wheelchairs from a resting position over high-pile carpet, over linoleum, and up a ramp with a 5 degrees incline while propulsion kinematics and kinetics were recorded with a motion capture system and an instrumented wheel. Three raters classified the first 3 strokes as 1 of 4 types on each surface: arc, semicircular (SC), single looping over propulsion (SL), and double looping over propulsion (DL). The Fisher exact test was used to assess pattern changes between strokes and surface type. A multiple analysis of variance test was used to compare peak and average resultant force and moment about the hub, average wheel velocity, stroke frequency, contact angle, and distance traveled between stroke patterns. SL was the most common pattern used during start-up propulsion (44.9%), followed by arc (35.9%), DL (14.1%), and SC (5.1%). Subjects who dropped their hands below the rim during recovery achieved faster velocities and covered greater distances (.016propulsion patterns is a difficult task that should use multiple raters. In addition, propulsion patterns change during start-up, with an arc pattern most prevalent initially. The biomechanical findings in this study agree with current clinical guidelines that recommend training users to drop the hand below the pushrim during recovery.

  14. The Potential for Ambient Plasma Wave Propulsion

    Science.gov (United States)

    Gilland, James H.; Williams, George J.

    2016-01-01

    A truly robust space exploration program will need to make use of in-situ resources as much as possible to make the endeavor affordable. Most space propulsion concepts are saddled with one fundamental burden; the propellant needed to produce momentum. The most advanced propulsion systems currently in use utilize electric and/or magnetic fields to accelerate ionized propellant. However, significant planetary exploration missions in the coming decades, such as the now canceled Jupiter Icy Moons Orbiter, are restricted by propellant mass and propulsion system lifetimes, using even the most optimistic projections of performance. These electric propulsion vehicles are inherently limited in flexibility at their final destination, due to propulsion system wear, propellant requirements, and the relatively low acceleration of the vehicle. A few concepts are able to utilize the environment around them to produce thrust: Solar or magnetic sails and, with certain restrictions, electrodynamic tethers. These concepts focus primarily on using the solar wind or ambient magnetic fields to generate thrust. Technically immature, quasi-propellantless alternatives lack either the sensitivity or the power to provide significant maneuvering. An additional resource to be considered is the ambient plasma and magnetic fields in solar and planetary magnetospheres. These environments, such as those around the Sun or Jupiter, have been shown to host a variety of plasma waves. Plasma wave propulsion takes advantage of an observed astrophysical and terrestrial phenomenon: Alfven waves. These are waves that propagate in the plasma and magnetic fields around and between planets and stars. The generation of Alfven waves in ambient magnetic and plasma fields to generate thrust is proposed as a truly propellantless propulsion system which may enable an entirely new matrix of exploration missions. Alfven waves are well known, transverse electromagnetic waves that propagate in magnetized plasmas at

  15. SNS AC Power Distribution and Reliability of AC Power Supply

    CERN Document Server

    Holik, Paul S

    2005-01-01

    The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*

  16. The SMPR for the naval propulsion; Les RPMP pour la propulsion navale

    Energy Technology Data Exchange (ETDEWEB)

    Gauducheau, B. [Technicatome, Centre d' Etudes Nucleaires de Saclay, 91 - Gif sur Yvette (France)

    2002-07-01

    The first controlled application of the fissile energy was the american nuclear reactor for the ship propulsion. Since the sixties, the France begun researches to secure the independence of its nuclear propulsion program. The historical aspects, the french program management and the perspectives of the ship nuclear propulsion, are discussed in this paper. (A.L.B.)

  17. Carbon Nanotube Based Electric Propulsion Thruster with Low Power Consumption, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — This SBIR project is to develop field emission electric propulsion (FEEP) thruster using carbon nanotubes (CNT) integrated anode. FEEP thrusters have gained...

  18. Cost effective second generation AC-modules: Development and testing aspects

    International Nuclear Information System (INIS)

    Islam, Saiful; Woyte, Achim; Belmans, Ronnie; Heskes, Peter; Rooij, P.M.; Hogedoorn, Ron

    2006-01-01

    In the framework of the European research project PV2GO, a new AC-module inverter was developed, taking into account all relevant aspects from a European market's point of view (standards, market, application, and research and development goals). The project goal was to achieve the overall system costs of 3 Euro per Wp for a modular plug-and-play photovoltaic system. For the photovoltaic-module, a standard 130-Wp Eurosolare module was chosen. The research and development (R and D) goal was to develop an advanced DC-control system consisting of a state-of-the-art programmable digital device and an Application Specific Integrated Circuit (ASIC) for the AC-control of the inverter. According to the topology concept, thermal and magnetic designs were optimized with regard to production technology and packaging for large-scale production. The new AC-modules were tested in a number of field-test sites in various parts of Europe and their reliability was assessed through Highly Accelerated Stress Tests. Efficiency and power quality have been tested in the laboratory. Further in the PV2GO project an optimization study of the manufacturing process of the new generation of AC-modules for high volume output was done. Another task was the pre-certification procedure to assure compliance with the European guidelines and standards

  19. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...

  20. The USAF Electric Propulsion Program

    National Research Council Canada - National Science Library

    Spores, Ronald

    1999-01-01

    ...: Propulsion Directorate and Air Force Office of Scientific Research (AFOSR). The Propulsion Directorate conducts electric propulsion efforts in basic research, engineering development, and space experiments...

  1. Advanced Propulsion Study

    National Research Council Canada - National Science Library

    Davis, Eric

    2004-01-01

    ... that show promise of leading to a major advance in Earth-to-orbit (ETO) propulsion. The study also reviewed and evaluated a select number of credible far-term breakthrough propulsion physics concepts pertaining...

  2. NASA's Propulsion Research Laboratory

    Science.gov (United States)

    2004-01-01

    The grand opening of NASA's new, world-class laboratory for research into future space transportation technologies located at the Marshall Space Flight Center (MSFC) in Huntsville, Alabama, took place in July 2004. The state-of-the-art Propulsion Research Laboratory (PRL) serves as a leading national resource for advanced space propulsion research. Its purpose is to conduct research that will lead to the creation and development of innovative propulsion technologies for space exploration. The facility is the epicenter of the effort to move the U.S. space program beyond the confines of conventional chemical propulsion into an era of greatly improved access to space and rapid transit throughout the solar system. The laboratory is designed to accommodate researchers from across the United States, including scientists and engineers from NASA, the Department of Defense, the Department of Energy, universities, and industry. The facility, with 66,000 square feet of useable laboratory space, features a high degree of experimental capability. Its flexibility allows it to address a broad range of propulsion technologies and concepts, such as plasma, electromagnetic, thermodynamic, and propellant propulsion. An important area of emphasis is the development and utilization of advanced energy sources, including highly energetic chemical reactions, solar energy, and processes based on fission, fusion, and antimatter. The Propulsion Research Laboratory is vital for developing the advanced propulsion technologies needed to open up the space frontier, and sets the stage of research that could revolutionize space transportation for a broad range of applications.

  3. Identifying Accessible Near-Earth Objects For Crewed Missions With Solar Electric Propulsion

    Science.gov (United States)

    Smet, Stijn De; Parker, Jeffrey S.; Herman, Jonathan F. C.; Aziz, Jonathan; Barbee, Brent W.; Englander, Jacob A.

    2015-01-01

    This paper discusses the expansion of the Near-Earth Object Human Space Flight Accessible Targets Study (NHATS) with Solar Electric Propulsion (SEP). The research investigates the existence of new launch seasons that would have been impossible to achieve using only chemical propulsion. Furthermore, this paper shows that SEP can be used to significantly reduce the launch mass and in some cases the flight time of potential missions as compared to the current, purely chemical trajectories identified by the NHATS project.

  4. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  5. Comparison of Aero-Propulsive Performance Predictions for Distributed Propulsion Configurations

    Science.gov (United States)

    Borer, Nicholas K.; Derlaga, Joseph M.; Deere, Karen A.; Carter, Melissa B.; Viken, Sally A.; Patterson, Michael D.; Litherland, Brandon L.; Stoll, Alex M.

    2017-01-01

    NASA's X-57 "Maxwell" flight demonstrator incorporates distributed electric propulsion technologies in a design that will achieve a significant reduction in energy used in cruise flight. A substantial portion of these energy savings come from beneficial aerodynamic-propulsion interaction. Previous research has shown the benefits of particular instantiations of distributed propulsion, such as the use of wingtip-mounted cruise propellers and leading edge high-lift propellers. However, these benefits have not been reduced to a generalized design or analysis approach suitable for large-scale design exploration. This paper discusses the rapid, "design-order" toolchains developed to investigate the large, complex tradespace of candidate geometries for the X-57. Due to the lack of an appropriate, rigorous set of validation data, the results of these tools were compared to three different computational flow solvers for selected wing and propulsion geometries. The comparisons were conducted using a common input geometry, but otherwise different input grids and, when appropriate, different flow assumptions to bound the comparisons. The results of these studies showed that the X-57 distributed propulsion wing should be able to meet the as-designed performance in cruise flight, while also meeting or exceeding targets for high-lift generation in low-speed flight.

  6. Application of Recommended Design Practices for Conceptual Nuclear Fusion Space Propulsion Systems

    Science.gov (United States)

    Williams, Craig H.

    2004-01-01

    An AIAA Special Project Report was recently produced by AIAA's Nuclear and Future Flight Propulsion Technical Committee and is currently in peer review. The Report provides recommended design practices for conceptual engineering studies of nuclear fusion space propulsion systems. Discussion and recommendations are made on key topics including design reference missions, degree of technological extrapolation and concomitant risk, thoroughness in calculating mass properties (nominal mass properties, weight-growth contingency and propellant margins, and specific impulse), and thoroughness in calculating power generation and usage (power-flow, power contingencies, specific power). The report represents a general consensus of the nuclear fusion space propulsion system conceptual design community and proposes 15 recommendations. This paper expands on the Report by providing specific examples illustrating how to apply each of the recommendations.

  7. In-Space Propulsion Technology Products for NASA's Future Science and Exploration Missions

    Science.gov (United States)

    Anderson, David J.; Pencil, Eric; Peterson, Todd; Dankanich, John; Munk, Michelle M.

    2011-01-01

    Since 2001, the In-Space Propulsion Technology (ISPT) project has been developing and delivering in-space propulsion technologies that will enable or enhance NASA robotic science missions. These in-space propulsion technologies are applicable, and potentially enabling, for future NASA flagship and sample return missions currently being considered, as well as having broad applicability to future competed mission solicitations. The high-temperature Advanced Material Bipropellant Rocket (AMBR) engine providing higher performance for lower cost was completed in 2009. Two other ISPT technologies are nearing completion of their technology development phase: 1) NASA's Evolutionary Xenon Thruster (NEXT) ion propulsion system, a 0.6-7 kW throttle-able gridded ion system; and 2) Aerocapture technology development with investments in a family of thermal protection system (TPS) materials and structures; guidance, navigation, and control (GN&C) models of blunt-body rigid aeroshells; aerothermal effect models: and atmospheric models for Earth, Titan, Mars and Venus. This paper provides status of the technology development, applicability, and availability of in-space propulsion technologies that have recently completed their technology development and will be ready for infusion into NASA s Discovery, New Frontiers, Science Mission Directorate (SMD) Flagship, and Exploration technology demonstration missions

  8. A motor learning approach to training wheelchair propulsion biomechanics for new manual wheelchair users: A pilot study.

    Science.gov (United States)

    Morgan, Kerri A; Tucker, Susan M; Klaesner, Joseph W; Engsberg, Jack R

    2017-05-01

    Developing an evidence-based approach to teaching wheelchair skills and proper propulsion for everyday wheelchair users with a spinal cord injury (SCI) is important to their rehabilitation. The purpose of this project was to pilot test manual wheelchair training based on motor learning and repetition-based approaches for new manual wheelchair users with an SCI. A repeated measures within-subject design was used with participants acting as their own controls. Six persons with an SCI requiring the use of a manual wheelchair participated in wheelchair training. The training included nine 90-minute sessions. The primary focus was on wheelchair propulsion biomechanics with a secondary focus on wheelchair skills. During Pretest 1, Pretest 2, and Posttest, wheelchair propulsion biomechanics were measured using the Wheelchair Propulsion Test and a Video Motion Capture system. During Pretest 2 and Posttest, propulsion forces using the WheelMill System and wheelchair skills using the Wheelchair Skills Test were measured. Significant changes in area of the push loop, hand-to-axle relationship, and slope of push forces were found. Changes in propulsion patterns were identified post-training. No significant differences were found in peak and average push forces and wheelchair skills pre- and post-training. This project identified trends in change related to a repetition-based motor learning approach for propelling a manual wheelchair. The changes found were related to the propulsion patterns used by participants. Despite some challenges associated with implementing interventions for new manual wheelchair users, such as recruitment, the results of this study show that repetition-based training can improve biomechanics and propulsion patterns for new manual wheelchair users.

  9. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  10. AC Initiation System.

    Science.gov (United States)

    An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

  11. Brief review on pulse laser propulsion

    Science.gov (United States)

    Yu, Haichao; Li, Hanyang; Wang, Yan; Cui, Lugui; Liu, Shuangqiang; Yang, Jun

    2018-03-01

    Pulse laser propulsion (PLP) is an advanced propulsion concept can be used across a variety of fields with a wide range of applications. PLP reflects superior payload as well as decreased launch costs in comparison with other conventional methods of producing thrust, such as chemical propulsion or electric propulsion. Numerous researchers have attempted to exploit the potential applications of PLP. This paper first reviews concepts relevant to PLP, including the propulsion modes, breakdown regimes, and propulsion efficiency; the propulsion targets for different materials with the pulse laser are then discussed in detail, including the propulsion of solid and liquid microspheres. PLP applications such as the driven microsatellite, target surface particle removal, and orbital debris removal are also discussed. Although the PLP has been applied to a variety of fields, further research is yet warranted to establish its application in the aerospace field.

  12. NASA Electric Propulsion System Studies

    Science.gov (United States)

    Felder, James L.

    2015-01-01

    An overview of NASA efforts in the area of hybrid electric and turboelectric propulsion in large transport. This overview includes a list of reasons why we are looking at transmitting some or all of the propulsive power for the aircraft electrically, a list of the different types of hybrid-turbo electric propulsion systems, and the results of 4 aircraft studies that examined different types of hybrid-turbo electric propulsion systems.

  13. Nuclear-microwave-electric propulsion

    International Nuclear Information System (INIS)

    Nordley, G.D.; Brown, W.C.

    1986-01-01

    Electric propulsion can move more mass through space than chemical propulsion by virtue of the higher exhaust velocities achieved by electric propulsion devices. This performance is achieved at the expense of very heavy power sources or very long trip times, which in turn create technical and economic penalties of varying severity. These penalties include: higher operations costs, delayed availability of the payload, and increased exposure to Van Allen Belt radiation. It is proposed to reduce these penalties by physically separating the power source from the propulsion and use microwave energy beaming technology, recently explored and partially developed/tested for Solar Power Satellite concept studies, as an extension cord. This paper summarizes the state of the art of the technology needed for space based beam microwave power cost/performance trades involved with the use beamed microwave/electric propulsion for some typical orbit transfer missions and offers some suggestions for additional work

  14. Optimum cycle frequencies in hand-rim wheelchair propulsion. Wheelchair propulsion technique

    NARCIS (Netherlands)

    van der Woude, L H; Veeger, DirkJan (H. E. J.); Rozendal, R H; Sargeant, A J

    1989-01-01

    To study the effect of different cycle frequencies on cardio-respiratory responses and propulsion technique in hand-rim wheelchair propulsion, experienced wheelchair sportsmen (WS group; n = 6) and non-wheelchair users (NW group; n = 6) performed wheelchair exercise tests on a motor-driven

  15. Effect of workload setting on propulsion technique in handrim wheelchair propulsion

    NARCIS (Netherlands)

    van Drongelen, Stefan; Arnet, Ursina; Veeger, DirkJan (H E. J); van der Woude, Lucas H. V.

    Objective: To investigate the influence of workload setting (speed at constant power, method to impose power) on the propulsion technique (i.e. force and timing characteristics) in handrim wheelchair propulsion. Method: Twelve able-bodied men participated in this study. External forces were measured

  16. Information report presented in application of article 145 of the regulation by the commission of national defense and armed forces about the propulsion system of the second aircraft carrier; Rapport d'information depose en application de l'article 145 du reglement par la commission de la defense nationale et des forces armees sur le mode de propulsion du second porte-avions

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-11-01

    In the framework of the project of launching of a sister-ship to the Charles de Gaulle aircraft carrier, this report makes an objective analysis of the different possible propulsion systems that can be considered for this battle ship according to different criteria: 1 - two possible energy sources and four possible configurations of aircraft carrier considered: alternative between nuclear propulsion and conventional propulsion, the two nuclear ships eventualities, the hypothesis of an entirely French-made classical propulsion ship, the opportunity of a French-British cooperation for a conventional aircraft carrier project; 2 - decision criteria: operational need, cost, industrial and technological stakes, constraints linked with daily ship and crew life; 3 - propulsion systems alternative: conventional propulsion and reinforcement of the European defense policy, nuclear propulsion for an operational superiority and for a complementarity with the Charles de Gaulle. (J.S.)

  17. Nuclear propulsion systems engineering

    International Nuclear Information System (INIS)

    Madsen, W.W.; Neuman, J.E.: Van Haaften, D.H.

    1992-01-01

    The Nuclear Energy for Rocket Vehicle Application (NERVA) program of the 1960's and early 1970's was dramatically successful, with no major failures during the entire testing program. This success was due in large part to the successful development of a systems engineering process. Systems engineering, properly implemented, involves all aspects of the system design and operation, and leads to optimization of theentire system: cost, schedule, performance, safety, reliability, function, requirements, etc. The process must be incorporated from the very first and continued to project completion. This paper will discuss major aspects of the NERVA systems engineering effort, and consider the implications for current nuclear propulsion efforts

  18. Laser Propulsion - Quo Vadis

    International Nuclear Information System (INIS)

    Bohn, Willy L.

    2008-01-01

    First, an introductory overview of the different types of laser propulsion techniques will be given and illustrated by some historical examples. Second, laser devices available for basic experiments will be reviewed ranging from low power lasers sources to inertial confinement laser facilities. Subsequently, a status of work will show the impasse in which the laser propulsion community is currently engaged. Revisiting the basic relations leads to new avenues in ablative and direct laser propulsion for ground based and space based applications. Hereby, special attention will be devoted to the impact of emerging ultra-short pulse lasers on the coupling coefficient and specific impulse. In particular, laser sources and laser propulsion techniques will be tested in microgravity environment. A novel approach to debris removal will be discussed with respect to the Satellite Laser Ranging (SRL) facilities. Finally, some non technical issues will be raised aimed at the future prospects of laser propulsion in the international community

  19. Critical Propulsion Components. Volume 1; Summary, Introduction, and Propulsion Systems Studies

    Science.gov (United States)

    2005-01-01

    Several studies have concluded that a supersonic aircraft, if environmentally acceptable and economically viable, could successfully compete in the 21st century marketplace. However, before industry can commit to what is estimated as a 15 to 20 billion dollar investment, several barrier issues must be resolved. In an effort to address these barrier issues, NASA and Industry teamed to form the High-Speed Research (HSR) program. As part of this program, the Critical Propulsion Components (CPC) element was created and assigned the task of developing those propulsion component technologies necessary to: (1) reduce cruise emissions by a factor of 10 and (2) meet the ever-increasing airport noise restrictions with an economically viable propulsion system. The CPC-identified critical components were ultra-low emission combustors, low-noise/high-performance exhaust nozzles, low-noise fans, and stable/high-performance inlets. Propulsion cycle studies (coordinated with NASA Langley Research Center sponsored airplane studies) were conducted throughout this CPC program to help evaluate candidate components and select the best concepts for the more complex and larger scale research efforts. The propulsion cycle and components ultimately selected were a mixed-flow turbofan (MFTF) engine employing a lean, premixed, prevaporized (LPP) combustor coupled to a two-dimensional mixed compression inlet and a two-dimensional mixer/ejector nozzle. Due to the large amount of material presented in this report, it was prepared in four volumes; Volume 1: Summary, Introduction, and Propulsion System Studies, Volume 2: Combustor, Volume 3: Exhaust Nozzle, and Volume 4: Inlet and Fan/ Inlet Acoustic Team.

  20. Propulsion System Dynamic Modeling of the NASA Supersonic Concept Vehicle for AeroPropulsoServoElasticity

    Science.gov (United States)

    Kopasakis, George; Connolly, Joseph W.; Seiel, Jonathan

    2016-01-01

    A summary of the propulsion system modeling under NASA's High Speed Project (HSP) AeroPropulsoServoElasticity (APSE) task is provided with a focus on the propulsion system for the low-boom supersonic configuration developed by Lockheed Martin and referred to as the N+2 configuration. This summary includes details on the effort to date to develop computational models for the various propulsion system components. The objective of this paper is to summarize the model development effort in this task, while providing more detail in the modeling areas that have not been previously published. The purpose of the propulsion system modeling and the overall APSE effort is to develop an integrated dynamic vehicle model to conduct appropriate unsteady analysis of supersonic vehicle performance. This integrated APSE system model concept includes the propulsion system model, and the vehicle structural aerodynamics model. The development to date of such a preliminary integrated model will also be summarized in this report

  1. Study on ac losses of HTS coil carrying ac transport current

    International Nuclear Information System (INIS)

    Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

    2005-01-01

    Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

  2. Electric vehicle propulsion alternatives

    Science.gov (United States)

    Secunde, R. R.; Schuh, R. M.; Beach, R. F.

    1983-01-01

    Propulsion technology development for electric vehicles is summarized. Analytical studies, technology evaluation, and the development of technology for motors, controllers, transmissions, and complete propulsion systems are included.

  3. Fuel Effective Photonic Propulsion

    Science.gov (United States)

    Rajalakshmi, N.; Srivarshini, S.

    2017-09-01

    With the entry of miniaturization in electronics and ultra-small light-weight materials, energy efficient propulsion techniques for space travel can soon be possible. We need to go for such high speeds so that the generation’s time long interstellar missions can be done in incredibly short time. Also renewable energy like sunlight, nuclear energy can be used for propulsion instead of fuel. These propulsion techniques are being worked on currently. The recently proposed photon propulsion concepts are reviewed, that utilize momentum of photons generated by sunlight or onboard photon generators, such as blackbody radiation or lasers, powered by nuclear or solar power. With the understanding of nuclear photonic propulsion, in this paper, a rough estimate of nuclear fuel required to achieve the escape velocity of Earth is done. An overview of the IKAROS space mission for interplanetary travel by JAXA, that was successful in demonstrating that photonic propulsion works and also generated additional solar power on board, is provided; which can be used as a case study. An extension of this idea for interstellar travel, termed as ‘Star Shot’, aims to send a nanocraft to an exoplanet in the nearest star system, which could be potentially habitable. A brief overview of the idea is presented.

  4. Multi-phase AC/AC step-down converter for distribution systems

    Science.gov (United States)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  5. Modeling of Ship Propulsion Performance

    DEFF Research Database (Denmark)

    Pedersen, Benjamin Pjedsted; Larsen, Jan

    2009-01-01

    Full scale measurements of the propulsion power, ship speed, wind speed and direction, sea and air temperature, from four different loading conditions has been used to train a neural network for prediction of propulsion power. The network was able to predict the propulsion power with accuracy...

  6. A High-power Electric Propulsion Test Platform in Space

    Science.gov (United States)

    Petro, Andrew J.; Reed, Brian; Chavers, D. Greg; Sarmiento, Charles; Cenci, Susanna; Lemmons, Neil

    2005-01-01

    This paper will describe the results of the preliminary phase of a NASA design study for a facility to test high-power electric propulsion systems in space. The results of this design study are intended to provide a firm foundation for subsequent detailed design and development activities leading to the deployment of a valuable space facility. The NASA Exploration Systems Mission Directorate is sponsoring this design project. A team from the NASA Johnson Space Center, Glenn Research Center, the Marshall Space Flight Center and the International Space Station Program Office is conducting the project. The test facility is intended for a broad range of users including government, industry and universities. International participation is encouraged. The objectives for human and robotic exploration of space can be accomplished affordably, safely and effectively with high-power electric propulsion systems. But, as thruster power levels rise to the hundreds of kilowatts and up to megawatts, their testing will pose stringent and expensive demands on existing Earth-based vacuum facilities. These considerations and the human access to near-Earth space provided by the International Space Station (ISS) have led to a renewed interest in space testing. The ISS could provide an excellent platform for a space-based test facility with the continuous vacuum conditions of the natural space environment and no chamber walls to modify the open boundary conditions of the propulsion system exhaust. The test platform could take advantage of the continuous vacuum conditions of the natural space environment. Space testing would provide open boundary conditions without walls, micro-gravity and a realistic thermal environment. Testing on the ISS would allow for direct observation of the test unit, exhaust plume and space-plasma interactions. When necessary, intervention by on-board personnel and post-test inspection would be possible. The ISS can provide electrical power, a location for

  7. The Use of AC-DC-AC Methods in Assessing Corrosion Resistance Performance of Coating Systems for Magnesium Alloys

    Science.gov (United States)

    McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante

    The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.

  8. Advanced supersonic propulsion study, phase 4

    Science.gov (United States)

    Howlett, R. A.

    1977-01-01

    Installation characteristics for a Variable Stream Control Engine (VSCE) were studied for three advanced supersonic airplane designs. Sensitivity of the VSCE concept to change in technology projections was evaluated in terms of impact on overall installed performance. Based on these sensitivity results, critical technology requirements were reviewed, resulting in the reaffirmation of the following requirements: low-noise nozzle system; a high performance, low emissions duct burner and main burner; hot section technology; variable geometry components; and propulsion integration features, including an integrated electronic control system.

  9. Wheelchairs propulsion analysis: review

    Directory of Open Access Journals (Sweden)

    Yoshimasa Sagawa Júnior

    Full Text Available OBJECTIVES: To analyze aspects related with wheelchair propulsion. MATERIALS AND METHODS: In order to delineate this review the search for information was carried out within electronics databases, using the following descriptors: "wheelchair propulsion", "wheelchair biomechanics" e "wheelchair users". Full papers published in English and French were included in the study. RESULTS: The wheelchair propulsion is a complex movement that requires the execution of repeated bi manual forces applications during a short time period. In this movement high levels of force must be produced due to the bad mechanical performance of the wheelchair. Could be characterized that wheelchair users are not satisfied with their wheelchair, the places are not adapted to their presence and lack of specific criteria for the adjustment of this equipment. The main points to look at are the seat height in relation to elbow flexion (100-120 degrees with his hand in the propulsion rim and tire pressure. The semicircular mode of technique propulsion seems to be more appropriate; in this pattern the wheelchair user returns his hand under the rim after propulsion. Efforts in wheelchairs are high and the incidence of injuries in wheelchair users is high. CONCLUSION: One can conclude that in spite of researchers’ efforts there are still many divergences between topics and methods of evaluation, what makes difficult to apply the experimental results to the wheelchairs users’ daily life.

  10. Ion Beam Propulsion Study

    Science.gov (United States)

    2008-01-01

    The Ion Beam Propulsion Study was a joint high-level study between the Applied Physics Laboratory operated by NASA and ASRC Aerospace at Kennedy Space Center, Florida, and Berkeley Scientific, Berkeley, California. The results were promising and suggested that work should continue if future funding becomes available. The application of ion thrusters for spacecraft propulsion is limited to quite modest ion sources with similarly modest ion beam parameters because of the mass penalty associated with the ion source and its power supply system. Also, the ion source technology has not been able to provide very high-power ion beams. Small ion beam propulsion systems were used with considerable success. Ion propulsion systems brought into practice use an onboard ion source to form an energetic ion beam, typically Xe+ ions, as the propellant. Such systems were used for steering and correction of telecommunication satellites and as the main thruster for the Deep Space 1 demonstration mission. In recent years, "giant" ion sources were developed for the controlled-fusion research effort worldwide, with beam parameters many orders of magnitude greater than the tiny ones of conventional space thruster application. The advent of such huge ion beam sources and the need for advanced propulsion systems for exploration of the solar system suggest a fresh look at ion beam propulsion, now with the giant fusion sources in mind.

  11. Project Dragonfly: A feasibility study of interstellar travel using laser-powered light sail propulsion

    Science.gov (United States)

    Perakis, Nikolaos; Schrenk, Lukas E.; Gutsmiedl, Johannes; Koop, Artur; Losekamm, Martin J.

    2016-12-01

    Light sail-based propulsion systems are a candidate technology for interplanetary and interstellar missions due to their flexibility and the fact that no fuel has to be carried along. In 2014, the Initiative for Interstellar Studies (i4is) hosted the Project Dragonfly Design Competition, which aimed at assessing the feasibility of sending an interstellar probe propelled by a laser-powered light sail to another star system. We analyzed and designed a mission to the Alpha Centauri system, with the objective to carry out science operations at the destination. Based on a comprehensive evaluation of currently available technologies and possible locations, we selected a lunar architecture for the laser system. It combines the advantages of surface- and space-based systems, as it requires no station keeping and suffers no atmospheric losses. We chose a graphene-based sandwich material for the light sail because of its low density. Deceleration of the spacecraft sufficient for science operations at the target system is achieved using both magnetic and electric sails. Applying these assumptions in a simulation leads to the conclusion that 250 kg of scientific payload can be sent to Alpha Centauri within the Project Dragonfly Design Competition's constraints of 100 year travel duration and 100 GW laser beam power. This is only sufficient to fulfill parts of the identified scientific objectives, and therefore renders the usefulness of such a mission questionable. A better sail material or higher laser power would improve the acceleration behavior, an increase in the mission time would allow for larger spacecraft masses.

  12. An Overview of In-Space Propulsion and Cryogenics Fluids Management Efforts for 2014 SBIR Phases I and II

    Science.gov (United States)

    Nguyen, Hung D.; Steele, Gynelle C.

    2016-01-01

    NASA's Small Business Innovation Research (SBIR) program focuses on technological innovation by investing in the development of innovative concepts and technologies to help NASA's mission directorates address critical research and development needs for Agency programs. This report highlights 11 of the innovative SBIR 2014 Phase I and II projects from 2010 to 2012 that focus on one of NASA Glenn Research Center's six core competencies-In-Space Propulsion and Cryogenic Fluids Management. The technologies cover a wide spectrum of applications such as divergent field annular ion engines, miniature nontoxic nitrous oxide-propane propulsion, noncatalytic ignition systems for high-performance advanced monopropellant thrusters, nontoxic storable liquid propulsion, and superconducting electric boost pumps for nuclear thermal propulsion. Each article describes an innovation and technical objective and highlights NASA commercial and industrial applications. This report provides an opportunity for NASA engineers, researchers, and program managers to learn how NASA SBIR technologies could help their programs and projects, and lead to collaborations and partnerships between the small SBIR companies and NASA that would benefit both.

  13. Alternative propulsion for automobiles

    CERN Document Server

    Stan, Cornel

    2017-01-01

    The book presents – based on the most recent research and development results worldwide - the perspectives of new propulsion concepts such as electric cars with batteries and fuel cells, and furthermore plug in hybrids with conventional and alternative fuels. The propulsion concepts are evaluated based on specific power, torque characteristic, acceleration behaviour, specific fuel consumption and pollutant emissions. The alternative fuels are discussed in terms of availability, production, technical complexity of the storage on board, costs, safety and infrastructure. The book presents summarized data about vehicles with electric and hybrid propulsion. The propulsion of future cars will be marked by diversity – from compact electric city cars and range extender vehicles for suburban and rural areas up to hybrid or plug in SUV´s, Pick up´s and luxury class automobiles.

  14. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  15. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  16. Space transportation propulsion USSR launcher technology, 1990

    Science.gov (United States)

    1991-01-01

    Space transportation propulsion U.S.S.R. launcher technology is discussed. The following subject areas are covered: Energia background (launch vehicle summary, Soviet launcher family) and Energia propulsion characteristics (booster propulsion, core propulsion, and growth capability).

  17. AeroPropulsoServoElasticity: Dynamic Modeling of the Variable Cycle Propulsion System

    Science.gov (United States)

    Kopasakis, George

    2012-01-01

    This presentation was made at the 2012 Fundamental Aeronautics Program Technical Conference and it covers research work for the Dynamic Modeling of the Variable cycle Propulsion System that was done under the Supersonics Project, in the area of AeroPropulsoServoElasticity. The presentation covers the objective for the propulsion system dynamic modeling work, followed by the work that has been done so far to model the variable Cycle Engine, modeling of the inlet, the nozzle, the modeling that has been done to model the affects of flow distortion, and finally presenting some concluding remarks and future plans.

  18. Ranking transmission projects in large scale systems using an AC power flow model; Priorizacao de obras em sistemas de grande porte usando um modelo AC da rede

    Energy Technology Data Exchange (ETDEWEB)

    Melo, A C.G. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil); Fontoura Filho, R N [ELETROBRAS, Rio de Janeiro, RJ (Brazil); Peres, L A.P. Pecorelli [FURNAS, Rio de Janeiro, RJ (Brazil); Morozowski Filho, M [Santa Catarina Univ., Florianopolis, SC (Brazil)

    1994-12-31

    Initially, this paper summarizes the approach developed by the Brazilian Planning Criteria Working Group (GTCP/ELETROBRAS) for identifying which subset of transmission investments should be postponed to meet a pre-stablished budget constraint with the least possible impact on system performance. Next, this paper presents the main features of the computational model PRIO, which allows the application of the ranking process to large scale power systems (2,000 buses and 3,000 circuits), with as many as 100 projects to be ranked. In this model, the adequacy analysis of each system state is carried out through an AC power flow coupled to a successive linear programming based remedial actions model. Case studies with the IEEE-RTS system and a configuration of the Brazilian Southeastern are presented and discussed. (author) 7 refs., 6 figs., 5 tabs.

  19. Reactors for nuclear electric propulsion

    Energy Technology Data Exchange (ETDEWEB)

    Buden, D.; Angelo, J.A. Jr.

    1981-01-01

    Propulsion is the key to space exploitation and power is the key to propulsion. This paper examines the role of nuclear fission reactors as the primary power source for high specific impulse electric propulsion systems for space missions of the 1980s and 1990s. Particular mission applications include transfer to and a reusable orbital transfer vehicle from low-Earth orbit to geosynchronous orbit, outer planet exploration and reconnaissance missions, and as a versatile space tug supporting lunar resource development. Nuclear electric propulsion is examined as an indispensable component in space activities of the next two decades.

  20. Reactors for nuclear electric propulsion

    International Nuclear Information System (INIS)

    Buden, D.; Angelo, J.A. Jr.

    1981-01-01

    Propulsion is the key to space exploitation and power is the key to propulsion. This paper examines the role of nuclear fission reactors as the primary power source for high specific impulse electric propulsion systems for space missions of the 1980s and 1990s. Particular mission applications include transfer to and a reusable orbital transfer vehicle from low-Earth orbit to geosynchronous orbit, outer planet exploration and reconnaissance missions, and as a versatile space tug supporting lunar resource development. Nuclear electric propulsion is examined as an indispensable component in space activities of the next two decades

  1. The Jet Propulsion Laboratory Electric and Hybrid Vehicle System Research and Development Project, 1977-1984: A Review

    Science.gov (United States)

    Kurtz, D.; Roan, V.

    1985-01-01

    The JPL Electric and Hybrid Vehicle System Research and Development Project was established in the spring of 1977. Originally administered by the Energy Research and Development Administration (ERDA) and later by the Electric and Hybrid Vehicle Division of the U.S. Department of Energy (DOE), the overall Program objective was to decrease this nation's dependence on foreign petroleum sources by developing the technologies and incentives necessary to bring electric and hybrid vehicles successfully into the marketplace. The ERDA/DOE Program structure was divided into two major elements: (1) technology research and system development and (2) field demonstration and market development. The Jet Propulsion Laboratory (JPL) has been one of several field centers supporting the former Program element. In that capacity, the specific historical areas of responsibility have been: (1) Vehicle system developments (2) System integration and test (3) Supporting subsystem development (4) System assessments (5) Simulation tool development.

  2. Fundamental Aeronautics Program: Overview of Propulsion Work in the Supersonic Cruise Efficiency Technical Challenge

    Science.gov (United States)

    Castner, Ray

    2012-01-01

    The Supersonics Project, part of NASA's Fundamental Aeronautics Program, contains a number of technical challenge areas which include sonic boom community response, airport noise, high altitude emissions, cruise efficiency, light weight durable engines/airframes, and integrated multi-discipline system design. This presentation provides an overview of the current (2012) activities in the supersonic cruise efficiency technical challenge, and is focused specifically on propulsion technologies. The intent is to develop and validate high-performance supersonic inlet and nozzle technologies. Additional work is planned for design and analysis tools for highly-integrated low-noise, low-boom applications. If successful, the payoffs include improved technologies and tools for optimized propulsion systems, propulsion technologies for a minimized sonic boom signature, and a balanced approach to meeting efficiency and community noise goals. In this propulsion area, the work is divided into advanced supersonic inlet concepts, advanced supersonic nozzle concepts, low fidelity computational tool development, high fidelity computational tools, and improved sensors and measurement capability. The current work in each area is summarized.

  3. Additive Manufacturing of Aerospace Propulsion Components

    Science.gov (United States)

    Misra, Ajay K.; Grady, Joseph E.; Carter, Robert

    2015-01-01

    The presentation will provide an overview of ongoing activities on additive manufacturing of aerospace propulsion components, which included rocket propulsion and gas turbine engines. Future opportunities on additive manufacturing of hybrid electric propulsion components will be discussed.

  4. SmallSats, Iodine Propulsion Technology, Applications to Low-Cost Lunar Missions, and the Iodine Satellite (iSAT) Project

    Science.gov (United States)

    Dankanich, John W.

    2014-01-01

    Closing Remarks: ?(1) SmallSats hold significant potential for future low cost high value missions; (2) Propulsion remains a key limiting capability for SmallSats that Iodine can address: High ISP * Density for volume constrained spacecraft; Indefinite quiescence, unpressurized and non-hazardous as a secondary payload; (3) Iodine enables MicroSat and SmallSat maneuverability: Enables transfer into high value orbits, constellation deployment and deorbit; (4) Iodine may enable a new class of planetary and exploration class missions: Enables GTO launched secondary spacecraft to transit to the moon, asteroids, and other interplanetary destinations for approximately 150 million dollars full life cycle cost including the launch; (5) ESPA based OTVs are also volume constrained and a shift from xenon to iodine can significantly increase the transfer vehicle change in volume capability including transfers from GTO to a range of Lunar Orbits; (6) The iSAT project is a fast pace high value iodine Hall technology demonstration mission: Partnership with NASA GRC and NASA MSFC with industry partner - Busek; (7) The iSAT mission is an approved project with PDR in November of 2014 and is targeting a flight opportunity in FY17.

  5. Development of superconducting ship propulsion system

    International Nuclear Information System (INIS)

    Sakuraba, Junji; Mori, Hiroyuki; Hata, Fumiaki; Sotooka, Koukichi

    1991-01-01

    When we plan displacement-type monohull high speed vessels, it is difficult to get the hull form with the wave-making resistance minimum, because the stern shape is restricted by arrangement of propulsive machines and shafts. A small-sized and light-weight propulsive machines will reduce the limit to full form design. Superconducting technology will have capability of realizing the small-sized and light-weight propulsion motor. The superconducting electric propulsion system which is composed of superconducting propulsion motors and generators, seems to be an ideal propulsion system for future vehicles. We have constructed a 480 kW superconducting DC homopolar laboratory test motor for developing this propulsion system. The characteristic of this motor is that it has a superconducting field winding and a segmented armature drum. The superconducting field winding which operates in the persistent current mode, is cooled by a condensation heat exchanger and helium refigerating system built into the cryostat of the superconducting field winding. The operating parameters of this motor agreed well with the design parameters. Using the design concepts of this motor, we have conceptually designed a 150,000-200,000 PS superconducting electric propulsive system for a displacement-type monohull high speed ship. (author)

  6. Software To Secure Distributed Propulsion Simulations

    Science.gov (United States)

    Blaser, Tammy M.

    2003-01-01

    Distributed-object computing systems are presented with many security threats, including network eavesdropping, message tampering, and communications middleware masquerading. NASA Glenn Research Center, and its industry partners, has taken an active role in mitigating the security threats associated with developing and operating their proprietary aerospace propulsion simulations. In particular, they are developing a collaborative Common Object Request Broker Architecture (CORBA) Security (CORBASec) test bed to secure their distributed aerospace propulsion simulations. Glenn has been working with its aerospace propulsion industry partners to deploy the Numerical Propulsion System Simulation (NPSS) object-based technology. NPSS is a program focused on reducing the cost and time in developing aerospace propulsion engines

  7. Tests of an alternating current propulsion subsystem for electric vehicles on a road load simulator

    Science.gov (United States)

    Stenger, F. J.

    1982-12-01

    The test results of a breadboard version of an ac electric-vehicle propulsion subsystem are presented. The breadboard was installed in the NASA Lewis Research Center Road Load Simulator facility and tested under steady-state and transient conditions. Steady-state tests were run to characterize the system and component efficiencies over the complete speed-torque range within the capability of the propulsion subsystem in the motoring mode of operation. Transient tests were performed to determine the energy consumption of the breadboard over the acceleration and cruise portions of SAE J227 and driving schedules B, C, and D. Tests in the regenerative mode were limited to the low-gear-speed range of the two speed transaxle used in the subsystem. The maximum steady-state subsystem efficiency observed for the breadboard was 81.5 percent in the high-gear-speed range in the motoring mode, and 76 percent in the regenerative braking mode (low gear). The subsystem energy efficiency during the transient tests ranged from 49.2 percent for schedule B to 68.4 percent for Schedule D.

  8. Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing

    Energy Technology Data Exchange (ETDEWEB)

    Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory

    2009-10-01

    The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.

  9. Nuclear merchant ship propulsion. The present status in the UK

    International Nuclear Information System (INIS)

    Kinsey, R.P.

    1976-01-01

    The latest report of the Nuclear Ship Stearing Group which deals with three important aspects; economic assessments, international safety and operating procedures for nuclear ships, and the industrial capability of the UK shipbuilding and nuclear industries, is discussed. The integral design concept for a pressurised water reactor for use as a marine reactor is considered. The operational safety aspects of such reactors and of the attendant refuelling facilities are discussed. U.K. capability in the whole nuclear merchant ship propulsion project is considered; reference being made to the design and construction of small PWR reactors, the development, design and supply of the nuclear propulsion unit, financial aspects, and the requirement for cooperation between industrial interests and governmental research units. (U.K.)

  10. Cold Gas Micro Propulsion

    NARCIS (Netherlands)

    Louwerse, M.C.

    2009-01-01

    This thesis describes the development of a micro propulsion system. The trend of miniaturization of satellites requires small sized propulsion systems. For particular missions it is important to maintain an accurate distance between multiple satellites. Satellites drift apart due to differences in

  11. Project Exodus

    Science.gov (United States)

    1990-01-01

    Project Exodus is an in-depth study to identify and address the basic problems of a manned mission to Mars. The most important problems concern propulsion, life support, structure, trajectory, and finance. Exodus will employ a passenger ship, cargo ship, and landing craft for the journey to Mars. These three major components of the mission design are discussed separately. Within each component the design characteristics of structures, trajectory, and propulsion are addressed. The design characteristics of life support are mentioned only in those sections requiring it.

  12. Lunar Robotic Precursor Missions Using Electric Propulsion

    OpenAIRE

    Winski, Richard G.

    2006-01-01

    A trade study is carried out for the design of electric propulsion based lunar robotic precursor missions. The focus is to understand the relationships between payload mass delivered, electric propulsion power, and trip time. The results are compared against a baseline system using chemical propulsion with LOX/H2. The major differences between the chemical propulsion based and electric propulsion based systems are presented in terms of the payload mass and trip time. It is shown that solar e...

  13. A Review of Laser Ablation Propulsion

    International Nuclear Information System (INIS)

    Phipps, Claude; Bohn, Willy; Lippert, Thomas; Sasoh, Akihiro; Schall, Wolfgang; Sinko, John

    2010-01-01

    Laser Ablation Propulsion is a broad field with a wide range of applications. We review the 30-year history of laser ablation propulsion from the transition from earlier pure photon propulsion concepts of Oberth and Saenger through Kantrowitz's original laser ablation propulsion idea to the development of air-breathing 'Lightcraft' and advanced spacecraft propulsion engines. The polymers POM and GAP have played an important role in experiments and liquid ablation fuels show great promise. Some applications use a laser system which is distant from the propelled object, for example, on another spacecraft, the Earth or a planet. Others use a laser that is part of the spacecraft propulsion system on the spacecraft. Propulsion is produced when an intense laser beam strikes a condensed matter surface and produces a vapor or plasma jet. The advantages of this idea are that exhaust velocity of the propulsion engine covers a broader range than is available from chemistry, that it can be varied to meet the instantaneous demands of the particular mission, and that practical realizations give lower mass and greater simplicity for a payload delivery system. We review the underlying theory, buttressed by extensive experimental data. The primary problem in laser space propulsion theory has been the absence of a way to predict thrust and specific impulse over the transition from the vapor to the plasma regimes. We briefly discuss a method for combining two new vapor regime treatments with plasma regime theory, giving a smooth transition from one regime to the other. We conclude with a section on future directions.

  14. Overview of the Development of the Solar Electric Propulsion Technology Demonstration Mission 12.5-kW Hall Thruster

    Science.gov (United States)

    Kamhawi, Hani; Huang, Wensheng; Haag, Thomas; Yim, John; Chang, Li; Clayman, Lauren; Herman, Daniel; Shastry, Rohit; Thomas, Robert; Verhey, Timothy; hide

    2014-01-01

    NASA is developing mission concepts for a solar electric propulsion technology demonstration mission. A number of mission concepts are being evaluated including ambitious missions to near Earth objects. The demonstration of a high-power solar electric propulsion capability is one of the objectives of the candidate missions under consideration. In support of NASA's exploration goals, a number of projects are developing extensible technologies to support NASA's near and long term mission needs. Specifically, the Space Technology Mission Directorate Solar Electric Propulsion Technology Demonstration Mission project is funding the development of a 12.5-kilowatt magnetically shielded Hall thruster system to support future NASA missions. This paper presents the design attributes of the thruster that was collaboratively developed by the NASA Glenn Research Center and the Jet Propulsion Laboratory. The paper provides an overview of the magnetic, plasma, thermal, and structural modeling activities that were carried out in support of the thruster design. The paper also summarizes the results of the functional tests that have been carried out to date. The planned thruster performance, plasma diagnostics (internal and in the plume), thermal, wear, and mechanical tests are outlined.

  15. An overview of integrated flight-propulsion controls flight research on the NASA F-15 research airplane

    Science.gov (United States)

    Burcham, Frank W., Jr.; Gatlin, Donald H.; Stewart, James F.

    1995-01-01

    The NASA Dryden Flight Research Center has been conducting integrated flight-propulsion control flight research using the NASA F-15 airplane for the past 12 years. The research began with the digital electronic engine control (DEEC) project, followed by the F100 Engine Model Derivative (EMD). HIDEC (Highly Integrated Digital Electronic Control) became the umbrella name for a series of experiments including: the Advanced Digital Engine Controls System (ADECS), a twin jet acoustics flight experiment, self-repairing flight control system (SRFCS), performance-seeking control (PSC), and propulsion controlled aircraft (PCA). The upcoming F-15 project is ACTIVE (Advanced Control Technology for Integrated Vehicles). This paper provides a brief summary of these activities and provides background for the PCA and PSC papers, and includes a bibliography of all papers and reports from the NASA F-15 project.

  16. Propulsive efficiency and non- expert swimmers performance

    Directory of Open Access Journals (Sweden)

    Tiago Barbosa

    2009-12-01

    Full Text Available Propulsive efficiency is one of the most interesting issues for competitive swimming researchers, has it presents significant relationships with the swimmer’s biophysical behavior and his/her performance. Although propulsive efficiency is a variable that has been quite studied in elite swimmers, there is no research on this issue in young and non-expert swimmers. Thus, the aim of this study was to: (i estimate the propulsive efficiency on non-expert swimmers; (ii identify biomechanical and anthropometrical parameters that are associated with propulsive efficiency; (iii identify the association between the propulsive efficiency and swim performance. Twenty-eight non-expert swimmers participated on this study. It was assessed the propulsive efficiency, biomechanical and anthropometrical parameters, as well as, the swim performance. The propulsive efficiency of non-expert swimmers is lower than data reported in the literature to higher competitive levels swimmers and there are no significant differences between boys and girls. It was also noted that several biomechanical and anthropometrical parameters, as well as, the swim performance are associated with the propulsive efficiency.

  17. Reconfiguration of NASA GRC's Vacuum Facility 6 for Testing of Advanced Electric Propulsion System (AEPS) Hardware

    Science.gov (United States)

    Peterson, Peter Y.; Kamhawi, Hani; Huang, Wensheng; Yim, John T.; Haag, Thomas W.; Mackey, Jonathan A.; McVetta, Michael S.; Sorrelle, Luke T.; Tomsik, Thomas M.; Gilligan, Ryan P.; hide

    2018-01-01

    The NASA Hall Effect Rocket with Magnetic Shielding (HERMeS) 12.5 kW Hall thruster has been the subject of extensive technology maturation in preparation for development into a flight propulsion system. The HERMeS thruster is being developed and tested at NASA GRC and NASA JPL through support of the Space Technology Mission Directorate (STMD) and is intended to be used as the electric propulsion system on the Power and Propulsion Element (PPE) of the recently announced Deep Space Gateway (DSG). The Advanced Electric Propulsion System (AEPS) contract was awarded to Aerojet-Rocketdyne to develop the HERMeS system into a flight system for use by NASA. To address the hardware test needs of the AEPS project, NASA GRC launched an effort to reconfigure Vacuum Facility 6 (VF-6) for high-power electric propulsion testing including upgrades and reconfigurations necessary to conduct performance, plasma plume, and system level integration testing. Results of the verification and validation testing with HERMeS Technology Demonstration Unit (TDU)-1 and TDU-3 Hall thrusters are also included.

  18. Research Opportunities in Space Propulsion

    Science.gov (United States)

    Rodgers, Stephen L.

    2007-01-01

    Rocket propulsion determines the primary characteristics of any space vehicle; how fast and far it can go, its lifetime, and its capabilities. It is the primary factor in safety and reliability and the biggest cost driver. The extremes of heat and pressure produced by propulsion systems push the limits of materials used for manufacturing. Space travel is very unforgiving with little room for errors, and so many things can go wrong with these very complex systems. So we have to plan for failure and that makes it costly. But what is more exciting than the roar of a rocket blasting into space? By its nature the propulsion world is conservative. The stakes are so high at every launch, in terms of payload value or in human life, that to introduce new components to a working, qualified system is extremely difficult and costly. Every launch counts and no risks are tolerated, which leads to the space world's version of Catch-22:"You can't fly till you flown." The last big 'game changer' in propulsion was the use of liquid hydrogen as a fuel. No new breakthrough, low cost access to space system will be developed without new efficient propulsion systems. Because there is no large commercial market driving investment in propulsion, what propulsion research is done is sponsored by government funding agencies. A further difficulty in propulsion technology development is that there are so few new systems flying. There is little opportunity to evolve propulsion technologies and to update existing systems with results coming out of research as there is in, for example, the auto industry. The biggest hurdle to space exploration is getting off the ground. The launch phase will consume most of the energy required for any foreseeable space exploration mission. The fundamental physical energy requirements of escaping earth's gravity make it difficult. It takes 60,000 kJ to put a kilogram into an escape orbit. The vast majority (-97%) of the energy produced by a launch vehicle is used

  19. Thermo-hydraulic characteristics of ship propulsion reactor in the conditions of ship motions and safety assessment

    International Nuclear Information System (INIS)

    Kobayashi, Michiyuki; Aya, Izuo; Inasaka, Fujio; Murata, Hiroyuki; Odano, Naoteru; Shiozaki, Koki

    1998-01-01

    A research project from 1995-1999 had a plan to make experimental studies on (1) safety of nuclear ship loaded with an integral ship propulsion reactor (2) effects of pulsating flow on the thermo-hydraulic characteristics of ship propulsion reactor and (3) thermo-hydraulic behaviors of the reactor container at the time of accident in a passively safe ship propulsion reactor. Development of a data base for ship propulsion reactor was attempted using previous experimental data on the thermo-hydraulic characteristics of the reactor in the institute in addition to the present results aiming to make general analytical evaluation for the safety of the engineering-simulation system for nuclear ship. A general data base was obtained by integrating the data list and the analytical program for static characteristics. A test equipment which allows to visualize the pulsating flow was produced and visualization experiments have started. (M.N.)

  20. Mars Earth Return Vehicle (MERV) Propulsion Options

    Science.gov (United States)

    Oleson, Steven R.; McGuire, Melissa L.; Burke, Laura; Fincannon, James; Warner, Joe; Williams, Glenn; Parkey, Thomas; Colozza, Tony; Fittje, Jim; Martini, Mike; hide

    2010-01-01

    The COMPASS Team was tasked with the design of a Mars Sample Return Vehicle. The current Mars sample return mission is a joint National Aeronautics and Space Administration (NASA) and European Space Agency (ESA) mission, with ESA contributing the launch vehicle for the Mars Sample Return Vehicle. The COMPASS Team ran a series of design trades for this Mars sample return vehicle. Four design options were investigated: Chemical Return /solar electric propulsion (SEP) stage outbound, all-SEP, all chemical and chemical with aerobraking. The all-SEP and Chemical with aerobraking were deemed the best choices for comparison. SEP can eliminate both the Earth flyby and the aerobraking maneuver (both considered high risk by the Mars Sample Return Project) required by the chemical propulsion option but also require long low thrust spiral times. However this is offset somewhat by the chemical/aerobrake missions use of an Earth flyby and aerobraking which also take many months. Cost and risk analyses are used to further differentiate the all-SEP and Chemical/Aerobrake options.

  1. Green Propulsion Technologies for Advanced Air Transports

    Science.gov (United States)

    Del Rosario, Ruben

    2015-01-01

    Air transportation is critical to U.S. and Global economic vitality. However, energy and climate issues challenge aviations ability to be sustainable in the long term. Aviation must dramatically reduce fuel use and related emissions. Energy costs to U.S. airlines nearly tripled between 1995 and 2011, and continue to be the highest percentage of operating costs. The NASA Advanced Air Transports Technology Project addresses the comprehensive challenge of enabling revolutionary energy efficiency improvements in subsonic transport aircraft combined with dramatic reductions in harmful emissions and perceived noise to facilitate sustained growth of the air transportation system. Advanced technologies and the development of unconventional aircraft systems offer the potential to achieve these improvements. The presentation will highlight the NASA vision of revolutionary systems and propulsion technologies needed to achieve these challenging goals. Specifically, the primary focus is on the N+3 generation; that is, vehicles that are three generations beyond the current state of the art, requiring mature technology solutions in the 2025-30 timeframe, which are envisioned as being powered by Hybrid Electric Propulsion Systems.

  2. Review: laser ignition for aerospace propulsion

    Directory of Open Access Journals (Sweden)

    Steven A. O’Briant

    2016-03-01

    This paper aims to provide the reader an overview of advanced ignition methods, with an emphasis on laser ignition and its applications to aerospace propulsion. A comprehensive review of advanced ignition systems in aerospace applications is performed. This includes studies on gas turbine applications, ramjet and scramjet systems, and space and rocket applications. A brief overview of ignition and laser ignition phenomena is also provided in earlier sections of the report. Throughout the reading, research papers, which were presented at the 2nd Laser Ignition Conference in April 2014, are mentioned to indicate the vast array of projects that are currently being pursued.

  3. Mirror fusion propulsion system - A performance comparison with alternate propulsion systems for the manned Mars mission

    International Nuclear Information System (INIS)

    Deveny, M.; Carpenter, S.; O'connell, T.; Schulze, N.

    1993-06-01

    The performance characteristics of several propulsion technologies applied to piloted Mars missions are compared. The characteristics that are compared are Initial Mass in Low Earth Orbit (IMLEO), mission flexibility, and flight times. The propulsion systems being compared are both demonstrated and envisioned: Chemical (or Cryogenic), Nuclear Thermal Rocket (NTR) solid core, NTR gas core, Nuclear Electric Propulsion (NEP), and a mirror fusion space propulsion system. The proposed magnetic mirror fusion reactor, known as the Mirror Fusion Propulsion System (MFPS), is described. The description is an overview of a design study that was conducted to convert a mirror reactor experiment at Lawrence Livermore National Lab (LLNL) into a viable space propulsion system. Design principles geared towards minimizing mass and maximizing power available for thrust are identified and applied to the LLNL reactor design, resulting in the MFPS. The MFPS' design evolution, reactor and fuel choices, and system configuration are described. Results of the performance comparison shows that the MFPS minimizes flight time to 60 to 90 days for flights to Mars while allowing continuous return-home capability while at Mars. Total MFPS IMLEO including propellant and payloads is kept to about 1,000 metric tons. 50 refs

  4. Nonlinear Dynamic Modeling and Controls Development for Supersonic Propulsion System Research

    Science.gov (United States)

    Connolly, Joseph W.; Kopasakis, George; Paxson, Daniel E.; Stuber, Eric; Woolwine, Kyle

    2012-01-01

    This paper covers the propulsion system component modeling and controls development of an integrated nonlinear dynamic simulation for an inlet and engine that can be used for an overall vehicle (APSE) model. The focus here is on developing a methodology for the propulsion model integration, which allows for controls design that prevents inlet instabilities and minimizes the thrust oscillation experienced by the vehicle. Limiting thrust oscillations will be critical to avoid exciting vehicle aeroelastic modes. Model development includes both inlet normal shock position control and engine rotor speed control for a potential supersonic commercial transport. A loop shaping control design process is used that has previously been developed for the engine and verified on linear models, while a simpler approach is used for the inlet control design. Verification of the modeling approach is conducted by simulating a two-dimensional bifurcated inlet and a representative J-85 jet engine previously used in a NASA supersonics project. Preliminary results are presented for the current supersonics project concept variable cycle turbofan engine design.

  5. Reliability of emergency ac power systems at nuclear power plants

    International Nuclear Information System (INIS)

    Battle, R.E.; Campbell, D.J.

    1983-07-01

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project

  6. Distributed propulsion.

    OpenAIRE

    Lindström, Robin; Rosvall, Tobias

    2013-01-01

    En prestandaanalys utfördes på en SAAB 2000 som referensobjekt. Olika metoder för att driva flygplan på ett miljövänligare sätt utvärderades tillsammans med distributed propulsion. Efter undersökningar valdes elmotorer tillsammans med Zink-luft batterier för att driva SAAB 2000 med distributed propulsion. En prestandaanalys utfördes på detta plan på samma sätt som för den ursprungliga SAAB 2000. Resultaten jämfördes och slutsatsen blev att räckvidden var för kort för att konfigurationen skull...

  7. Turboelectric Distributed Propulsion in a Hybrid Wing Body Aircraft

    Science.gov (United States)

    Felder, James L.; Brown, Gerald V.; DaeKim, Hyun; Chu, Julio

    2011-01-01

    The performance of the N3-X, a 300 passenger hybrid wing body (HWB) aircraft with turboelectric distributed propulsion (TeDP), has been analyzed to see if it can meet the 70% fuel burn reduction goal of the NASA Subsonic Fixed Wing project for N+3 generation aircraft. The TeDP system utilizes superconducting electric generators, motors and transmission lines to allow the power producing and thrust producing portions of the system to be widely separated. It also allows a small number of large turboshaft engines to drive any number of propulsors. On the N3-X these new degrees of freedom were used to (1) place two large turboshaft engines driving generators in freestream conditions to maximize thermal efficiency and (2) to embed a broad continuous array of 15 motor driven propulsors on the upper surface of the aircraft near the trailing edge. That location maximizes the amount of the boundary layer ingested and thus maximizes propulsive efficiency. The Boeing B777-200LR flying 7500 nm (13890 km) with a cruise speed of Mach 0.84 and an 118100 lb payload was selected as the reference aircraft and mission for this study. In order to distinguish between improvements due to technology and aircraft configuration changes from those due to the propulsion configuration changes, an intermediate configuration was included in this study. In this configuration a pylon mounted, ultra high bypass (UHB) geared turbofan engine with identical propulsion technology was integrated into the same hybrid wing body airframe. That aircraft achieved a 52% reduction in mission fuel burn relative to the reference aircraft. The N3-X was able to achieve a reduction of 70% and 72% (depending on the cooling system) relative to the reference aircraft. The additional 18% - 20% reduction in the mission fuel burn can therefore be attributed to the additional degrees of freedom in the propulsion system configuration afforded by the TeDP system that eliminates nacelle and pylon drag, maximizes boundary

  8. Vehicle with inclinable caterpillar propulsion units

    International Nuclear Information System (INIS)

    Clar, G.

    1991-01-01

    This vehicle usable in hostile environment such nuclear industry has four propulsion units with a caterpillar track and two integrated motors: one for advancing the caterpillar track and the other for inclining the propulsion unit when overcoming obstacles. Each propulsion unit is easily replaceable because there are no mechanical parts in the body of the vehicle [fr

  9. Design and Performance of the NASA SCEPTOR Distributed Electric Propulsion Flight Demonstrator

    Science.gov (United States)

    Borer, Nicholas K.; Patterson, Michael D.; Viken, Jeffrey K.; Moore, Mark D.; Clarke, Sean; Redifer, Matthew E.; Christie, Robert J.; Stoll, Alex M.; Dubois, Arthur; Bevirt, JoeBen; hide

    2016-01-01

    Distributed Electric Propulsion (DEP) technology uses multiple propulsors driven by electric motors distributed about the airframe to yield beneficial aerodynamic-propulsion interaction. The NASA SCEPTOR flight demonstration project will retrofit an existing internal combustion engine-powered light aircraft with two types of DEP: small "high-lift" propellers distributed along the leading edge of the wing which accelerate the flow over the wing at low speeds, and larger cruise propellers co-located with each wingtip for primary propulsive power. The updated high-lift system enables a 2.5x reduction in wing area as compared to the original aircraft, reducing drag at cruise and shifting the velocity for maximum lift-to-drag ratio to a higher speed, while maintaining low-speed performance. The wingtip-mounted cruise propellers interact with the wingtip vortex, enabling a further efficiency increase that can reduce propulsive power by 10%. A tradespace exploration approach is developed that enables rapid identification of salient trades, and subsequent creation of SCEPTOR demonstrator geometries. These candidates were scrutinized by subject matter experts to identify design preferences that were not modeled during configuration exploration. This exploration and design approach is used to create an aircraft that consumes an estimated 4.8x less energy at the selected cruise point when compared to the original aircraft.

  10. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  11. Integration of Xantrex HY-100 Hybrid Inverter with an AC Induction Wind Turbine

    Energy Technology Data Exchange (ETDEWEB)

    Corbus, D.; Newcomb, C.; Friedly, S.

    2003-05-01

    Several issues must be addressed before solid-state inverters can be used in wind-diesel systems with larger wind turbines. This project addresses those issues by using a commercial hybrid inverter designed for PV-diesel systems and modifying the inverter for use with an AC induction wind turbine. Another approach would have entailed building an inverter specifically for use with an AC induction wind turbine, but that was beyond the scope of this project. The inverter chosen for this project was a Xantrex HY-100, an inverter designed for PV systems. The unit consists of an inverter/rectifier bridge, a generator interface contactor, a battery charge controller, a hybrid controller, and the associated control electronics. Details of the inverter may be found in Appendix A. A twofold approach was taken to integrating the existing inverter for use with an AC induction wind turbine: 1) development of a detailed model to model both steady-state and transient behavior of the system, and 2) modification and testing of the inverter with an induction wind turbine based on the modeling results. This report describes these two tasks.

  12. Project Bibliographies: Tracking the Expansion of Knowledge Using JPL Project Publications

    Science.gov (United States)

    Coppin, Ann

    2016-01-01

    The Jet Propulsion Laboratory (JPL) Library defines a project bibliography as a bibliography of publicly available publications relating to a specific JPL instrument or mission. These bibliographies may be used to share information between distant project team members, as part of the required Education and Public Outreach effort, or as part of…

  13. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  14. Hybrid CNG propulsion for fleet vehicles: emission reduction potential and operating experience

    Energy Technology Data Exchange (ETDEWEB)

    Drozdz, P. [BC Research Institute, BC (Canada)

    1997-12-31

    A project (1) to build an experimental hybrid electric vehicle to be used as a test bed for the development of EZEV-oriented technologies, (2) to develop a control system to manage the energy use in a series hybrid vehicle, (3) to evaluate the suitability of valve regulated lead acid batteries for hybrid propulsion, and (4) to investigate the feasibility of using hybrid propulsion for medium duty fleet vehicles was discussed. In this context, the electric G-Van, the BCRI hybrid G-Van battery, the hybrid power unit, and the electronic control unit were described. The concept of hybrid vehicle control, and the control system software were explained, and a summary of the hybrid system efficiency test was provided.

  15. Q-Thruster Breadboard Campaign Project

    Science.gov (United States)

    White, Harold

    2014-01-01

    Dr. Harold "Sonny" White has developed the physics theory basis for utilizing the quantum vacuum to produce thrust. The engineering implementation of the theory is known as Q-thrusters. During FY13, three test campaigns were conducted that conclusively demonstrated tangible evidence of Q-thruster physics with measurable thrust bringing the TRL up from TRL 2 to early TRL 3. This project will continue with the development of the technology to a breadboard level by leveraging the most recent NASA/industry test hardware. This project will replace the manual tuning process used in the 2013 test campaign with an automated Radio Frequency (RF) Phase Lock Loop system (precursor to flight-like implementation), and will redesign the signal ports to minimize RF leakage (improves efficiency). This project will build on the 2013 test campaign using the above improvements on the test implementation to get ready for subsequent Independent Verification and Validation testing at Glenn Research Center (GRC) and Jet Propulsion Laboratory (JPL) in FY 2015. Q-thruster technology has a much higher thrust to power than current forms of electric propulsion (7x Hall thrusters), and can significantly reduce the total power required for either Solar Electric Propulsion (SEP) or Nuclear Electric Propulsion (NEP). Also, due to the high thrust and high specific impulse, Q-thruster technology will greatly relax the specific mass requirements for in-space nuclear reactor systems. Q-thrusters can reduce transit times for a power-constrained architecture.

  16. Aeroelastic Wing Shaping Using Distributed Propulsion

    Science.gov (United States)

    Nguyen, Nhan T. (Inventor); Reynolds, Kevin Wayne (Inventor); Ting, Eric B. (Inventor)

    2017-01-01

    An aircraft has wings configured to twist during flight. Inboard and outboard propulsion devices, such as turbofans or other propulsors, are connected to each wing, and are spaced along the wing span. A flight controller independently controls thrust of the inboard and outboard propulsion devices to significantly change flight dynamics, including changing thrust of outboard propulsion devices to twist the wing, and to differentially apply thrust on each wing to change yaw and other aspects of the aircraft during various stages of a flight mission. One or more generators can be positioned upon the wing to provide power for propulsion devices on the same wing, and on an opposite wing.

  17. Visions of the Future: Hybrid Electric Aircraft Propulsion

    Science.gov (United States)

    Bowman, Cheryl L.

    2016-01-01

    The National Aeronautics and Space Administration (NASA) is investing continually in improving civil aviation. Hybridization of aircraft propulsion is one aspect of a technology suite which will transform future aircraft. In this context, hybrid propulsion is considered a combination of traditional gas turbine propulsion and electric drive enabled propulsion. This technology suite includes elements of propulsion and airframe integration, parallel hybrid shaft power, turbo-electric generation, electric drive systems, component development, materials development and system integration at multiple levels.

  18. NCDC International Best Track Archive for Climate Stewardship (IBTrACS) Project, Version 3

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The International Best Track Archive for Climate Stewardship (IBTrACS) dataset was developed by the NOAA National Climatic Data Center, which took the initial step...

  19. The Design and Integration of a Distributed Fan Propulsion System within a Split-Wing, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — A baseline propulsion system has been designed as a starting point in a previous SBIR effort for this project which consists of two turboshaft engines, a generator...

  20. The Space Nuclear Thermal Propulsion Program: Propulsion for the twenty first century

    International Nuclear Information System (INIS)

    Bleeker, G.; Moody, J.; Kesaree, M.

    1993-01-01

    As mission requirements approach the limits of the chemical propulsion systems, new engines must be investigated that can meet the advanced mission requirements of higher payload fractions, higher velocities, and consequently higher specific Impulses (Isp). The propulsion system that can meet these high demands is a nuclear thermal rocket engine. This engine generates the thrust by expanding/existing the hydrogen, heated from the energy derived from the fission process in a reactor, through a nozzle. The Department of Defense (DoD), however, initiated a new nuclear rocket development program in 1987 for ballistic missile defense application. The Space Nuclear Thermal Propulsion (SNTP) Program that seeks to improve on the technology of ROVER/NERVA grew out of this beginning and has been managed by the Air Force, with the involvement of DoE and NASA. The goal of the SNTP Program is to develop an engine to meet potential Air Force requirements for upper stage engine, bimodal propulsion/power applications, and orbital transfer vehicles, as well as the NASA requirements for possible missions to the Moon and Mars. During the entire life of the program, the DoD has considered safety to be of paramount importance, and is following all national environmental policies

  1. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  2. Projected progress in the engineering state-of-the-art. [for aerospace

    Science.gov (United States)

    Nicks, O. W.

    1978-01-01

    Projected advances in discipline areas associated with aerospace engineering are discussed. The areas examined are propulsion and power, materials and structures, aerothermodynamics, and electronics. Attention is directed to interdisciplinary relationships; one example would be the application of communications technology to the solution of propulsion problems. Examples involving projected technology changes are presented, and technology integration and societal effects are considered.

  3. Powered Flight The Engineering of Aerospace Propulsion

    CERN Document Server

    Greatrix, David R

    2012-01-01

    Whilst most contemporary books in the aerospace propulsion field are dedicated primarily to gas turbine engines, there is often little or no coverage of other propulsion systems and devices such as propeller and helicopter rotors or detailed attention to rocket engines. By taking a wider viewpoint, Powered Flight - The Engineering of Aerospace Propulsion aims to provide a broader context, allowing observations and comparisons to be made across systems that are overlooked by focusing on a single aspect alone. The physics and history of aerospace propulsion are built on step-by-step, coupled with the development of an appreciation for the mathematics involved in the science and engineering of propulsion. Combining the author’s experience as a researcher, an industry professional and a lecturer in graduate and undergraduate aerospace engineering, Powered Flight - The Engineering of Aerospace Propulsion covers its subject matter both theoretically and with an awareness of the practicalities of the industry. To ...

  4. Advanced Chemical Propulsion Study

    Science.gov (United States)

    Woodcock, Gordon; Byers, Dave; Alexander, Leslie A.; Krebsbach, Al

    2004-01-01

    A study was performed of advanced chemical propulsion technology application to space science (Code S) missions. The purpose was to begin the process of selecting chemical propulsion technology advancement activities that would provide greatest benefits to Code S missions. Several missions were selected from Code S planning data, and a range of advanced chemical propulsion options was analyzed to assess capabilities and benefits re these missions. Selected beneficial applications were found for higher-performing bipropellants, gelled propellants, and cryogenic propellants. Technology advancement recommendations included cryocoolers and small turbopump engines for cryogenic propellants; space storable propellants such as LOX-hydrazine; and advanced monopropellants. It was noted that fluorine-bearing oxidizers offer performance gains over more benign oxidizers. Potential benefits were observed for gelled propellants that could be allowed to freeze, then thawed for use.

  5. Proposal and Development of a High Voltage Variable Frequency Alternating Current Power System for Hybrid Electric Aircraft

    Science.gov (United States)

    Sadey, David J.; Taylor, Linda M.; Beach, Raymond F.

    2017-01-01

    The development of ultra-efficient commercial vehicles and the transition to low-carbon emission propulsion are seen as strategic thrust paths within NASA Aeronautics. A critical enabler to these paths comes in the form of hybrid electric propulsion systems. For megawatt-class systems, the best power system topology for these hybrid electric propulsion systems is debatable. Current proposals within NASA and the Aero community suggest using a combination of alternating current (AC) and direct current (DC) for power generation, transmission, and distribution. This paper proposes an alternative to the current thought model through the use of a primarily high voltage AC power system, supported by the Convergent Aeronautics Solutions (CAS) Project. This system relies heavily on the use of doubly-fed induction machines (DFIMs), which provide high power densities, minimal power conversion, and variable speed operation. The paper presents background on the activity along with the system architecture, development status, and preliminary results.

  6. Project Risk Management

    Science.gov (United States)

    Jr., R. F. Miles

    1995-01-01

    Project risk management is primarily concerned with performance, reliability, cost, and schedule. Environmental risk management is primarily concerned with human health and ecological hazards and likelihoods. This paper discusses project risk management and compares it to environmental risk management, both with respect to goals and implementation. The approach of the Jet Propulsion Laboratory to risk management is presented as an example of a project risk management approach that is an extension to NASA NHB 7120.5: Management of Major System Programs and Projects.

  7. A Conceptual Tree of Laser Propulsion

    International Nuclear Information System (INIS)

    Pakhomov, Andrew V.; Sinko, John E.

    2008-01-01

    An original attempt to develop a conceptual tree for laser propulsion is offered. The tree provides a systematic view for practically all possible laser propulsion concepts and all inter-conceptual links, based on propellant phases and phase transfers. It also helps to see which fields of laser propulsion have been already thoroughly explored, where the next effort must be applied, and which paths should be taken with proper care or avoided entirely

  8. Replacement of HCFC-225 Solvent for Cleaning NASA Propulsion Oxygen Systems

    Science.gov (United States)

    Mitchell, Mark A.; Lowrey, Nikki M.

    2015-01-01

    Since the 1990's, when the Class I Ozone Depleting Substance (ODS) chlorofluorocarbon-113 (CFC-113) was banned, NASA's rocket propulsion test facilities at Marshall Space Flight Center (MSFC) and Stennis Space Center (SSC) have relied upon hydrochlorofluorocarbon-225 (HCFC-225) to safely clean and verify the cleanliness of large scale propulsion oxygen systems. Effective January 1, 2015, the production, import, export, and new use of HCFC-225, a Class II ODS, was prohibited by the Clean Air Act. In 2012 through 2014, leveraging resources from both the NASA Rocket Propulsion Test Program and the Defense Logistics Agency - Aviation Hazardous Minimization and Green Products Branch, test labs at MSFC, SSC, and Johnson Space Center's White Sands Test Facility (WSTF) collaborated to seek out, test, and qualify a replacement for HCFC-225 that is both an effective cleaner and safe for use with oxygen systems. Candidate solvents were selected and a test plan was developed following the guidelines of ASTM G127, Standard Guide for the Selection of Cleaning Agents for Oxygen Systems. Solvents were evaluated for materials compatibility, oxygen compatibility, cleaning effectiveness, and suitability for use in cleanliness verification and field cleaning operations. Two solvents were determined to be acceptable for cleaning oxygen systems and one was chosen for implementation at NASA's rocket propulsion test facilities. The test program and results are summarized. This project also demonstrated the benefits of cross-agency collaboration in a time of limited resources.

  9. Lightweight Damage Tolerant, High-Temperature Radiators for Nuclear Power and Propulsion

    Science.gov (United States)

    Craven, Paul D.; SanSoucie, Michael P.

    2015-01-01

    NASA is increasingly emphasizing exploration to bodies beyond near-Earth orbit. New propulsion systems and new spacecraft are being built for these missions. As the target bodies get further out from Earth, high energy density systems, e.g., nuclear fusion, for propulsion and power will be advantageous. The mass and size of these systems, including supporting systems such as the heat exchange system, including thermal radiators, will need to be as small as possible. Conventional heat exchange systems are a significant portion of the total thermal management mass and size. Nuclear electric propulsion (NEP) is a promising option for high-speed, in-space travel due to the high energy density of nuclear fission power sources and efficient electric thrusters. Heat from the reactor is converted to power for use in propulsion or for system power. The heat not used in the power conversion is then radiated to space as shown in figure 1. Advanced power conversion technologies will require high operating temperatures and would benefit from lightweight radiator materials. Radiator performance dictates power output for nuclear electric propulsion systems. Pitch-based carbon fiber materials have the potential to offer significant improvements in operating temperature, thermal conductivity, and mass. These properties combine to allow significant decreases in the total mass of the radiators and significant increases in the operating temperature of the fins. A Center-funded project at NASA Marshall Space Flight Center has shown that high thermal conductivity, woven carbon fiber fins with no matrix material, can be used to dissipate waste heat from NEP systems and because of high specific power (kW/kg), will require less mass and possibly less total area than standard metal and composite radiator fins for radiating the same amount of heat. This project uses an innovative approach to reduce the mass and size required for the thermal radiators to the point that in-space NEP and power

  10. Powersail High Power Propulsion System Design Study

    Science.gov (United States)

    Gulczinski, Frank S., III

    2000-11-01

    A desire by the United States Air Force to exploit the space environment has led to a need for increased on-orbit electrical power availability. To enable this, the Air Force Research Laboratory Space Vehicles Directorate (AFRL/ VS) is developing Powersail: a two-phased program to demonstrate high power (100 kW to 1 MW) capability in space using a deployable, flexible solar array connected to the host spacecraft using a slack umbilical. The first phase will be a proof-of-concept demonstration at 50 kW, followed by the second phase, an operational system at full power. In support of this program, the AFRL propulsion Directorate's Spacecraft Propulsion Branch (AFRL/PRS ) at Edwards AFB has commissioned a design study of the Powersail High Power Propulsion System. The purpose of this study, the results of which are summarized in this paper, is to perform mission and design trades to identify potential full-power applications (both near-Earth and interplanetary) and the corresponding propulsion system requirements and design. The design study shall farther identify a suitable low power demonstration flight that maximizes risk reduction for the fully operational system. This propulsion system is expected to be threefold: (1) primary propulsion for moving the entire vehicle, (2) a propulsion unit that maintains the solar array position relative to the host spacecraft, and (3) control propulsion for maintaining proper orientation for the flexible solar array.

  11. Pushing the Limits of Cubesat Attitude Control: A Ground Demonstration

    Science.gov (United States)

    Sanders, Devon S.; Heater, Daniel L.; Peeples, Steven R.; Sules. James K.; Huang, Po-Hao Adam

    2013-01-01

    A cubesat attitude control system (ACS) was designed at the NASA Marshall Space Flight Center (MSFC) to provide sub-degree pointing capabilities using low cost, COTS attitude sensors, COTS miniature reaction wheels, and a developmental micro-propulsion system. The ACS sensors and actuators were integrated onto a 3D-printed plastic 3U cubesat breadboard (10 cm x 10 cm x 30 cm) with a custom designed instrument board and typical cubesat COTS hardware for the electrical, power, and data handling and processing systems. In addition to the cubesat development, a low-cost air bearing was designed and 3D printed in order to float the cubesat in the test environment. Systems integration and verification were performed at the MSFC Small Projects Rapid Integration & Test Environment laboratory. Using a combination of both the miniature reaction wheels and the micro-propulsion system, the open and closed loop control capabilities of the ACS were tested in the Flight Robotics Laboratory. The testing demonstrated the desired sub-degree pointing capability of the ACS and also revealed the challenges of creating a relevant environment for development testin

  12. Hybrid vehicle turbine engine technology support (HVTE-TS) project. 1995--1996 annual report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    This report presents a summary of technical work accomplished on the Hybrid Vehicle Turbine Engine--Technology Support (HVTE-TS) Project during calendar years 1995 and 1996. Work was performed under an initial National Aeronautics and Space Administration (NASA) contract DEN3-336. As of September 1996 the contract administration was transferred to the US Department of Energy (DoE) Chicago Operations Office, and renumbered as DE-AC02-96EE50553. The purpose of the HVTE-TS program is to develop gas turbine engine technology in support of DoE and automotive industry programs exploring the use of gas turbine generator sets in hybrid-electric automotive propulsion systems. The program focus is directed to the development of four key technologies to be applied to advanced turbogenerators for hybrid vehicles: Structural ceramic materials and processes; Low emissions combustion systems; Regenerators and seals systems; and Insulation systems and processes. 60 figs., 9 tabs.

  13. Characterization of tetraaza-AC8, a surfactant with cation complexing potential

    International Nuclear Information System (INIS)

    Arleth, Lise

    1995-01-01

    Being a surfactant with cation complexing potential, the Tetraaza-AC8 can, in the long term, possibly be applied for the selection and extraction of specific cations. This can be of interest for the handling of radioactive waste or in the chemical industries for extraction of rare earth molecules as for example Rhodium. A thorough characterization of the behavior and abilities of Tetraaza-AC8 is necessary before one can even think of taking it into a larger production with sight of a specific application. This project deals with the characterization of the behavior and abilities of Tetraaza- AC8. In order to make use of the surface active properties of Tetraaza-AC8 it is necessary to dissolve it in some kind of solvent. As water is an important solvent which is, in addition, both inexpensive and non-polluting it is the natural choice. The aim of the project can then precised as follows: To study the micelle formation of dilute aqueous solutions of Tetraaza- AC8 and to determine how the micelle formation is influenced by the addition of respectively CsF, CuF_2 and RhCl_3 to the solutions The primary method of analysis is small-angle scattering. As small-angle x-ray scattering (SAXS) and small-angle neutron scattering (SANS) emphasizes different parts of the micellar structure, the combination of the methods allows a good determination of the micellar shape. In order to support the interpretation of scattering data, density measurements, surface tension measurements and UV/visible light spectroscopy are also performed. The scattering data have been analyzed according to two fundamentally different methods of analysis namely the method of indirect Fourier transform and the method of fitting molecular based models of the micelles to the scattering spectra. The first chapter contains a short introduction to the field of surfactants and complexing macrocycles. The chemical structure of Tetraaza-AC8 will be explained and motivated. A short description of the synthesis

  14. Low Offset AC Correlator.

    Science.gov (United States)

    This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

  15. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  16. Optimization of extended propulsion time nuclear-electric propulsion trajectories

    Science.gov (United States)

    Sauer, C. G., Jr.

    1981-01-01

    This paper presents the methodology used in optimizing extended propulsion time NEP missions considering realistic thruster lifetime constraints. These missions consist of a powered spiral escape from a 700-km circular orbit at the earth, followed by a powered heliocentric transfer with an optimized coast phase, and terminating in a spiral capture phase at the target planet. This analysis is most applicable to those missions with very high energy requirements such as outer planet orbiter missions or sample return missions where the total propulsion time could greatly exceed the expected lifetime of an individual thruster. This methodology has been applied to the investigation of NEP missions to the outer planets where examples are presented of both constrained and optimized trajectories.

  17. An Overview of Cube-Satellite Propulsion Technologies and Trends

    Directory of Open Access Journals (Sweden)

    Akshay Reddy Tummala

    2017-12-01

    Full Text Available CubeSats provide a cost effective means to perform scientific and technological studies in space. Due to their affordability, CubeSat technologies have been diversely studied and developed by educational institutions, companies and space organizations all over the world. The CubeSat technology that is surveyed in this paper is the propulsion system. A propulsion system is the primary mobility device of a spacecraft and helps with orbit modifications and attitude control. This paper provides an overview of micro-propulsion technologies that have been developed or are currently being developed for CubeSats. Some of the micro-propulsion technologies listed have also flown as secondary propulsion systems on larger spacecraft. Operating principles and key design considerations for each class of propulsion system are outlined. Finally, the performance factors of micro-propulsion systems have been summarized in terms of: first, a comparison of thrust and specific impulse for all propulsion systems; second, a comparison of power and specific impulse, as also thrust-to-power ratio and specific impulse for electric propulsion systems.

  18. High-Lift Propeller System Configuration Selection for NASA's SCEPTOR Distributed Electric Propulsion Flight Demonstrator

    Science.gov (United States)

    Patterson, Michael D.; Derlaga, Joseph M.; Borer, Nicholas K.

    2016-01-01

    Although the primary function of propellers is typically to produce thrust, aircraft equipped with distributed electric propulsion (DEP) may utilize propellers whose main purpose is to act as a form of high-lift device. These \\high-lift propellers" can be placed upstream of wing such that, when the higher-velocity ow in the propellers' slipstreams interacts with the wing, the lift is increased. This technique is a main design feature of a new NASA advanced design project called Scalable Convergent Electric Propulsion Technology Operations Research (SCEPTOR). The goal of the SCEPTOR project is design, build, and y a DEP aircraft to demonstrate that such an aircraft can be much more ecient than conventional designs. This paper provides details into the high-lift propeller system con guration selection for the SCEPTOR ight demonstrator. The methods used in the high-lift propeller system conceptual design and the tradeo s considered in selecting the number of propellers are discussed.

  19. Propulsion of liposomes using bacterial motors

    International Nuclear Information System (INIS)

    Zhang Zhenhai; Li Kejie; Li Zhifei; Yu Wei; Xie Zhihong; Shi Zhiguo

    2013-01-01

    Here we describe the utilization of flagellated bacteria as actuators to propel spherical liposomes by attaching bacteria to the liposome surface. Bacteria were stably attached to liposomes using a cross-linking antibody. The effect of the number of attached bacteria on propulsion speed was experimentally determined. The effects of bacterial propulsion on the bacteria–antibody–liposome complex were stochastic. We demonstrated that liposomal mobility increased when bacteria were attached, and the propulsion speed correlated with the number of bacteria. (paper)

  20. Exotic power and propulsion concepts

    International Nuclear Information System (INIS)

    Forward, R.L.

    1990-01-01

    The status of some exotic physical phenomena and unconventional spacecraft concepts that might produce breakthroughs in power and propulsion in the 21st Century are reviewed. The subjects covered include: electric, nuclear fission, nuclear fusion, antimatter, high energy density materials, metallic hydrogen, laser thermal, solar thermal, solar sail, magnetic sail, and tether propulsion

  1. Data Mining for ISHM of Liquid Rocket Propulsion Status Update

    Science.gov (United States)

    Srivastava, Ashok; Schwabacher, Mark; Oza, Nijunj; Martin, Rodney; Watson, Richard; Matthews, Bryan

    2006-01-01

    This document consists of presentation slides that review the current status of data mining to support the work with the Integrated Systems Health Management (ISHM) for the systems associated with Liquid Rocket Propulsion. The aim of this project is to have test stand data from Rocketdyne to design algorithms that will aid in the early detection of impending failures during operation. These methods will be extended and improved for future platforms (i.e., CEV/CLV).

  2. Operationally efficient propulsion system study (OEPSS) data book. Volume 6; Space Transfer Propulsion Operational Efficiency Study Task of OEPSS

    Science.gov (United States)

    Harmon, Timothy J.

    1992-01-01

    This document is the final report for the Space Transfer Propulsion Operational Efficiency Study Task of the Operationally Efficient Propulsion System Study (OEPSS) conducted by the Rocketdyne Division of Rockwell International. This Study task studied, evaluated and identified design concepts and technologies which minimized launch and in-space operations and optimized in-space vehicle propulsion system operability.

  3. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  4. Main Propulsion Test Article (MPTA)

    Science.gov (United States)

    Snoddy, Cynthia

    2010-01-01

    Scope: The Main Propulsion Test Article integrated the main propulsion subsystem with the clustered Space Shuttle Main Engines, the External Tank and associated GSE. The test program consisted of cryogenic tanking tests and short- and long duration static firings including gimbaling and throttling. The test program was conducted on the S1-C test stand (Position B-2) at the National Space Technology Laboratories (NSTL)/Stennis Space Center. 3 tanking tests and 20 hot fire tests conducted between December 21 1 1977 and December 17, 1980 Configuration: The main propulsion test article consisted of the three space shuttle main engines, flightweight external tank, flightweight aft fuselage, interface section and a boilerplate mid/fwd fuselage truss structure.

  5. Design and Development of a 200-kW Turbo-Electric Distributed Propulsion Testbed

    Science.gov (United States)

    Papathakis, Kurt V.; Kloesel, Kurt J.; Lin, Yohan; Clarke, Sean; Ediger, Jacob J.; Ginn, Starr

    2016-01-01

    The National Aeronautics and Space Administration (NASA) Armstrong Flight Research Center (AFRC) (Edwards, California) is developing a Hybrid-Electric Integrated Systems Testbed (HEIST) Testbed as part of the HEIST Project, to study power management and transition complexities, modular architectures, and flight control laws for turbo-electric distributed propulsion technologies using representative hardware and piloted simulations. Capabilities are being developed to assess the flight readiness of hybrid electric and distributed electric vehicle architectures. Additionally, NASA will leverage experience gained and assets developed from HEIST to assist in flight-test proposal development, flight-test vehicle design, and evaluation of hybrid electric and distributed electric concept vehicles for flight safety. The HEIST test equipment will include three trailers supporting a distributed electric propulsion wing, a battery system and turbogenerator, dynamometers, and supporting power and communication infrastructure, all connected to the AFRC Core simulation. Plans call for 18 high performance electric motors that will be powered by batteries and the turbogenerator, and commanded by a piloted simulation. Flight control algorithms will be developed on the turbo-electric distributed propulsion system.

  6. Nuclear merchant ship propulsion

    International Nuclear Information System (INIS)

    Schroeder, E.; Jager, W.; Schafstall, H.G.

    1977-01-01

    The operation of about 300 nuclear naval vessels has proven the feasibility of nuclear ship propulsion. Until now six non military ships have been built or are under construction. In the Soviet Union two nuclear icebreakers are in operation, and a third one is under construction. In the western world three prototype merchant ships have been built. Of these ships only the NS OTTO HAHN is in operation and provides valuable experience for future large scale use of nuclear merchant ship propulsion. In many countries studies and plans are made for future nuclear merchant ships. Types of vessels investigated are large containerships, tankers and specialized ships like icebreakers or ice-breaking ships. The future of nuclear merchant ship propulsion depends on three interrelated items: (1) nuclear ship technology; (2) economy of nuclear ship propulsion; (3) legal questions. Nuclear merchant ship technology is based until now on standard ship technology and light water reactor technology. Except for special questions due to the non-stationary type of the plant entirely new problems do not arise. This has been proven by the recent conceptual licensing procedure for a large nuclear containership in Germany. The economics of nuclear propulsion will be under discussion until they are proven by the operation of privately owned lead ships. Unsolved legal questions e.g. in connection with port entry permissions are at present another problem for nuclear shipping. Efforts are made to solve these questions on an international basis. The future development of nuclear energy electricity production in large land based plants will stimulate the employment of smaller units. Any future development of long distance sea transport will have to take this opportunity of a reliable and economic energy supply into account

  7. An Airbreathing Launch Vehicle Design with Turbine-Based Low-Speed Propulsion and Dual Mode Scramjet High-Speed Propulsion

    Science.gov (United States)

    Moses, P. L.; Bouchard, K. A.; Vause, R. F.; Pinckney, S. Z.; Ferlemann, S. M.; Leonard, C. P.; Taylor, L. W., III; Robinson, J. S.; Martin, J. G.; Petley, D. H.

    1999-01-01

    Airbreathing launch vehicles continue to be a subject of great interest in the space access community. In particular, horizontal takeoff and horizontal landing vehicles are attractive with their airplane-like benefits and flexibility for future space launch requirements. The most promising of these concepts involve airframe integrated propulsion systems, in which the external undersurface of the vehicle forms part of the propulsion flowpath. Combining of airframe and engine functions in this manner involves all of the design disciplines interacting at once. Design and optimization of these configurations is a most difficult activity, requiring a multi-discipline process to analytically resolve the numerous interactions among the design variables. This paper describes the design and optimization of one configuration in this vehicle class, a lifting body with turbine-based low-speed propulsion. The integration of propulsion and airframe, both from an aero-propulsive and mechanical perspective are addressed. This paper primarily focuses on the design details of the preferred configuration and the analyses performed to assess its performance. The integration of both low-speed and high-speed propulsion is covered. Structural and mechanical designs are described along with materials and technologies used. Propellant and systems packaging are shown and the mission-sized vehicle weights are disclosed.

  8. Hybrid AC-High Voltage DC Grid Stability and Controls

    Science.gov (United States)

    Yu, Jicheng

    The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

  9. Propulsive options for a manned Mars transportation system

    International Nuclear Information System (INIS)

    Braun, R.D.; Blersch, D.J.

    1989-01-01

    In this investigation, five potential manned Mars transportation systems are compared. These options include: (1) a single vehicle, chemically propelled (CHEM) option, (2) a single vehicle, nuclear thermal propulsion (NTP) option, (3) a single vehicle solar electric propulsion (SEP) option, (4) a single vehicle hybrid nuclear electric propulsion (NEP)/CHEM option, and (5) a dual vehicle option (NEP cargo spacecraft and CHEM manned vehicle). In addition to utilizing the initial vehicle weight in low-earth orbit as a measure of mission feasibility, this study addresses the major technological barriers each propulsive scenario must surpass. It is shown that instead of a single clearly superior propulsion system, each means of propulsion may be favored depending upon the specified program policy and the extent of the desired manned flight time. Furthermore, the effect which aerobraking and multiple transfer cycles have upon mission feasibility is considered. 18 refs

  10. An Overview of 2014 SBIR Phase 1 and Phase 2 Air-Breathing Propulsion

    Science.gov (United States)

    Nguyen, Hung D.; Steele, Gynelle C.; Morris, Jessica R.

    2015-01-01

    NASA's Small Business Innovation Research (SBIR) program focuses on technological innovation by investing in development of innovative concepts and technologies to help NASA mission directorates address critical research needs for Agency programs. This report highlights nine of the innovative SBIR 2014 Phase I and Phase II projects that emphasize one of NASA Glenn Research Center's six core competencies-Air-Breathing Propulsion. The technologies cover a wide spectrum of applications such as development of X-ray computed tomography (CT) imaging method for the measurement of complex 3D ice shapes, phased array techniques for low signal-to-noise ratio wind tunnels, compact kinetic mechanisms for petroleum-derived and alternative aviation fuels, and hybrid electric propulsion systems for a multirotor aircraft. Each featured technology describes an innovation, technical objective, and highlights NASA commercial and industrial applications. This report provides as an opportunity for NASA engineers, researchers, and program managers to learn how NASA SBIR technologies could help their programs and projects, and lead to collaborations and partnerships between the small SBIR companies and NASA that would benefit both.

  11. The project of the submarine of nuclear propulsion under the optics of its protagonists: an historical analysis from Geisel to Lula 1974 - 2009

    International Nuclear Information System (INIS)

    Correa, Fernanda das Gracas

    2009-01-01

    This work is a historical analysis of the project of construction of the submarine of nuclear propulsion under the optics of the people who direct or had indirectly become involved themselves with it. Geisel undertook a more autonomous type of politics. The Europe started to be the strategical region for the acquisition of nuclear technology. The only favorable country transfer nuclear technology to Brazil was the Federal Republic of Germany (FRG). The idea to construct a nuclear submarine is product of the negotiations between authorities of Brazilian politics and political, diplomatical, scientific and business authorities of the FRG. In 1978, the engineer Othon Luiz Pinheiro da Silva came back to Brazil after completing his doctorate in nuclear technology in the MIT. Commander Othon developed the idea to construct a nuclear submarine in the Brazilian Navy. Due to the events in the national and in the international scenario, Geisel decided to construct the nuclear submarine, but he opted to allow the Brazilian Navy to lead this construction. Although Geisel sketched a project of naval nuclear propulsion, it was the project elaborated by commander Othon which became the nuclear project of the Brazilian Navy. In order to prevent international attention toward this work, Geisel guided it for the subversion. This way, the idea to construct a nuclear submarine ceases to belong to the Brazilian nuclear program to become parallel nuclear program. When Figueiredo became president he kept the diversification politics of partnerships, kept the nuclear Agreement Brazil-FRG in 1975 and kept the project of construction of a nuclear reactor. Figueiredo, after observing the performance of the English nuclear submarines in the south Atlantic and to perceive the real intentions of U.S.A. towards Brazil, Figueiredo decided to support politically and financially and the project of construction of the nuclear submarine. Despite all aversion that Figueiredo had in relation to

  12. Distributed propulsion for ships

    OpenAIRE

    Nylund, Vilde

    2017-01-01

    It is anticipated that using distributed electric propulsion (DEP) on conventional ships will increase the total propulsive efficiency. This is mainly due to two reasons; firstly, because the total propeller disk area can be increased. Secondly, because each propeller can be optimised for the local wake where it is operating. In this work, the benefits of using DEP has been investigated for a 14 000 TEU container ship. Based on a literary study of the present state of propeller modelling ...

  13. A novel nuclear-powered propulsion system for ship

    International Nuclear Information System (INIS)

    Liu Tao; Han Weishi

    2003-01-01

    A novel nuclear-powered propulsion system for ship is presented in this paper. In this system, a minitype liquid sodium-cooled reactor is used as power; alkali-metal thermal-to-electric conversion (AMTEC) cells are utilized to transform the heat energy to electric energy and superconducting magneto-hydrodynamic (MHD) work as propulsion. This nuclear-powered propulsion system has great advantages in low noise, high speed, long survivability and simple manipulation. It has great significance for the development of propulsion system. (author)

  14. Center for Advanced Space Propulsion Second Annual Technical Symposium Proceedings

    Science.gov (United States)

    1990-01-01

    The proceedings for the Center for Advanced Space Propulsion Second Annual Technical Symposium are divided as follows: Chemical Propulsion, CFD; Space Propulsion; Electric Propulsion; Artificial Intelligence; Low-G Fluid Management; and Rocket Engine Materials.

  15. FLUIDIC AC AMPLIFIERS.

    Science.gov (United States)

    Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

  16. An Investigation of Bilateral Symmetry During Manual Wheelchair Propulsion.

    Science.gov (United States)

    Soltau, Shelby L; Slowik, Jonathan S; Requejo, Philip S; Mulroy, Sara J; Neptune, Richard R

    2015-01-01

    Studies of manual wheelchair propulsion often assume bilateral symmetry to simplify data collection, processing, and analysis. However, the validity of this assumption is unclear. Most investigations of wheelchair propulsion symmetry have been limited by a relatively small sample size and a focus on a single propulsion condition (e.g., level propulsion at self-selected speed). The purpose of this study was to evaluate bilateral symmetry during manual wheelchair propulsion in a large group of subjects across different propulsion conditions. Three-dimensional kinematics and handrim kinetics along with spatiotemporal variables were collected and processed from 80 subjects with paraplegia while propelling their wheelchairs on a stationary ergometer during three different conditions: level propulsion at their self-selected speed (free), level propulsion at their fastest comfortable speed (fast), and propulsion on an 8% grade at their level, self-selected speed (graded). All kinematic variables had significant side-to-side differences, primarily in the graded condition. Push angle was the only spatiotemporal variable with a significant side-to-side difference, and only during the graded condition. No kinetic variables had significant side-to-side differences. The magnitudes of the kinematic differences were low, with only one difference exceeding 5°. With differences of such small magnitude, the bilateral symmetry assumption appears to be reasonable during manual wheelchair propulsion in subjects without significant upper-extremity pain or impairment. However, larger asymmetries may exist in individuals with secondary injuries and pain in their upper extremity and different etiologies of their neurological impairment.

  17. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

  18. Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

    International Nuclear Information System (INIS)

    Fang Minggang; Nie, Yingchao; Theilmann, David A.

    2009-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

  19. An overview of the NASA Advanced Propulsion Concepts program

    International Nuclear Information System (INIS)

    Curran, F.M.; Bennett, G.L.; Frisbee, R.H.; Sercel, J.C.; Lapointe, M.R.

    1992-07-01

    NASA Advanced Propulsion Concepts (APC) program for the development of long-term space propulsion system schemes is managed by both NASA-Lewis and the JPL and is tasked with the identification and conceptual development of high-risk/high-payoff configurations. Both theoretical and experimental investigations have been undertaken in technology areas deemed essential to the implementation of candidate concepts. These APC candidates encompass very high energy density chemical propulsion systems, advanced electric propulsion systems, and an antiproton-catalyzed nuclear propulsion concept. A development status evaluation is presented for these systems. 45 refs

  20. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  1. 46 CFR 121.620 - Propulsion engine control systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Propulsion engine control systems. 121.620 Section 121... Propulsion engine control systems. (a) A vessel must have two independent means of controlling each propulsion engine. Control must be provided for the engine speed, direction of shaft rotation, and engine...

  2. A novel power control strategy of Modular Multi-level Converter in HVDC-AC hybrid transmission systems for passive networks

    DEFF Research Database (Denmark)

    Hu, Zhenda; Wu, Rui; Yang, Xiaodong

    2014-01-01

    With the development of High Voltage DC Transmission (HVDC) technology, there will be more and more HVDC-AC hybrid transmission system in the world. A basic challenge in HVDC-AC hybrid transmission systems is to optimize the power sharing between DC and AC lines, which become more severe when sup...... control strategy of Modular Multi-level Converter in VSC-HVDC, which can optimize converter output power according to passive network loading variation. Proposal method is studied with a case study of a VSC-HVDC AC hybrid project by PSCAD/EMTDC simulations....

  3. Monofilament Vaporization Propulsion (MVP) System, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Monofilament Vaporization Propulsion (MVP) is a new propulsion technology targeted at secondary payload applications. It does not compromise on performance while...

  4. 46 CFR 184.620 - Propulsion engine control systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Propulsion engine control systems. 184.620 Section 184... Communications Systems § 184.620 Propulsion engine control systems. (a) A vessel must have two independent means of controlling each propulsion engine. Control must be provided for the engine speed, direction of...

  5. In-Space Propulsion Technologies for Robotic Exploration of the Solar System

    Science.gov (United States)

    Johnson, Les; Meyer, Rae Ann; Frame, Kyle

    2006-01-01

    Supporting NASA's Science Mission Directorate, the In-Space Propulsion Technology Program is developing the next generation of space propulsion technologies for robotic, deep-space exploration. Recent technological advancements and demonstrations of key, high-payoff propulsion technologies have been achieved and will be described. Technologies under development and test include aerocapture, solar electric propulsion, solar sail propulsion, and advanced chemical propulsion.

  6. Fabrication and Testing of CERMET Fuel Materials for Nuclear Thermal Propulsion

    Science.gov (United States)

    Hickman, Robert; Broadway, Jeramie; Mireles, Omar

    2012-01-01

    A first generation Nuclear Cryogenic Propulsion Stage (NCPS) based on Nuclear Thermal Propulsion (NTP) is currently being developed for Advanced Space Exploration Systems. The overall goal of the project is to address critical NTP technology challenges and programmatic issues to establish confidence in the affordability and viability of NTP systems. The current technology roadmap for NTP identifies the development of a robust fuel form as a critical near term need. The lack of a qualified nuclear fuel is a significant technical risk that will require a considerable fraction of program resources to mitigate. Due to these risks and the cost for qualification, the development and selection of a primary fuel must begin prior to Authority to Proceed (ATP) for a specific mission. The fuel development is a progressive approach to incrementally reduce risk, converge the fuel materials, and mature the design and fabrication process of the fuel element. A key objective of the current project is to advance the maturity of CERMET fuels. The work includes fuel processing development and characterization, fuel specimen hot hydrogen screening, and prototypic fuel element testing. Early fuel materials development is critical to help validate requirements and fuel performance. The purpose of this paper is to provide an overview and status of the work at Marshall Space Flight Center (MSFC).

  7. Modifications in Wheelchair Propulsion Technique with Speed.

    Science.gov (United States)

    Russell, Ian M; Raina, Shashank; Requejo, Philip S; Wilcox, Rand R; Mulroy, Sara; McNitt-Gray, Jill L

    2015-01-01

    Repetitive loading of the upper limb joints during manual wheelchair (WC) propulsion (WCP) has been identified as a factor that contributes to shoulder pain, leading to loss of independence and decreased quality of life. The purpose of this study was to determine how individual manual WC users with paraplegia modify propulsion mechanics to accommodate expected increases in reaction forces (RFs) generated at the pushrim with self-selected increases in WCP speed. Upper extremity kinematics and pushrim RFs were measured for 40 experienced manual WC users with paraplegia while propelling on a stationary ergometer at self-selected free and fast propulsion speeds. Upper extremity kinematics and kinetics were compared within subject between propulsion speeds. Between group and within-subject differences were determined (α = 0.05). Increased propulsion speed was accompanied by increases in RF magnitude (22 of 40, >10 N) and shoulder net joint moment (NJM, 15 of 40, >10 Nm) and decreases in pushrim contact duration. Within-subject comparison indicated that 27% of participants modified their WCP mechanics with increases in speed by regulating RF orientation relative to the upper extremity segments. Reorientation of the RF relative to the upper extremity segments can be used as an effective strategy for mitigating rotational demands (NJM) imposed on the shoulder at increased propulsion speeds. Identification of propulsion strategies that individuals can use to effectively accommodate for increases in RFs is an important step toward preserving musculoskeletal health of the shoulder and improving health-related quality of life.

  8. Innovative Approaches to Development and Ground Testing of Advanced Bimodal Space Power and Propulsion Systems

    International Nuclear Information System (INIS)

    Hill, T.; Noble, C.; Martinell, J.; Borowski, S.

    2000-01-01

    The last major development effort for nuclear power and propulsion systems ended in 1993. Currently, there is not an initiative at either the National Aeronautical and Space Administration (NASA) or the U.S. Department of Energy (DOE) that requires the development of new nuclear power and propulsion systems. Studies continue to show nuclear technology as a strong technical candidate to lead the way toward human exploration of adjacent planets or provide power for deep space missions, particularly a 15,000 lbf bimodal nuclear system with 115 kW power capability. The development of nuclear technology for space applications would require technology development in some areas and a major flight qualification program. The last major ground test facility considered for nuclear propulsion qualification was the U.S. Air Force/DOE Space Nuclear Thermal Propulsion Project. Seven years have passed since that effort, and the questions remain the same, how to qualify nuclear power and propulsion systems for future space flight. It can be reasonably assumed that much of the nuclear testing required to qualify a nuclear system for space application will be performed at DOE facilities as demonstrated by the Nuclear Rocket Engine Reactor Experiment (NERVA) and Space Nuclear Thermal Propulsion (SNTP) programs. The nuclear infrastructure to support testing in this country is aging and getting smaller, though facilities still exist to support many of the technology development needs. By renewing efforts, an innovative approach to qualifying these systems through the use of existing facilities either in the U.S. (DOE's Advance Test Reactor, High Flux Irradiation Facility and the Contained Test Facility) or overseas should be possible

  9. Innovation Approaches to Development and Ground Testing of Advanced Bimodal Space Power and Propulsion Systems

    Energy Technology Data Exchange (ETDEWEB)

    Hill, T.; Noble, C.; Martinell, J. (INEEL); Borowski, S. (NASA Glenn Research Center)

    2000-07-14

    The last major development effort for nuclear power and propulsion systems ended in 1993. Currently, there is not an initiative at either the National Aeronautical and Space Administration (NASA) or the U.S. Department of Energy (DOE) that requires the development of new nuclear power and propulsion systems. Studies continue to show nuclear technology as a strong technical candidate to lead the way toward human exploration of adjacent planets or provide power for deep space missions, particularly a 15,000 lbf bimodal nuclear system with 115 kW power capability. The development of nuclear technology for space applications would require technology development in some areas and a major flight qualification program. The last major ground test facility considered for nuclear propulsion qualification was the U.S. Air Force/DOE Space Nuclear Thermal Propulsion Project. Seven years have passed since that effort, and the questions remain the same, how to qualify nuclear power and propulsion systems for future space flight. It can be reasonably assumed that much of the nuclear testing required to qualify a nuclear system for space application will be performed at DOE facilities as demonstrated by the Nuclear Rocket Engine Reactor Experiment (NERVA) and Space Nuclear Thermal Propulsion (SNTP) programs. The nuclear infrastructure to support testing in this country is aging and getting smaller, though facilities still exist to support many of the technology development needs. By renewing efforts, an innovative approach to qualifying these systems through the use of existing facilities either in the U.S. (DOE's Advance Test Reactor, High Flux Irradiation Facility and the Contained Test Facility) or overseas should be possible.

  10. Innovative Approaches to Development and Ground Testing of Advanced Bimodal Space Power and Propulsion Systems

    Energy Technology Data Exchange (ETDEWEB)

    Hill, Thomas Johnathan; Noble, Cheryl Ann; Noble, C.; Martinell, John Stephen; Borowski, S.

    2000-07-01

    The last major development effort for nuclear power and propulsion systems ended in 1993. Currently, there is not an initiative at either the National Aeronautical and Space Administration (NASA) or the U.S. Department of Energy (DOE) that requires the development of new nuclear power and propulsion systems. Studies continue to show nuclear technology as a strong technical candidate to lead the way toward human exploration of adjacent planets or provide power for deep space missions, particularly a 15,000 lbf bimodal nuclear system with 115 kW power capability. The development of nuclear technology for space applications would require technology development in some areas and a major flight qualification program. The last major ground test facility considered for nuclear propulsion qualification was the U.S. Air Force/DOE Space Nuclear Thermal Propulsion Project. Seven years have passed since that effort, and the questions remain the same, how to qualify nuclear power and propulsion systems for future space flight. It can be reasonable assumed that much of the nuclear testing required to qualify a nuclear system for space application will be performed at DOE facilities as demonstrated by the Nuclear Rocket Engine Reactor Experiment (NERVA) and Space Nuclear Thermal Propulsion (SNTP) programs. The nuclear infrastructure to support testing in this country is aging and getting smaller, though facilities still exist to support many of the technology development needs. By renewing efforts, an innovative approach to qualifying these systems through the use of existing facilities either in the U.S. (DOE's Advance Test Reactor, High Flux Irradiation Facility and the Contained Test Facility) or overseas should be possible.

  11. Beamed-Energy Propulsion (BEP) Study

    Science.gov (United States)

    George, Patrick; Beach, Raymond

    2012-01-01

    The scope of this study was to (1) review and analyze the state-of-art in beamed-energy propulsion (BEP) by identifying potential game-changing applications, (2) formulate a roadmap of technology development, and (3) identify key near-term technology demonstrations to rapidly advance elements of BEP technology to Technology Readiness Level (TRL) 6. The two major areas of interest were launching payloads and space propulsion. More generally, the study was requested and structured to address basic mission feasibility. The attraction of beamed-energy propulsion (BEP) is the potential for high specific impulse while removing the power-generation mass. The rapid advancements in high-energy beamed-power systems and optics over the past 20 years warranted a fresh look at the technology. For launching payloads, the study concluded that using BEP to propel vehicles into space is technically feasible if a commitment to develop new technologies and large investments can be made over long periods of time. From a commercial competitive standpoint, if an advantage of beamed energy for Earth-to-orbit (ETO) is to be found, it will rest with smaller, frequently launched payloads. For space propulsion, the study concluded that using beamed energy to propel vehicles from low Earth orbit to geosynchronous Earth orbit (LEO-GEO) and into deep space is definitely feasible and showed distinct advantages and greater potential over current propulsion technologies. However, this conclusion also assumes that upfront infrastructure investments and commitments to critical technologies will be made over long periods of time. The chief issue, similar to that for payloads, is high infrastructure costs.

  12. NASA Propulsion Sub-System Concept Studies and Risk Reduction Activities for Resource Prospector Lander

    Science.gov (United States)

    Trinh, Huu P.

    2015-01-01

    NASA's exploration roadmap is focused on developing technologies and performing precursor missions to advance the state of the art for eventual human missions to Mars. One of the key components of this roadmap is various robotic missions to Near-Earth Objects, the Moon, and Mars to fill in some of the strategic knowledge gaps. The Resource Prospector (RP) project is one of these robotic precursor activities in the roadmap. RP is a multi-center and multi-institution project to investigate the polar regions of the Moon in search of volatiles. The mission is rated Class D and is approximately 10 days, assuming a five day direct Earth to Moon transfer. Because of the mission cost constraint, a trade study of the propulsion concepts was conducted with a focus on available low-cost hardware for reducing cost in development, while technical risk, system mass, and technology advancement requirements were also taken into consideration. The propulsion system for the lander is composed of a braking stage providing a high thrust to match the lander's velocity with the lunar surface and a lander stage performing the final lunar descent. For the braking stage, liquid oxygen (LOX) and liquid methane (LCH4) propulsion systems, derived from the Morpheus experimental lander, and storable bi-propellant systems, including the 4th stage Peacekeeper (PK) propulsion components and Space Shuttle orbital maneuvering engine (OME), and a solid motor were considered for the study. For the lander stage, the trade study included miniaturized Divert Attitude Control System (DACS) thrusters (Missile Defense Agency (MDA) heritage), their enhanced thruster versions, ISE-100 and ISE-5, and commercial-off-the-shelf (COTS) hardware. The lowest cost configuration of using the solid motor and the PK components while meeting the requirements was selected. The reference concept of the lander is shown in Figure 1. In the current reference configuration, the solid stage is the primary provider of delta

  13. Sistema remot de monitoratge cardíac implementat amb programari lliure

    OpenAIRE

    Fornons Ortega, Daniel

    2016-01-01

    Aquest projecte té com a objectiu crear un sistema de monitoratge de baix cost que permeti als usuaris enregistrar el ritme cardíac (RC) i la variabilitat de la freqüència cardíaca (VFC) i compartir-los. A més a més, el sistema creat també es útil en el camp de l'esport per a monitorar els entrenaments dels esportistes i detectar diferents fases de la preparació com l'afinament o el sobreentrenament. Per obtenir les dades de RC i VFC s'utilitza una cinta amb un sensor de ritme cardíac comerci...

  14. AC susceptibility of thin Pb films in intermediate and mixed state

    Czech Academy of Sciences Publication Activity Database

    Janů, Zdeněk; Švindrych, Zdeněk; Truněček, O.; Kúš, P.; Plecenik, A.

    2011-01-01

    Roč. 471, 23-24 (2011), s. 1647-1650 ISSN 0921-4534 R&D Projects: GA MŠk(CZ) ME10069 Institutional research plan: CEZ:AV0Z10100520 Keywords : intermediate state * mixed state * AC susceptibility Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.014, year: 2011

  15. Propulsion controlled aircraft computer

    Science.gov (United States)

    Cogan, Bruce R. (Inventor)

    2010-01-01

    A low-cost, easily retrofit Propulsion Controlled Aircraft (PCA) system for use on a wide range of commercial and military aircraft consists of an propulsion controlled aircraft computer that reads in aircraft data including aircraft state, pilot commands and other related data, calculates aircraft throttle position for a given maneuver commanded by the pilot, and then displays both current and calculated throttle position on a cockpit display to show the pilot where to move throttles to achieve the commanded maneuver, or is automatically sent digitally to command the engines directly.

  16. The effect of wheelchair propulsion style on changes in time spent in extreme wrist orientations after a bout of fatiguing propulsion.

    Science.gov (United States)

    Zukowski, Lisa A; Hass, Chris J; Shechtman, Orit; Christou, Evangelos A; Tillman, Mark D

    2017-10-01

    This study compared how wheelchair propulsion styles affect changes in percentage of time spent in extreme wrist orientations, which have been associated with median nerve injury, after a fatiguing bout of propulsion. Twenty novice, non-disabled adult males learned arcing (ARC) and semicircular (SEMI) propulsion styles and utilised each to perform a wheelchair fatigue protocol. ARC and SEMI did not significantly differ in terms of changes after the fatigue protocol in percentage of time spent in extreme flexion/extension or radial/ulnar deviation at the push phase beginning or end. A pattern was observed, although not significant, of greater increases in percentage of time spent in extreme wrist extension and ulnar deviation during the push phase beginning and ulnar deviation during the push phase end while utilising SEMI relative to ARC. This study evinces that individual differences are greater than observed changes in extreme wrist orientations for both propulsion styles. Practitioner Summary: How wheelchair propulsion styles change with fatigue in terms of extreme wrist orientations was examined. This study evinces that individual differences are greater than observed changes in extreme wrist orientations for both propulsion styles and point towards the need for future research on individual differences utilising propulsion styles.

  17. Reactor physics in support of the naval nuclear propulsion programme

    International Nuclear Information System (INIS)

    Lisley, P.G.; Beeley, P.A.

    1994-01-01

    Reactor physics is a core component of all courses but in particular two postgraduate courses taught at the department in support of the naval nuclear propulsion programme. All of the courses include the following elements: lectures and problem solving exercises, laboratory work, experiments on the Jason zero power Argonaut reactor, demonstration of PWR behavior on a digital computer simulator and project work. This paper will highlight the emphasis on reactor physics in all elements of the education and training programme. (authors). 9 refs

  18. 46 CFR 109.555 - Propulsion boilers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Propulsion boilers. 109.555 Section 109.555 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Miscellaneous § 109.555 Propulsion boilers. The master or person in charge and the engineer in charge shall...

  19. 46 CFR 130.120 - Propulsion control.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Propulsion control. 130.120 Section 130.120 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS VESSEL CONTROL, AND MISCELLANEOUS EQUIPMENT AND SYSTEMS Vessel Control § 130.120 Propulsion control. (a) Each vessel must have— (1...

  20. Is effective force application in handrim wheelchair propulsion also efficient?

    NARCIS (Netherlands)

    Bregman, D.J.J.; van Drongelen, S.V.; Veeger, H.E.J.

    2009-01-01

    Background: Efficiency in manual wheelchair propulsion is low, as is the fraction of the propulsion force that is attributed to the moment of propulsion of the wheelchair. In this study we tested the hypothesis that a tangential propulsion force direction leads to an increase in physiological cost,

  1. ACS production: optimal design of solar thermal power plants; Produccion de ACS. Optimizacion del dimensionado de instalaciones de energia solar termica

    Energy Technology Data Exchange (ETDEWEB)

    Platon Arias, L.; San Jose Alonso, F.

    2009-07-01

    The aim of this project is to develop a program to size solar thermal power plants for the production of the company ACS, which enable optimum value calculations of the different influence parameters (surface, inclination, orientation, energy input) advising diverse circumstances and requirements. The energy input calculation has been effected according to f-chart method. For the solar radiation on inclined and oriented surfaces calculation, has been applied the Klein Method. (Author) 14 refs.

  2. Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

    Science.gov (United States)

    Luczak, Susan E; Rosen, I Gary

    2014-08-01

    Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

  3. A cermet fuel reactor for nuclear thermal propulsion

    International Nuclear Information System (INIS)

    Kruger, G.

    1991-01-01

    Work on the cermet fuel reactor done in the 1960's by General Electric (GE) and the Argonne National Laboratory (ANL) that had as its goal the development of systems that could be used for nuclear rocket propulsion as well as closed cycle propulsion system designs for ship propulsion, space nuclear propulsion, and other propulsion systems is reviewed. It is concluded that we can have excellent thermal and mechanical performance with cermet fuel. Thousands of hours of testing were performed on the cermet fuel at both GE and AGL, including very rapid transients and some radiation performance history. We conclude that there are no feasibility issues with cermet fuel. What is needed is reactivation of existing technology and qualification testing of a specific fuel form. We believe this can be done with a minimum development risk

  4. Overview and future prospects of laser plasma propulsion technology

    International Nuclear Information System (INIS)

    Zheng Zhiyuan; Lu Xin; Zhang Jie

    2003-01-01

    Due to its high cost, low efficiency, complex operation and unsatisfactory recycling, traditional rocket propulsion by chemical fuels has hindered the exploration of outer space to further limits. With the rapid development of laser and space technology, the new technology of laser propulsion exhibits unique advantages and prospects. The mechanism and current development of laser plasma propulsion are reviewed, with mention of the technical problems and focus issues of laser plasma in micro-flight propulsion

  5. Fitting aerodynamics and propulsion into the puzzle

    Science.gov (United States)

    Johnston, Patrick J.; Whitehead, Allen H., Jr.; Chapman, Gary T.

    1987-01-01

    The development of an airbreathing single-stage-to-orbit vehicle, in particular the problems of aerodynamics and propulsion integration, is examined. The boundary layer transition on constant pressure surfaces at hypersonic velocities, and the effects of noise on the transition are investigated. The importance of viscosity, real-gas effects, and drag at hypersonic speeds is discussed. A propulsion system with sufficient propulsive lift to enhance the performance of the vehicle is being developed. The difficulties of engine-airframe integration are analyzed.

  6. Ultrasonic propulsion of kidney stones.

    Science.gov (United States)

    May, Philip C; Bailey, Michael R; Harper, Jonathan D

    2016-05-01

    Ultrasonic propulsion is a novel technique that uses short bursts of focused ultrasonic pulses to reposition stones transcutaneously within the renal collecting system and ureter. The purpose of this review is to discuss the initial testing of effectiveness and safety, directions for refinement of technique and technology, and opinions on clinical application. Preclinical studies with a range of probes, interfaces, and outputs have demonstrated feasibility and consistent safety of ultrasonic propulsion with room for increased outputs and refinement toward specific applications. Ultrasonic propulsion was used painlessly and without adverse events to reposition stones in 14 of 15 human study participants without restrictions on patient size, stone size, or stone location. The initial feasibility study showed applicability in a range of clinically relevant situations, including facilitating passage of residual fragments following ureteroscopy or shock wave lithotripsy, moving a large stone at the ureteropelvic junction with relief of pain, and differentiating large stones from a collection of small fragments. Ultrasonic propulsion shows promise as an office-based system for transcutaneously repositioning kidney stones. Potential applications include facilitating expulsion of residual fragments following ureteroscopy or shock wave lithotripsy, repositioning stones prior to treatment, and repositioning obstructing ureteropelvic junction stones into the kidney to alleviate acute renal colic.

  7. Hybrid-electric propulsion for automotive and aviation applications

    OpenAIRE

    Friedrich, C; Robertson, Paul Andrew

    2014-01-01

    In parallel with the automotive industry, hybrid-electric propulsion is becoming a viable alternative propulsion technology for the aviation sector and reveals potential advantages including fuel savings, lower pollution, and reduced noise emission. Hybrid-electric propulsion systems can take advantage of the synergy between two technologies by utilizing both internal combustion engines and electric motors together, each operating at their respective optimum conditions...

  8. Inertial frames and breakthrough propulsion physics

    Science.gov (United States)

    Millis, Marc G.

    2017-09-01

    The term ;Breakthrough Propulsion Physics; comes from the NASA project by that name which examined non-rocket space drives, gravity control, and faster-than-light travel. The focus here is on space drives and the related unsolved physics of inertial frames. A ;space drive; is a generic term encompassing any concept for using as-yet undiscovered physics to move a spacecraft instead of existing rockets, sails, or tethers. The collective state of the art spans mostly steps 1-3 of the scientific method: defining the problem, collecting data, and forming hypotheses. The key issues include (1) conservation of momentum, (2) absence of obvious reaction mass, and (3) the net-external thrusting requirement. Relevant open problems in physics include: (1) the sources and mechanisms of inertial frames, (2) coupling of gravitation to the other fundamental forces, and (3) the nature of the quantum vacuum. Rather than following the assumption that inertial frames are an immutable, intrinsic property of space, this paper revisits Mach's Principle, where it is posited that inertia is relative to the distant surrounding matter. This perspective allows conjectures that a space drive could impart reaction forces to that matter, via some as-yet undiscovered interaction with the inertial frame properties of space. Thought experiments are offered to begin a process to derive new hypotheses. It is unknown if this line of inquiry will be fruitful, but it is hoped that, by revisiting unsolved physics from a propulsion point of view, new insights will be gained.

  9. Electric Motors for Vehicle Propulsion

    OpenAIRE

    Larsson, Martin

    2014-01-01

    This work is intended to contribute with knowledge to the area of electic motorsfor propulsion in the vehicle industry. This is done by first studying the differentelectric motors available, the motors suitable for vehicle propulsion are then dividedinto four different types to be studied separately. These four types are thedirect current, induction, permanent magnet and switched reluctance motors. Thedesign and construction are then studied to understand how the different typesdiffer from ea...

  10. Propulsive efficiency of a biomorphic pulsed-jet underwater vehicle

    International Nuclear Information System (INIS)

    Moslemi, Ali A; Krueger, Paul S

    2010-01-01

    The effect of the velocity program and duty cycle (St L ) on the propulsive efficiency of pulsed-jet propulsion was studied experimentally on a self-propelled, pulsed-jet underwater vehicle, dubbed Robosquid due to the similarity of essential elements of its propulsion system with squid jet propulsion. Robosquid was tested for jet slug length-to-diameter ratios (L/D) in the range 2-6 and St L in the range 0.2-0.6 with jet velocity programs commanded to be triangular or trapezoidal. Digital particle image velocimetry was used for measuring the impulse and energy of jet pulses to calculate the pulsed-jet propulsive efficiency and compare it with an equivalent steady jet system. Robosquid's Reynolds number (Re) based on average vehicle velocity and vehicle diameter ranged between 1300 and 2700 for the conditions tested. The results indicated better propulsive efficiency of the trapezoidal velocity program (up to 20% higher) compared to the triangular velocity program. Also, an increase in the ratio of the pulsed-jet propulsive efficiency to the equivalent steady jet propulsive efficiency (η P /η P,ss ) was observed as St L increased and L/D decreased. For cases of short L/D and high St L , η P /η P,ss was found to be as high as 1.2, indicating better performance of pulsed jets. This result demonstrates a case where propulsion using essential elements of a biological locomotion system can outperform the traditional mechanical system equivalent in terms of efficiency. It was also found that changes in St L had a proportionately larger effect on propulsive efficiency compared to changes in L/D. A simple model is presented to explain the results in terms of the contribution of over-pressure at the nozzle exit plane associated with the formation of vortex rings with each jet pulse.

  11. Direct Energy Conversion for Nuclear Propulsion at Low Specific Mass

    Science.gov (United States)

    Scott, John H.

    2014-01-01

    The project will continue the FY13 JSC IR&D (October-2012 to September-2013) effort in Travelling Wave Direct Energy Conversion (TWDEC) in order to demonstrate its potential as the core of a high potential, game-changing, in-space propulsion technology. The TWDEC concept converts particle beam energy into radio frequency (RF) alternating current electrical power, such as can be used to heat the propellant in a plasma thruster. In a more advanced concept (explored in the Phase 1 NIAC project), the TWDEC could also be utilized to condition the particle beam such that it may transfer directed kinetic energy to a target propellant plasma for the purpose of increasing thrust and optimizing the specific impulse. The overall scope of the FY13 first-year effort was to build on both the 2012 Phase 1 NIAC research and the analysis and test results produced by Japanese researchers over the past twenty years to assess the potential for spacecraft propulsion applications. The primary objective of the FY13 effort was to create particle-in-cell computer simulations of a TWDEC. Other objectives included construction of a breadboard TWDEC test article, preliminary test calibration of the simulations, and construction of first order power system models to feed into mission architecture analyses with COPERNICUS tools. Due to funding cuts resulting from the FY13 sequestration, only the computer simulations and assembly of the breadboard test article were completed. The simulations, however, are of unprecedented flexibility and precision and were presented at the 2013 AIAA Joint Propulsion Conference. Also, the assembled test article will provide an ion current density two orders of magnitude above that available in previous Japanese experiments, thus enabling the first direct measurements of power generation from a TWDEC for FY14. The proposed FY14 effort will use the test article for experimental validation of the computer simulations and thus complete to a greater fidelity the

  12. A Power-Efficient Propulsion Method for Magnetic Microrobots

    Directory of Open Access Journals (Sweden)

    Gioia Lucarini

    2014-07-01

    Full Text Available Current magnetic systems for microrobotic navigation consist of assemblies of electromagnets, which allow for the wireless accurate steering and propulsion of sub-millimetric bodies. However, large numbers of windings and/or high currents are needed in order to generate suitable magnetic fields and gradients. This means that magnetic navigation systems are typically cumbersome and require a lot of power, thus limiting their application fields. In this paper, we propose a novel propulsion method that is able to dramatically reduce the power demand of such systems. This propulsion method was conceived for navigation systems that achieve propulsion by pulling microrobots with magnetic gradients. We compare this power-efficient propulsion method with the traditional pulling propulsion, in the case of a microrobot swimming in a micro-structured confined liquid environment. Results show that both methods are equivalent in terms of accuracy and the velocity of the motion of the microrobots, while the new approach requires only one ninth of the power needed to generate the magnetic gradients. Substantial equivalence is demonstrated also in terms of the manoeuvrability of user-controlled microrobots along a complex path.

  13. A cermet fuel reactor for nuclear thermal propulsion

    Science.gov (United States)

    Kruger, Gordon

    1991-01-01

    Work on the cermet fuel reactor done in the 1960's by General Electric (GE) and the Argonne National Laboratory (ANL) that had as its goal the development of systems that could be used for nuclear rocket propulsion as well as closed cycle propulsion system designs for ship propulsion, space nuclear propulsion, and other propulsion systems is reviewed. It is concluded that the work done in the 1960's has demonstrated that we can have excellent thermal and mechanical performance with cermet fuel. Thousands of hours of testing were performed on the cermet fuel at both GE and AGL, including very rapid transients and some radiation performance history. We conclude that there are no feasibility issues with cermet fuel. What is needed is reactivation of existing technology and qualification testing of a specific fuel form. We believe this can be done with a minimum development risk.

  14. Airbreathing Propulsion An Introduction

    CERN Document Server

    Bose, Tarit

    2012-01-01

    Airbreathing Propulsion covers the physics of combustion, fluid and thermo-dynamics, and structural mechanics of airbreathing engines, including piston, turboprop, turbojet, turbofan, and ramjet engines. End-of-chapter exercises allow the reader to practice the fundamental concepts behind airbreathing propulsion, and the included PAGIC computer code will help the reader to examine the relationships between the performance parameters of different engines. Large amounts of data on many different piston, turbojet, and turboprop engines have been compiled for this book and are included as an appendix. This textbook is ideal for senior undergraduate and graduate students studying aeronautical engineering, aerospace engineering, and mechanical engineering.

  15. Advanced Chemical Propulsion

    Science.gov (United States)

    Bai, S. Don

    2000-01-01

    Design, propellant selection, and launch assistance for advanced chemical propulsion system is discussed. Topics discussed include: rocket design, advance fuel and high energy density materials, launch assist, and criteria for fuel selection.

  16. Real-time feedback enhances forward propulsion during walking in old adults.

    Science.gov (United States)

    Franz, Jason R; Maletis, Michela; Kram, Rodger

    2014-01-01

    Reduced propulsive function during the push-off phase of walking plays a central role in the deterioration of walking ability with age. We used real-time propulsive feedback to test the hypothesis that old adults have an underutilized propulsive reserve available during walking. 8 old adults (mean [SD], age: 72.1 [3.9] years) and 11 young adults (age: 21.0 [1.5] years) participated. For our primary aim, old subjects walked: 1) normally, 2) with visual feedback of their peak propulsive ground reaction forces, and 3) with visual feedback of their medial gastrocnemius electromyographic activity during push-off. We asked those subjects to match a target set to 20% and 40% greater propulsive force or push-off muscle activity than normal walking. We tested young subjects walking normally only to provide reference ground reaction force values. Walking normally, old adults exerted 12.5% smaller peak propulsive forces than young adults (Ppush-off muscle activities when we provided propulsive feedback. Most notably, force feedback elicited propulsive forces that were equal to or 10.5% greater than those of young adults (+20% target, P=0.87; +40% target, P=0.02). With electromyographic feedback, old adults significantly increased their push-off muscle activities but without increasing their propulsive forces. Old adults with propulsive deficits have a considerable and underutilized propulsive reserve available during level walking. Further, real-time propulsive feedback represents a promising therapeutic strategy to improve the forward propulsion of old adults and thus maintain their walking ability and independence. © 2013.

  17. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  18. Project Longshot: A mission to Alpha Centauri

    Science.gov (United States)

    West, Curtis; Chamberlain, Sally; Pagan, Neftali; Stevens, Robert

    1989-01-01

    Project Longshot, an exercise in the Advanced Design Program for Space, had as its destination Alpha Centauri, the closest star system to our own solar system. Alpha Centauri, a trinary star system, is 4.34 light years from earth. Although Project Longshot is impossible based on existing technologies, areas that require further investigation in order to make this feat possible are identified. Three areas where advances in technology are needed are propulsion, data processing for autonomous command and control functions, and reliability. Propulsion, possibly by antimatter annihilation; navigation and navigation aids; reliable hardware and instruments; artificial intelligence to eliminate the need for command telemetry; laser communication; and a reliable, compact, and lightweight power system that converts energy efficiently and reliably present major challenges. Project Longshot promises exciting advances in science and technology and new information concerning the universe.

  19. Highly miniaturized FEEP propulsion system (NanoFEEP) for attitude and orbit control of CubeSats

    Science.gov (United States)

    Bock, Daniel; Tajmar, Martin

    2018-03-01

    A highly miniaturized Field Emission Electric Propulsion (FEEP) system is currently under development at TU Dresden, called NanoFEEP [1]. The highly miniaturized thruster heads are very compact and have a volume of less than 3 cm3 and a weight of less than 6 g each. One thruster is able to generate continuous thrust of up to 8 μN with short term peaks of up to 22 μN. The very compact design and low power consumption (heating power demand between 50 and 150 mW) are achieved by using Gallium as metal propellant with its low melting point of approximately 30 °C. This makes it possible to implement an electric propulsion system consisting of four thruster heads, two neutralizers and the necessary electronics on a 1U CubeSat with its strong limitation in space, weight and available power. Even formation flying of 1U CubeSats using an electric propulsion system is possible with this system, which is shown by the example of a currently planned cooperation project between Wuerzburg University, Zentrum fuer Telematik and TU Dresden. It is planned to use the NanoFEEP electric propulsion system on the UWE (University Wuerzburg Experimental) 1U CubeSat platform [2] to demonstrate orbit and two axis attitude control with our electric propulsion system NanoFEEP. We present the latest performance characteristics of the NanoFEEP thrusters and the highly miniaturized electronics. Additionally, the concept and the current status of a novel cold neutralizer chip using Carbon Nano Tubes (CNTs) is presented.

  20. Hazardous and Medical Waste Destruction Using the AC Plasmatron Final Report CRADA No. TC-1560-98

    Energy Technology Data Exchange (ETDEWEB)

    Caplan, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bucher, K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Tulupov, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-09-28

    The goal of this project was to develop a prototype medical waste destruction facility based on the AC plasma torch capable of processing 150 kg of waste per hour while satisfying US EPA emission standards. The project was to provide the first opportunity for a joint U.S.-Russian project using an AC Plasma Torch in a hazardous waste destruction system to be assembled and operated in the U.S. thus promoting the commercialization in the U.S. of this joint U.S.-Russian developed technology. This project was a collaboration between the Russian Institute Soliton- NTT, the U.S industrial partner Scientific Utilization Inc. (SUI) and Lawrence Livermore National Laboratory ( LLNL). The project was funded by DOE for a total of $1.2 million with $600K for allocated for Phase I and $600K for Phase II. The Russian team received about $800K over the two (2) year period while LLNL received $400K. SUI was to provide in kind matching funds totaling $1.2 million.

  1. Linearized propulsion theory of flapping airfoils revisited

    Science.gov (United States)

    Fernandez-Feria, Ramon

    2016-11-01

    A vortical impulse theory is used to compute the thrust of a plunging and pitching airfoil in forward flight within the framework of linear potential flow theory. The result is significantly different from the classical one of Garrick that considered the leading-edge suction and the projection in the flight direction of the pressure force. By taking into account the complete vorticity distribution on the airfoil and the wake the mean thrust coefficient contains a new term that generalizes the leading-edge suction term and depends on Theodorsen function C (k) and on a new complex function C1 (k) of the reduced frequency k. The main qualitative difference with Garrick's theory is that the propulsive efficiency tends to zero as the reduced frequency increases to infinity (as 1 / k), in contrast to Garrick's efficiency that tends to a constant (1 / 2). Consequently, for pure pitching and combined pitching and plunging motions, the maximum of the propulsive efficiency is not reached as k -> ∞ like in Garrick's theory, but at a finite value of the reduced frequency that depends on the remaining non-dimensional parameters. The present analytical results are in good agreement with experimental data and numerical results for small amplitude oscillations. Supported by the Ministerio de Economia y Competitividad of Spain Grant No. DPI2013-40479-P.

  2. Solar Sail Propulsion Technology Readiness Level Database

    Science.gov (United States)

    Adams, Charles L.

    2004-01-01

    The NASA In-Space Propulsion Technology (ISPT) Projects Office has been sponsoring 2 solar sail system design and development hardware demonstration activities over the past 20 months. Able Engineering Company (AEC) of Goleta, CA is leading one team and L Garde, Inc. of Tustin, CA is leading the other team. Component, subsystem and system fabrication and testing has been completed successfully. The goal of these activities is to advance the technology readiness level (TRL) of solar sail propulsion from 3 towards 6 by 2006. These activities will culminate in the deployment and testing of 20-meter solar sail system ground demonstration hardware in the 30 meter diameter thermal-vacuum chamber at NASA Glenn Plum Brook in 2005. This paper will describe the features of a computer database system that documents the results of the solar sail development activities to-date. Illustrations of the hardware components and systems, test results, analytical models, relevant space environment definition and current TRL assessment, as stored and manipulated within the database are presented. This database could serve as a central repository for all data related to the advancement of solar sail technology sponsored by the ISPT, providing an up-to-date assessment of the TRL of this technology. Current plans are to eventually make the database available to the Solar Sail community through the Space Transportation Information Network (STIN).

  3. Controls and Health Management Technologies for Intelligent Aerospace Propulsion Systems

    Science.gov (United States)

    Garg, Sanjay

    2004-01-01

    With the increased emphasis on aircraft safety, enhanced performance and affordability, and the need to reduce the environmental impact of aircraft, there are many new challenges being faced by the designers of aircraft propulsion systems. The Controls and Dynamics Technology Branch at NASA (National Aeronautics and Space Administration) Glenn Research Center (GRC) in Cleveland, Ohio, is leading and participating in various projects in partnership with other organizations within GRC and across NASA, the U.S. aerospace industry, and academia to develop advanced controls and health management technologies that will help meet these challenges through the concept of an Intelligent Engine. The key enabling technologies for an Intelligent Engine are the increased efficiencies of components through active control, advanced diagnostics and prognostics integrated with intelligent engine control to enhance component life, and distributed control with smart sensors and actuators in an adaptive fault tolerant architecture. This paper describes the current activities of the Controls and Dynamics Technology Branch in the areas of active component control and propulsion system intelligent control, and presents some recent analytical and experimental results in these areas.

  4. Magnetic levitation and MHD propulsion

    International Nuclear Information System (INIS)

    Tixador, P.

    1994-01-01

    Magnetic levitation and MHD propulsion are now attracting attention in several countries. Different superconducting MagLev and MHD systems will be described concentrating on, above all, the electromagnetic aspect. Some programmes occurring throughout the world will be described. Magnetic levitated trains could be the new high speed transportation system for the 21st century. Intensive studies involving MagLev trains using superconductivity have been carried our in Japan since 1970. The construction of a 43 km long track is to be the next step. In 1991 a six year programme was launched in the United States to evaluate the performances of MagLev systems for transportation. The MHD (MagnetoHydroDynamic) offers some interesting advantages (efficiency, stealth characteristics, ..) for naval propulsion and increasing attention is being paid towards it nowadays. Japan is also up at the top with the tests of Yamato I, a 260 ton MHD propulsed ship. (orig.)

  5. Magnetic levitation and MHD propulsion

    Energy Technology Data Exchange (ETDEWEB)

    Tixador, P [CNRS/CRTBT-LEG, 38 - Grenoble (France)

    1994-04-01

    Magnetic levitation and MHD propulsion are now attracting attention in several countries. Different superconducting MagLev and MHD systems will be described concentrating on, above all, the electromagnetic aspect. Some programmes occurring throughout the world will be described. Magnetic levitated trains could be the new high speed transportation system for the 21st century. Intensive studies involving MagLev trains using superconductivity have been carried our in Japan since 1970. The construction of a 43 km long track is to be the next step. In 1991 a six year programme was launched in the United States to evaluate the performances of MagLev systems for transportation. The MHD (MagnetoHydroDynamic) offers some interesting advantages (efficiency, stealth characteristics, ..) for naval propulsion and increasing attention is being paid towards it nowadays. Japan is also up at the top with the tests of Yamato I, a 260 ton MHD propulsed ship. (orig.).

  6. The Hubble Legacy Archive ACS grism data

    Science.gov (United States)

    Kümmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.

    2011-06-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 μm, with a dispersion of 40 Å/pixel and a resolution of ~80 Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47 919 datasets (65% of the total number of extracted spectra) for 32 149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2 - 4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects

  7. STATIC TESTS OF UNCONVENTIONAL PROPULSION UNITS FOR ULTRALIGHT AIRPLANES

    Directory of Open Access Journals (Sweden)

    Martin Helmich

    2014-06-01

    Full Text Available This paper presents static tests of a new unconventional propulsion unit for small aviation airplanes. Our laboratory stand – a fan drive demonstrator – enables us to compare various design options. We performed experiments to verify the propulsion functionality and a measurement procedure to determine the available thrust of the propulsion unit and its dependence on engine speed. The results used for subsequent optimization include the operating parameters of the propulsion unit, and the temperature and velocity fields in parts of the air duct.

  8. Additive Manufacturing of Low Cost Upper Stage Propulsion Components

    Science.gov (United States)

    Protz, Christopher; Bowman, Randy; Cooper, Ken; Fikes, John; Taminger, Karen; Wright, Belinda

    2014-01-01

    NASA is currently developing Additive Manufacturing (AM) technologies and design tools aimed at reducing the costs and manufacturing time of regeneratively cooled rocket engine components. These Low Cost Upper Stage Propulsion (LCUSP) tasks are funded through NASA's Game Changing Development Program in the Space Technology Mission Directorate. The LCUSP project will develop a copper alloy additive manufacturing design process and develop and optimize the Electron Beam Freeform Fabrication (EBF3) manufacturing process to direct deposit a nickel alloy structural jacket and manifolds onto an SLM manufactured GRCop chamber and Ni-alloy nozzle. In order to develop these processes, the project will characterize both the microstructural and mechanical properties of the SLMproduced GRCop-84, and will explore and document novel design techniques specific to AM combustion devices components. These manufacturing technologies will be used to build a 25K-class regenerative chamber and nozzle (to be used with tested DMLS injectors) that will be tested individually and as a system in hot fire tests to demonstrate the applicability of the technologies. These tasks are expected to bring costs and manufacturing time down as spacecraft propulsion systems typically comprise more than 70% of the total vehicle cost and account for a significant portion of the development schedule. Additionally, high pressure/high temperature combustion chambers and nozzles must be regeneratively cooled to survive their operating environment, causing their design to be time consuming and costly to build. LCUSP presents an opportunity to develop and demonstrate a process that can infuse these technologies into industry, build competition, and drive down costs of future engines.

  9. A comparison of propulsion systems for potential space mission applications

    International Nuclear Information System (INIS)

    Harvego, E.A.; Sulmeisters, T.K.

    1987-01-01

    A derivative of the NERVA nuclear rocket engine was compared with a chemical propulsion system and a nuclear electric propulsion system to assess the relative capabilities of the different propulsion system options for three potential space missions. The missions considered were (1) orbital transfer from low earth orbit (LEO) to geosynchronous earth orbit (GEO), (2) LEO to a lunar base, and (3) LEO to Mars. The results of this comparison indicate that the direct-thrust NERVA-derivative nuclear rocket engine has the best performance characteristics for the missions considered. The combined high thrust and high specific impulse achievable with a direct-thrust nuclear stage permits short operating times (transfer times) comparable to chemical propulsion systems, but with considerably less required propellant. While nuclear-electric propulsion systems are more fuel efficient than either direct-nuclear or chemical propulsion, they are not stand-alone systems, since their relatively low thrust levels require the use of high-thrust ferry or lander stages in high gravity applications such as surface-to-orbit propulsion. The extremely long transfer times and inefficient trajectories associated with electric propulsion systems were also found to be a significant drawback

  10. Research on applications of rectangular beam in micro laser propulsion

    International Nuclear Information System (INIS)

    Jiao, L.; Cai, J.; Ma, H.H.; Li, G.X.; Li, L.; Shen, Z.W.; Tang, Z.P.

    2014-01-01

    Highlights: • Diode laser bar of 808 nm is introduced into the micro laser propulsion field. • Double base propellant (DBP) coating with BOPP substrate was obtained. • The combination of laser power and energy decides the propulsion performance. • The new rectangular beam prefers to produce higher impulse. - Abstract: Micro laser propulsion is a new technology with brilliant future. In order to reduce the thruster mass and volume further, laser bar is introduced into the micro laser propulsion field. A new kind of 220 × 20 μm rectangular beam of 808 nm was obtained by oval lens compressing the light of diode at fast axes and slow axes. The effect of laser power, energy and coating thickness of double base propellant on propulsion performance was studied. Propulsion performance of double base propellant under static and dynamic mode shows some different characters. Compared to round beam, the new beam prefers to produce higher impulse. Ablation efficiency of DBP shows better performance in short laser duration. The combination of power density and energy density decides the laser propulsion performance. The new rectangular beam is appropriate for millisecond micro-laser propulsion

  11. The influence of verbal training and visual feedback on manual wheelchair propulsion.

    Science.gov (United States)

    DeGroot, Keri K; Hollingsworth, Holly H; Morgan, Kerri A; Morris, Carrie L; Gray, David B

    2009-03-01

    To determine if verbal training with visual feedback improved manual wheelchair propulsion; to examine propulsion differences between an individual with paraplegia and an individual with tetraplegia. Quasi-experimental study: Nine manual wheelchair-using adults participated in propulsion assessments and training. Baseline propulsion performance was measured on several tasks on different surfaces. Participants were trained on a wheelchair treadmill with verbal and visual feedback to increase push length, reduce push frequency and to modify propulsion pattern. Handrim biomechanics were measured with an instrumented wheel. Changes in propulsion were assessed. Differences in propulsion characteristics between a participant with paraplegia and a participant with tetraplegia were examined. Push length increased (p propulsion characteristics between a participant with paraplegia and a participant with tetraplegia. Verbal training may produce changes in push biomechanics of manual wheelchair users. Longer training periods may be needed to sustain propulsion changes. Findings from this study support other studies that have shown propulsion differences between people with tetraplegia and paraplegia. Propulsion training for populations with upper-extremity impairments warrants further study.

  12. Test facility for auxiliary cooling system (ACS) of fast breeder reactor for Power Reactor and Nuclear Fuel Development Corporation (PNC)

    International Nuclear Information System (INIS)

    1983-01-01

    In preparation of constructing ''Monju'', a prototype fast breeder reactor, PNC has been pushing forward its research and development projects and the ACS was constructed under these projects. The auxiliary cooling system is an important engineered safety feature, and is used for safe removal of heat from the reactor at the shutdown. The ACS serves as a means of testing and assessing the auxiliary cooling system for the ''Monju'' and is designed and manufactured to have one fifth capacity of the Monju. The air heat exchanger and the ACS system was designed to withstand higher temperature range of the conventional design code (MITI-501), and finned tubes were applied for effective heat removal. Preheating system was designed to heat up the whole system over 200 0 C within 20 hours to prevent sodium from freezing. Basic performance of ACS was verified satisfactorily by a series of performance tests, such as start up test, flow rate measurement and preheating test before delivery. The experience from designing and construction of ACS and data obtained by these tests will be very instructive for designing and construction of the ''Monju''. (author)

  13. Design and Development of a 200-kW Turbo-Electric Distributed Propulsion Testbed

    Science.gov (United States)

    Papathakis, Kurt V.

    2017-01-01

    There a few NASA funded electric and hybrid electric projects from different NASA Centers, including the NASA Armstrong Flight Research Center (AFRC) (Edwards, California). Each project identifies a specific technology gap that is currently inhibiting the growth and proliferation of relevant technologies in commercial aviation. This paper describes the design and development of a turbo-electric distributed propulsion (TeDP) hardware-in-the-loop (HIL) simulation bench, which is a test bed for discovering turbo-electric control, distributed electric control, power management control, and integration competencies while providing risk mitigation for future turbo-electric flying demonstrators.

  14. Propulsion Electric Grid Simulator (PEGS) for Future Turboelectric Distributed Propulsion Aircraft

    Science.gov (United States)

    Choi, Benjamin B.; Morrison, Carlos; Dever, Timothy; Brown, Gerald V.

    2014-01-01

    NASA Glenn Research Center, in collaboration with the aerospace industry and academia, has begun the development of technology for a future hybrid-wing body electric airplane with a turboelectric distributed propulsion (TeDP) system. It is essential to design a subscale system to emulate the TeDP power grid, which would enable rapid analysis and demonstration of the proof-of-concept of the TeDP electrical system. This paper describes how small electrical machines with their controllers can emulate all the components in a TeDP power train. The whole system model in Matlab/Simulink was first developed and tested in simulation, and the simulation results showed that system dynamic characteristics could be implemented by using the closed-loop control of the electric motor drive systems. Then we designed a subscale experimental system to emulate the entire power system from the turbine engine to the propulsive fans. Firstly, we built a system to emulate a gas turbine engine driving a generator, consisting of two permanent magnet (PM) motors with brushless motor drives, coupled by a shaft. We programmed the first motor and its drive to mimic the speed-torque characteristic of the gas turbine engine, while the second motor and drive act as a generator and produce a torque load on the first motor. Secondly, we built another system of two PM motors and drives to emulate a motor driving a propulsive fan. We programmed the first motor and drive to emulate a wound-rotor synchronous motor. The propulsive fan was emulated by implementing fan maps and flight conditions into the fourth motor and drive, which produce a torque load on the driving motor. The stator of each PM motor is designed to travel axially to change the coupling between rotor and stator. This feature allows the PM motor to more closely emulate a wound-rotor synchronous machine. These techniques can convert the plain motor system into a unique TeDP power grid emulator that enables real-time simulation performance

  15. PEGASUS: a multi-megawatt nuclear electric propulsion system

    International Nuclear Information System (INIS)

    Coomes, E.P.; Cuta, J.M.; Webb, B.J.; King, D.Q.

    1985-06-01

    With the Space Transportation System (STS), the advent of space station Columbus and the development of expertise at working in space that this will entail, the gateway is open to the final frontier. The exploration of this frontier is possible with state-of-the-art hydrogen/oxygen propulsion but would be greatly enhanced by the higher specific impulse of electric propulsion. This paper presents a concept that uses a multi-megawatt nuclear power plant to drive an electric propulsion system. The concept has been named PEGASUS, PowEr GenerAting System for Use in Space, and is intended as a ''work horse'' for general space transportation needs, both long- and short-haul missions. The recent efforts of the SP-100 program indicate that a power system capable of producing upwards of 1 megawatt of electric power should be available in the next decade. Additionally, efforts in other areas indicate that a power system with a constant power capability an order of magnitude greater could be available near the turn of the century. With the advances expected in megawatt-class space power systems, the high specific impulse propulsion systems must be reconsidered as potential propulsion systems. The power system is capable of meeting both the propulsion system and spacecraft power requirements

  16. Propulsion Wheel Motor for an Electric Vehicle

    Science.gov (United States)

    Figuered, Joshua M. (Inventor); Herrera, Eduardo (Inventor); Waligora, Thomas M. (Inventor); Bluethmann, William J. (Inventor); Farrell, Logan Christopher (Inventor); Lee, Chunhao J. (Inventor); Vitale, Robert L. (Inventor); Winn, Ross Briant (Inventor); Eggleston, IV, Raymond Edward (Inventor); Guo, Raymond (Inventor); hide

    2016-01-01

    A wheel assembly for an electric vehicle includes a wheel rim that is concentrically disposed about a central axis. A propulsion-braking module is disposed within an interior region of the wheel rim. The propulsion-braking module rotatably supports the wheel rim for rotation about the central axis. The propulsion-braking module includes a liquid cooled electric motor having a rotor rotatable about the central axis, and a stator disposed radially inside the rotor relative to the central axis. A motor-wheel interface hub is fixedly attached to the wheel rim, and is directly attached to the rotor for rotation with the rotor. The motor-wheel interface hub directly transmits torque from the electric motor to the wheel rim at a 1:1 ratio. The propulsion-braking module includes a drum brake system having an electric motor that rotates a cam device, which actuates the brake shoes.

  17. Microwave Thermal Propulsion

    Science.gov (United States)

    Parkin, Kevin L. G.; Lambot, Thomas

    2017-01-01

    We have conducted research in microwave thermal propulsion as part of the space exploration access technologies (SEAT) research program, a cooperative agreement (NNX09AF52A) between NASA and Carnegie Mellon University. The SEAT program commenced on the 19th of February 2009 and concluded on the 30th of September 2015. The DARPA/NASA Millimeter-wave Thermal Launch System (MTLS) project subsumed the SEAT program from May 2012 to March 2014 and one of us (Parkin) served as its principal investigator and chief engineer. The MTLS project had no final report of its own, so we have included the MTLS work in this report and incorporate its conclusions here. In the six years from 2009 until 2015 there has been significant progress in millimeter-wave thermal rocketry (a subset of microwave thermal rocketry), most of which has been made under the auspices of the SEAT and MTLS programs. This final report is intended for multiple audiences. For researchers, we present techniques that we have developed to simplify and quantify the performance of thermal rockets and their constituent technologies. For program managers, we detail the facilities that we have built and the outcomes of experiments that were conducted using them. We also include incomplete and unfruitful lines of research. For decision-makers, we introduce the millimeter-wave thermal rocket in historical context. Considering the economic significance of space launch, we present a brief but significant cost-benefit analysis, for the first time showing that there is a compelling economic case for replacing conventional rockets with millimeter-wave thermal rockets.

  18. Study of underwater laser propulsion using different target materials.

    Science.gov (United States)

    Qiang, Hao; Chen, Jun; Han, Bing; Shen, Zhong-Hua; Lu, Jian; Ni, Xiao-Wu

    2014-07-14

    In order to investigate the influence of target materials, including aluminum (Al), titanium (Ti) and copper (Cu), on underwater laser propulsion, the analytical formula of the target momentum IT is deduced from the enhanced coupling theory of laser propulsion in atmosphere with transparent overlay metal target. The high-speed photography method and numerical simulation are employed to verify the IT model. It is shown that the enhanced coupling theory, which was developed originally for laser propulsion in atmosphere, is also applicable to underwater laser propulsion with metal targets.

  19. The AC photovoltaic module is here!

    Science.gov (United States)

    Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

    1997-02-01

    This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

  20. Mars Sample Return Using Solar Sail Propulsion

    Science.gov (United States)

    Johnson, Les; Macdonald, Malcolm; Mcinnes, Colin; Percy, Tom

    2012-01-01

    Many Mars Sample Return (MSR) architecture studies have been conducted over the years. A key element of them is the Earth Return Stage (ERS) whose objective is to obtain the sample from the Mars Ascent Vehicle (MAV) and return it safely to the surface of the Earth. ERS designs predominantly use chemical propulsion [1], incurring a significant launch mass penalty due to the low specific impulse of such systems coupled with the launch mass sensitivity to returned mass. It is proposed to use solar sail propulsion for the ERS, providing a high (effective) specific impulse propulsion system in the final stage of the multi-stage system. By doing so to the launch mass of the orbiter mission can be significantly reduced and hence potentially decreasing mission cost. Further, solar sailing offers a unique set of non-Keplerian low thrust trajectories that may enable modifications to the current approach to designing the Earth Entry Vehicle by potentially reducing the Earth arrival velocity. This modification will further decrease the mass of the orbiter system. Solar sail propulsion uses sunlight to propel vehicles through space by reflecting solar photons from a large, mirror-like surface made of a lightweight, reflective material. The continuous photonic pressure provides propellantless thrust to conduct orbital maneuvering and plane changes more efficiently than conventional chemical propulsion. Because the Sun supplies the necessary propulsive energy, solar sails require no onboard propellant, thus reducing system mass. This technology is currently at TRL 7/8 as demonstrated by the 2010 flight of the Japanese Aerospace Exploration Agency, JAXA, IKAROS mission. [2

  1. DISCRETION MAGNETIQUE DES MACHINES ELECTRIQUES DE PROPULSION NAVALE

    OpenAIRE

    Froidurot , Benoît

    2002-01-01

    For about ten years, electrical machines have been commonly used in naval propulsion systems for civilian applications. This is mainly due to new magnetic materials (magnets...) and power drive electronic, which increase the performances of the machines. This kind of propulsion is planed to be implemented on military ships. However, some constraints of discretion make this propulsion require specific systems for the ship security. This study is then dedicted to the magnetic discretion of nava...

  2. Children's Gender-Typed Toy Interests: Does Propulsion Matter?

    Science.gov (United States)

    Dinella, Lisa M; Weisgram, Erica S; Fulcher, Megan

    2017-07-01

    Children's toy play is at the foundation of child development. However, gender differentiation in early play experiences may result in gender differences in cognitive abilities, social interactions, and vocational choices. We investigated gender-typing of toys and toys' propulsive properties (e.g., wheels, forward motion) as possible factors impacting children's toy interests, perceptions of other children's interests, and children's actual toy choices during free play. In Studies 1 and 2, 82 preschool children (42 boys, 40 girls; mean age = 4.90 years) were asked to report their interest and perceptions of other children's interests in toys. In Study 1, masculine, feminine, and neutral toys with and without propulsive properties were presented. Children reported greater interest in gender-typed toys and neutral toys compared to cross-gender-typed toys. In Study 2, unfamiliar, neutral toys with and without propulsive properties were presented. Propulsive properties did not affect children's interest across both studies. Study 3 was an observational study that assessed toy preferences among 42 preschool children (21 males, 21 females, mean age = 4.49 years) during a play session with masculine, feminine, and neutral toys with and without propulsive properties. Gender-typed toy preferences were less apparent than expected, with children showing high interest in neutral toys, and girls playing with a wide variety of masculine, feminine, and neutral toys. Gender differences in interest for toys with propulsion properties were not evident. Overall, gender differences in children's interest in toys as a function of propulsion properties were not found in the three experiments within this study.

  3. The Enabling Use of Ion Propulsion on Dawn

    Science.gov (United States)

    Rayman, M.; Russell, C. T.; Raymond, C. A.; Mase, R. M.

    2011-12-01

    Dawn's mission to orbit both Vesta and Ceres is enabled by its use of ion propulsion. Even orbiting Vesta alone with conventional propulsion would have been unaffordable within the constraints of the Discovery Program, and orbiting both would have been impossible. In fact, no other spacecraft has been targeted to orbit two solar system destinations, which is only one of the many firsts that Dawn will achieve. The successful testing of ion propulsion on Deep Space 1 paved the way for Dawn not only to use the hardware with confidence but also to learn how to design the flight system and design the mission to take advantage of its capabilities. In addition to allowing Dawn to reach these two important targets, ion propulsion allows the spacecraft to accomplish significant changes in its orbit. Therefore, science observations of Vesta are planned from four different orbits, at varying altitudes and solar geometry. The use of ion propulsion results in a significant mission design effort since the trajectory is constantly being refined. This also creates a flexible mission architecture, which allows for optimization of the mission as conditions change. Solar electric ion propulsion is especially well suited to missions to the Main Asteroid Belt since solar energy is still a viable power source, whereas the size of the solar array needed beyond 3.5 AU is a potential limitation. Dawn has already surpassed the record for greatest propulsive velocity, but its greatest achievements will no doubt be the incredible bounty of science data enabled by this innovative flight system.

  4. Advanced reliability improvement of AC-modules (ARIA)

    International Nuclear Information System (INIS)

    Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.

    2001-09-01

    are fully or partially shaded. Alpha Real has conducted considerable testing of shading and temperature rises of up to 180C have been observed. Such a temperature rise will influence the lifetime and reliability of the module, and it is therefore common practice to protect modules from these conditions by using by-pass diodes. Having now an active element on the back of the module, such as a module integrated inverter, new possibilities are offered for new concepts for hot-spot prevention. The main conclusions of the ARIA project are: Both the AC module inverters, Sunmaster 130S and Edisun E230721G, withstood the electrical immunity tests successfully; The Sunmaster 130S passed the accelerated reliability tests with good results; The Edisun E230721G passed the temperature cycling test and a humidity-freezing test; The ANIT s.r.l. ARIA modules met all requirements of the CEI/IEC 61215 standard; The voltage comparison method is a most promising principle for hot spot detection. It is implemented into both the Solcolino E230721G and the Sunmaster 130S. The costs for a 200W module are about $1. to $2.5, where the costs for by-pass diodes are $4 to $15; Measurements at different locations in three countries have shown that the new Hot Spot Detector (HSD) by comparing the voltages operates. Computer simulations show that if the current through the shaded cell is less than or equal to the current generated by the shaded cell, the shaded cell will not become reverse biased. 10 refs

  5. Space station propulsion requirements study

    Science.gov (United States)

    Wilkinson, C. L.; Brennan, S. M.

    1985-01-01

    Propulsion system requirements to support Low Earth Orbit (LEO) manned space station development and evolution over a wide range of potential capabilities and for a variety of STS servicing and space station operating strategies are described. The term space station and the overall space station configuration refers, for the purpose of this report, to a group of potential LEO spacecraft that support the overall space station mission. The group consisted of the central space station at 28.5 deg or 90 deg inclinations, unmanned free-flying spacecraft that are both tethered and untethered, a short-range servicing vehicle, and a longer range servicing vehicle capable of GEO payload transfer. The time phasing for preferred propulsion technology approaches is also investigated, as well as the high-leverage, state-of-the-art advancements needed, and the qualitative and quantitative benefits of these advancements on STS/space station operations. The time frame of propulsion technologies applicable to this study is the early 1990's to approximately the year 2000.

  6. NASA program planning on nuclear electric propulsion

    International Nuclear Information System (INIS)

    Bennett, G.L.; Miller, T.J.

    1992-03-01

    As part of the focused technology planning for future NASA space science and exploration missions, NASA has initiated a focused technology program to develop the technologies for nuclear electric propulsion and nuclear thermal propulsion. Beginning in 1990, NASA began a series of interagency planning workshops and meetings to identify key technologies and program priorities for nuclear propulsion. The high-priority, near-term technologies that must be developed to make NEP operational for space exploration include scaling thrusters to higher power, developing high-temperature power processing units, and developing high power, low-mass, long-lived nuclear reactors. 28 refs

  7. Definition of an arcjet propulsion sub-system

    International Nuclear Information System (INIS)

    Price, T.W.

    1989-01-01

    An engineering flight demonstration of a 100 kW3 Space Reactor Power System is planned for the mid to late 1990s. An arcjet based propulsion subsystem will be included on the flight demonstraction as a secondary experiment. Two studies, sponsored by the Kay Technologies Directorate of the SDI Organization and managed by the Jet Propulsion Laboratory are currently under way to define that propulsion subsystem. The principal tasks of those contracts and the plans for two later phases, an experimental verification of the concept and a flight qualification/delivery of a flight unit, are described. 9 refs

  8. Nuclear thermal propulsion engine cost trade studies

    International Nuclear Information System (INIS)

    Paschall, R.K.

    1993-01-01

    The NASA transportation strategy for the Mars Exploration architecture includes the use of nuclear thermal propulsion as the primary propulsion system for Mars transits. It is anticipated that the outgrowth of the NERVA/ROVER programs will be a nuclear thermal propulsion (NTP) system capable of providing the propulsion for missions to Mars. The specific impulse (Isp) for such a system is expected to be in the 870 s range. Trade studies were conducted to investigate whether or not it may be cost effective to invest in a higher performance (Isp>870 s) engine for nuclear thermal propulsion for missions to Mars. The basic cost trades revolved around the amount of mass that must be transported to low-earth orbit prior to each Mars flight and the cost to launch that mass. The mass required depended on the assumptions made for Mars missions scenarios including piloted/cargo flights, number of Mars missions, and transit time to Mars. Cost parameters included launch cost, program schedule for development and operations, and net discount rate. The results were very dependent on the assumptions that were made. Under some assumptions, higher performance engines showed cost savings in the billions of dollars; under other assumptions, the additional cost to develop higher performance engines was not justified

  9. Laser Propulsion - Is it another myth or a real potential?

    International Nuclear Information System (INIS)

    Cook, Joung R.

    2008-01-01

    This paper discusses different principles of inducing propulsive power using lasers and examines the performance limits along with pros and cons with respect to different space propulsion applications: satellite launching, orbital transfer, space debris clearing, satellite propulsion, and space travels. It concludes that a use of electrical propulsion, in conjunction with laser power beaming, is the most feasible application with technological and economic advantages for commercial use within the next decades

  10. Third session: new projects

    International Nuclear Information System (INIS)

    Iracane, D.; Dupuy, J.P.; Perotto, G.; Ithurralde, G.; Cabrillat, J.C.; Becle, D.; Pivet, S.; Minguet, J.L.

    2005-01-01

    The RJH (Jules Horowitz reactor) is a 100 MWth research reactor, cooled and moderated by water, that has been designed to operate with high density (8 g U/cm 3 ) and low enrichment fuel (19.75%) uranium molybdenum fuel. Its main neutron performances are expected to be: -) maximum fast neutron flux (E > 0.907 MeV) in the sample: 5.10 14 n/cm 2 /s, -) maximum thermal neutron flux (E 14 n/cm 2 /s, and -) maximal neutron damage: 16 dpa/year. RJH that will be built on the Cea's site of Cadarache, is scheduled to enter into service in 2014, it will take over the activities of the Osiris reactor and its operating life is planned to be over 50 years long. The Cabri research reactor is located on the Cadarache site, it has been operating since 1962 and is now undergoing important upgrading operations whose aim is to make the facility fit to study the behaviour of new nuclear fuels in accidental situations. The RES test reactor is a facility whose aim is to qualify nuclear fuels and core configurations of existing propulsion reactors onboard of aircraft carriers or submarines and to propose innovative concepts for future propulsion reactors. (A.C.)

  11. Advanced propulsion system for hybrid vehicles

    Science.gov (United States)

    Norrup, L. V.; Lintz, A. T.

    1980-01-01

    A number of hybrid propulsion systems were evaluated for application in several different vehicle sizes. A conceptual design was prepared for the most promising configuration. Various system configurations were parametrically evaluated and compared, design tradeoffs performed, and a conceptual design produced. Fifteen vehicle/propulsion systems concepts were parametrically evaluated to select two systems and one vehicle for detailed design tradeoff studies. A single hybrid propulsion system concept and vehicle (five passenger family sedan)were selected for optimization based on the results of the tradeoff studies. The final propulsion system consists of a 65 kW spark-ignition heat engine, a mechanical continuously variable traction transmission, a 20 kW permanent magnet axial-gap traction motor, a variable frequency inverter, a 386 kg lead-acid improved state-of-the-art battery, and a transaxle. The system was configured with a parallel power path between the heat engine and battery. It has two automatic operational modes: electric mode and heat engine mode. Power is always shared between the heat engine and battery during acceleration periods. In both modes, regenerative braking energy is absorbed by the battery.

  12. Measurement Issues In Pulsed Laser Propulsion

    International Nuclear Information System (INIS)

    Sinko, John E.; Scharring, Stefan; Eckel, Hans-Albert; Roeser, Hans-Peter; Sasoh, Akihiro

    2010-01-01

    Various measurement techniques have been used throughout the over 40-year history of laser propulsion. Often, these approaches suffered from inconsistencies in definitions of the key parameters that define the physics of laser ablation impulse generation. Such parameters include, but are not limited to the pulse energy, spot area, imparted impulse, and ablated mass. The limits and characteristics of common measurement techniques in each of these areas will be explored as they relate to laser propulsion. The idea of establishing some standardization system for laser propulsion data is introduced in this paper, so that reported results may be considered and studied by the general community with more certain understanding of particular merits and limitations. In particular, it is the intention to propose a minimum set of requirements a literature study should meet. Some international standards for measurements are already published, but modifications or revisions of such standards may be necessary for application to laser ablation propulsion. Issues relating to development of standards will be discussed, as well as some examples of specific experimental circumstances in which standardization would have prevented misinterpretation or misuse of past data.

  13. Levitação acústica

    OpenAIRE

    Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

    2015-01-01

    A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

  14. Formation of Nuclear Splicing Factor Compartments Is Independent of Lamins A/C

    Czech Academy of Sciences Publication Activity Database

    Večeřová, Jaromíra; Koberna, Karel; Malínský, Jan; Soutoglou, E.; Sullivan, T.; Stewart, C. L.; Raška, Ivan; Misteli, T.

    2004-01-01

    Roč. 15, č. 11 (2004), s. 4904-4910 ISSN 1059-1524 R&D Projects: GA AV ČR IAA5039103; GA ČR GA304/02/0342 Institutional research plan: CEZ:AV0Z5039906 Keywords : lamins A/C Subject RIV: EA - Cell Biology Impact factor: 7.517, year: 2004

  15. Advanced supersonic propulsion study. [with emphasis on noise level reduction

    Science.gov (United States)

    Sabatella, J. A. (Editor)

    1974-01-01

    A study was conducted to determine the promising propulsion systems for advanced supersonic transport application, and to identify the critical propulsion technology requirements. It is shown that noise constraints have a major effect on the selection of the various engine types and cycle parameters. Several promising advanced propulsion systems were identified which show the potential of achieving lower levels of sideline jet noise than the first generation supersonic transport systems. The non-afterburning turbojet engine, utilizing a very high level of jet suppression, shows the potential to achieve FAR 36 noise level. The duct-heating turbofan with a low level of jet suppression is the most attractive engine for noise levels from FAR 36 to FAR 36 minus 5 EPNdb, and some series/parallel variable cycle engines show the potential of achieving noise levels down to FAR 36 minus 10 EPNdb with moderate additional penalty. The study also shows that an advanced supersonic commercial transport would benefit appreciably from advanced propulsion technology. The critical propulsion technology needed for a viable supersonic propulsion system, and the required specific propulsion technology programs are outlined.

  16. Evaluation of advanced propulsion options for the next manned transportation system: Propulsion evolution study

    Science.gov (United States)

    Spears, L. T.; Kramer, R. D.

    1990-01-01

    The objectives were to examine launch vehicle applications and propulsion requirements for potential future manned space transportation systems and to support planning toward the evolution of Space Shuttle Main Engine (SSME) and Space Transportation Main Engine (STME) engines beyond their current or initial launch vehicle applications. As a basis for examinations of potential future manned launch vehicle applications, we used three classes of manned space transportation concepts currently under study: Space Transportation System Evolution, Personal Launch System (PLS), and Advanced Manned Launch System (AMLS). Tasks included studies of launch vehicle applications and requirements for hydrogen-oxygen rocket engines; the development of suggestions for STME engine evolution beyond the mid-1990's; the development of suggestions for STME evolution beyond the Advanced Launch System (ALS) application; the study of booster propulsion options, including LOX-Hydrocarbon options; the analysis of the prospects and requirements for utilization of a single engine configuration over the full range of vehicle applications, including manned vehicles plus ALS and Shuttle C; and a brief review of on-going and planned LOX-Hydrogen propulsion technology activities.

  17. Distributed Multi-propulsion Units System

    OpenAIRE

    原田, 正志; HARADA, Masashi

    2002-01-01

    Reduction of the weight of the propulsion system is important in the design of a stratospheric airship. However, it also important to increaseefficiency of the system because available energy generated by solar cells on the hull is quite limited. One solution to increase efficiency of the propulsion system is to use a stern propeller, the propeller mounted on the stern of the hull as shown in Figure 1. Mounted on the stern of the hull, the stern propeller is merged with the boundary layer of ...

  18. Propulsion and Power Technologies for the NASA Exploration Vision: A Research Perspective

    Science.gov (United States)

    Litchford, Ron J.

    2004-01-01

    Future propulsion and power technologies for deep space missions are profiled in this viewgraph presentation. The presentation includes diagrams illustrating possible future travel times to other planets in the solar system. The propulsion technologies researched at Marshall Space Flight Center (MSFC) include: 1) Chemical Propulsion; 2) Nuclear Propulsion; 3) Electric and Plasma Propulsion; 4) Energetics. The presentation contains additional information about these technologies, as well as space reactors, reactor simulation, and the Propulsion Research Laboratory (PRL) at MSFC.

  19. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  20. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  1. A Brief Review of the Need for Robust Smart Wireless Sensor Systems for Future Propulsion Systems, Distributed Engine Controls, and Propulsion Health Management

    Science.gov (United States)

    Hunter, Gary W.; Behbahani, Alireza

    2012-01-01

    Smart Sensor Systems with wireless capability operational in high temperature, harsh environments are a significant component in enabling future propulsion systems to meet a range of increasingly demanding requirements. These propulsion systems must incorporate technology that will monitor engine component conditions, analyze the incoming data, and modify operating parameters to optimize propulsion system operations. This paper discusses the motivation towards the development of high temperature, smart wireless sensor systems that include sensors, electronics, wireless communication, and power. The challenges associated with the use of traditional wired sensor systems will be reviewed and potential advantages of Smart Sensor Systems will be discussed. A brief review of potential applications for wireless smart sensor networks and their potential impact on propulsion system operation, with emphasis on Distributed Engine Control and Propulsion Health Management, will be given. A specific example related to the development of high temperature Smart Sensor Systems based on silicon carbide electronics will be discussed. It is concluded that the development of a range of robust smart wireless sensor systems are a foundation for future development of intelligent propulsion systems with enhanced capabilities.

  2. Small business innovation research. Abstracts of completed 1987 phase 1 projects

    Science.gov (United States)

    1989-01-01

    Non-proprietary summaries of Phase 1 Small Business Innovation Research (SBIR) projects supported by NASA in the 1987 program year are given. Work in the areas of aeronautical propulsion, aerodynamics, acoustics, aircraft systems, materials and structures, teleoperators and robotics, computer sciences, information systems, spacecraft systems, spacecraft power supplies, spacecraft propulsion, bioastronautics, satellite communication, and space processing are covered.

  3. Magnetic levitation and MHD propulsion

    Science.gov (United States)

    Tixador, P.

    1994-04-01

    Magnetic levitation and MHD propulsion are now attracting attention in several countries. Different superconducting MagLev and MHD systems will be described concentrating on, above all, the electromagnetic aspect. Some programmes occurring throughout the world will be described. Magnetic levitated trains could be the new high speed transportation system for the 21st century. Intensive studies involving MagLev trains using superconductivity have been carried out in Japan since 1970. The construction of a 43 km long track is to be the next step. In 1991 a six year programme was launched in the United States to evaluate the performances of MagLev systems for transportation. The MHD (MagnetoHydroDynamic) offers some interesting advantages (efficiency, stealth characteristics, ...) for naval propulsion and increasing attention is being paid towards it nowadays. Japan is also up at the top with the tests of Yamato I, a 260 ton MHD propulsed ship. Depuis quelques années nous assistons à un redémarrage de programmes concernant la lévitation et la propulsion supraconductrices. Différents systèmes supraconducteurs de lévitation et de propulsion seront décrits en examinant plus particulièrement l'aspect électromagnétique. Quelques programmes à travers le monde seront abordés. Les trains à sustentation magnétique pourraient constituer un nouveau mode de transport terrestre à vitesse élevée (500 km/h) pour le 21^e siècle. Les japonais n'ont cessé de s'intéresser à ce système avec bobine supraconductrice. Ils envisagent un stade préindustriel avec la construction d'une ligne de 43 km. En 1991 un programme américain pour une durée de six ans a été lancé pour évaluer les performances des systèmes à lévitation pour le transport aux Etats Unis. La MHD (Magnéto- Hydro-Dynamique) présente des avantages intéressants pour la propulsion navale et un regain d'intérêt apparaît à l'heure actuelle. Le japon se situe là encore à la pointe des d

  4. Dynamic simulator for PEFC propulsion plant

    Energy Technology Data Exchange (ETDEWEB)

    Hiraide, Masataka; Kaneda, Eiichi; Sato, Takao [Mitsui Engineering & Shipbuilding Co., Ltd., Tokyo (Japan)] [and others

    1996-12-31

    This report covers part of a joint study on a PEFC propulsion system for surface ships, summarized in a presentation to this Seminar, entitled {open_quote}Study on a Polymer Electrolyte Fuel Cell (PEFC) Propulsion System for Surface Ships{close_quotes}, and which envisages application to a 1,500 DWT cargo vessel. The work presented here focuses on a simulation study on PEFC propulsion plant performance, and particularly on the system response to changes in load. Using a dynamic simulator composed of system components including fuel cell, various simulations were executed, to examine the performance of the system as a whole and of the individual system components under quick and large load changes such as occasioned by maneuvering operations and by racing when the propeller emerges above water in heavy sea.

  5. Development priorities for in-space propulsion technologies

    Science.gov (United States)

    Johnson, Les; Meyer, Michael; Palaszewski, Bryan; Coote, David; Goebel, Dan; White, Harold

    2013-02-01

    During the summer of 2010, NASA's Office of Chief Technologist assembled 15 civil service teams to support the creation of a NASA integrated technology roadmap. The Aero-Space Technology Area Roadmap is an integrated set of technology area roadmaps recommending the overall technology investment strategy and prioritization for NASA's technology programs. The integrated set of roadmaps will provide technology paths needed to meet NASA's strategic goals. The roadmaps have been reviewed by senior NASA management and the National Research Council. With the exception of electric propulsion systems used for commercial communications satellite station-keeping and a handful of deep space science missions, almost all of the rocket engines in use today are chemical rockets; that is, they obtain the energy needed to generate thrust by combining reactive chemicals to create a hot gas that is expanded to produce thrust. A significant limitation of chemical propulsion is that it has a relatively low specific impulse. Numerous concepts for advanced propulsion technologies with significantly higher values of specific impulse have been developed over the past 50 years. Advanced in-space propulsion technologies will enable much more effective exploration of our solar system, near and far, and will permit mission designers to plan missions to "fly anytime, anywhere, and complete a host of science objectives at the destinations" with greater reliability and safety. With a wide range of possible missions and candidate propulsion technologies with very diverse characteristics, the question of which technologies are 'best' for future missions is a difficult one. A portfolio of technologies to allow optimum propulsion solutions for a diverse set of missions and destinations are described in the roadmap and herein.

  6. Performance Criteria of Nuclear Space Propulsion Systems

    Science.gov (United States)

    Shepherd, L. R.

    Future exploration of the solar system on a major scale will require propulsion systems capable of performance far greater than is achievable with the present generation of rocket engines using chemical propellants. Viable missions going deeper into interstellar space will be even more demanding. Propulsion systems based on nuclear energy sources, fission or (eventually) fusion offer the best prospect for meeting the requirements. The most obvious gain coming from the application of nuclear reactions is the possibility, at least in principle, of obtaining specific impulses a thousandfold greater than can be achieved in chemically energised rockets. However, practical considerations preclude the possibility of exploiting the full potential of nuclear energy sources in any engines conceivable in terms of presently known technology. Achievable propulsive power is a particularly limiting factor, since this determines the acceleration that may be obtained. Conventional chemical rocket engines have specific propulsive powers (power per unit engine mass) in the order of gigawatts per tonne. One cannot envisage the possibility of approaching such a level of performance by orders of magnitude in presently conceivable nuclear propulsive systems. The time taken, under power, to reach a given terminal velocity is proportional to the square of the engine's exhaust velocity and the inverse of its specific power. An assessment of various nuclear propulsion concepts suggests that, even with the most optimistic assumptions, it could take many hundreds of years to attain the velocities necessary to reach the nearest stars. Exploration within a range of the order of a thousand AU, however, would appear to offer viable prospects, even with the low levels of specific power of presently conceivable nuclear engines.

  7. Prospective application of laser plasma propulsion in rocket technology

    International Nuclear Information System (INIS)

    Lu Xin; Zhang Jie; Li Yingjun

    2002-01-01

    Interest in laser plasma propulsion is growing intensively. The interaction of high intensity short laser pulses with materials can produce plasma expansion with a velocity of hundreds of km/s. The specific impulse of ablative laser propulsion can be many tens of times greater than that of chemical rockets. The development and potential application of laser plasma propulsion are discussed

  8. Misconceptions of Electric Propulsion Aircraft and Their Emergent Aviation Markets

    Science.gov (United States)

    Moore, Mark D.; Fredericks, Bill

    2014-01-01

    Over the past several years there have been aircraft conceptual design and system studies that have reached conflicting conclusions relating to the feasibility of full and hybrid electric aircraft. Some studies and propulsion discipline experts have claimed that battery technologies will need to improve by 10 to 20 times before electric aircraft can effectively compete with reciprocating or turbine engines. However, such studies have approached comparative assessments without understanding the compelling differences that electric propulsion offers, how these technologies will fundamentally alter the way propulsion integration is approached, or how these new technologies can not only compete but far exceed existing propulsion solutions in many ways at battery specific energy densities of only 400 watt hours per kilogram. Electric propulsion characteristics offer the opportunity to achieve 4 to 8 time improvements in energy costs with dramatically lower total operating costs, while dramatically improving efficiency, community noise, propulsion system reliability and safety through redundancy, as well as life cycle Green House Gas emissions. Integration of electric propulsion will involve far greater degrees of distribution than existing propulsion solutions due to their compact and scale-free nature to achieve multi-disciplinary coupling and synergistic integration with the aerodynamics, highlift system, acoustics, vehicle control, balance, and aeroelasticity. Appropriate metrics of comparison and differences in analysis/design tools are discussed while comparing electric propulsion to other disruptive technologies. For several initial applications, battery energy density is already sufficient for competitive products, and for many additional markets energy densities will likely be adequate within the next 7 years for vibrant introduction. Market evolution and early adopter markets are discussed, along with the investment areas that will fill technology gaps and

  9. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  10. A review of underwater bio-mimetic propulsion: cruise and fast-start

    Science.gov (United States)

    Chao, Li-Ming; Cao, Yong-Hui; Pan, Guang

    2017-08-01

    This paper reviews recent developments in the understanding of underwater bio-mimetic propulsion. Two impressive models of underwater propulsion are considered: cruise and fast-start. First, we introduce the progression of bio-mimetic propulsion, especially underwater propulsion, where some primary conceptions are touched upon. Second, the understanding of flapping foils, considered as one of the most efficient cruise styles of aquatic animals, is introduced, where the effect of kinematics and the shape and flexibility of foils on generating thrust are elucidated respectively. Fast-start propulsion is always exhibited when predator behaviour occurs, and we provide an explicit introduction of corresponding zoological experiments and numerical simulations. We also provide some predictions about underwater bio-mimetic propulsion.

  11. A review of underwater bio-mimetic propulsion: cruise and fast-start

    Energy Technology Data Exchange (ETDEWEB)

    Chao, Li-Ming; Cao, Yong-Hui; Pan, Guang, E-mail: PanGuang_010@163.com [School of Marine Science and Technology, Northwestern Polytechnical University, Xian 710072 (China)

    2017-08-15

    This paper reviews recent developments in the understanding of underwater bio-mimetic propulsion. Two impressive models of underwater propulsion are considered: cruise and fast-start. First, we introduce the progression of bio-mimetic propulsion, especially underwater propulsion, where some primary conceptions are touched upon. Second, the understanding of flapping foils, considered as one of the most efficient cruise styles of aquatic animals, is introduced, where the effect of kinematics and the shape and flexibility of foils on generating thrust are elucidated respectively. Fast-start propulsion is always exhibited when predator behaviour occurs, and we provide an explicit introduction of corresponding zoological experiments and numerical simulations. We also provide some predictions about underwater bio-mimetic propulsion. (review)

  12. Tools for advanced simulations to nuclear propulsion systems in rockets

    International Nuclear Information System (INIS)

    Torres Sepulveda, A.; Perez Vara, R.

    2004-01-01

    While chemical propulsion rockets have dominated space exploration, other forms of rocket propulsion based on nuclear power, electrostatic and magnetic drive, and other principles besides chemical reactions, have been considered from the earliest days of the field. The goal of most of these advanced rocket propulsion schemes is improved efficiency through higher exhaust velocities, in order to reduce the amount of fuel the rocket vehicle needs to carry, though generally at the expense of high thrust. Nuclear propulsion seems to be the most promising short term technology to plan realistic interplanetary missions. The development of a nuclear electric propulsion spacecraft shall require the development of models to analyse the mission and to understand the interaction between the related subsystems (nuclear reactor, electrical converter, power management and distribution, and electric propulsion) during the different phases of the mission. This paper explores the modelling of a nuclear electric propulsion (NEP) spacecraft type using EcosimPro simulation software. This software is a multi-disciplinary simulation tool with a powerful object-oriented simulation language and state-of-the-art solvers. EcosimPro is the recommended ESA simulation tool for environmental Control and Life Support Systems (ECLSS) and has been used successfully within the framework of the European activities of the International Space Station programme. Furthermore, propulsion libraries for chemical and electrical propulsion are currently being developed under ESA contracts to set this tool as standard usage in the propulsion community. At present, there is not any workable NEP spacecraft, but a standardized-modular, multi-purpose interplanetary spacecraft for post-2000 missions, called ISC-2000, has been proposed in reference. The simulation model presented on this paper is based on the preliminary designs for this spacecraft. (Author)

  13. AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

    International Nuclear Information System (INIS)

    McCarthy, Christina B.; Theilmann, David A.

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

  14. Is effective force application in handrim wheelchair propulsion also efficient?

    Science.gov (United States)

    Bregman, D J J; van Drongelen, S; Veeger, H E J

    2009-01-01

    Efficiency in manual wheelchair propulsion is low, as is the fraction of the propulsion force that is attributed to the moment of propulsion of the wheelchair. In this study we tested the hypothesis that a tangential propulsion force direction leads to an increase in physiological cost, due to (1) the sub-optimal use of elbow flexors and extensors, and/or (2) the necessity of preventing of glenohumeral subluxation. Five able-bodied and 11 individuals with a spinal cord injury propelled a wheelchair while kinematics and kinetics were collected. The results were used to perform inverse dynamical simulations with input of (1) the experimentally obtained propulsion force, and (2) only the tangential component of that force. In the tangential force condition the physiological cost was over 30% higher, while the tangential propulsion force was only 75% of the total experimental force. According to model estimations, the tangential force condition led to more co-contraction around the elbow, and a higher power production around the shoulder joint. The tangential propulsion force led to a significant, but small 4% increase in necessity for the model to compensate for glenohumeral subluxation, which indicates that this is not a likely cause of the decrease in efficiency. The present findings support the hypothesis that the observed force direction in wheelchair propulsion is a compromise between efficiency and the constraints imposed by the wheelchair-user system. This implies that training should not be aimed at optimization of the propulsion force, because this may be less efficient and more straining for the musculoskeletal system.

  15. LO2/LH2 propulsion for outer planet orbiter spacecraft

    Science.gov (United States)

    Garrison, P. W.; Sigurdson, K. B.

    1983-01-01

    Galileo class orbiter missions (750-1500 kg) to the outer planets require a large postinjection delta-V for improved propulsion performance. The present investigation shows that a pump-fed low thrust LO2/LH2 propulsion system can provide a significantly larger net on-orbit mass for a given delta-V than a state-of-the-art earth storable, N2O4/monomethylhydrazine pressure-fed propulsion system. A description is given of a conceptual design for a LO2/LH2 pump-fed propulsion system developed for a Galileo class mission to the outer planets. Attention is given to spacecraft configuration, details regarding the propulsion system, the thermal control of the cryogenic propellants, and aspects of mission performance.

  16. Initial Skill Acquisition of Handrim Wheelchair Propulsion: A New Perspective.

    Science.gov (United States)

    Vegter, Riemer J K; de Groot, Sonja; Lamoth, Claudine J; Veeger, Dirkjan Hej; van der Woude, Lucas H V

    2014-01-01

    To gain insight into cyclic motor learning processes, hand rim wheelchair propulsion is a suitable cyclic task, to be learned during early rehabilitation and novel to almost every individual. To propel in an energy efficient manner, wheelchair users must learn to control bimanually applied forces onto the rims, preserving both speed and direction of locomotion. The purpose of this study was to evaluate mechanical efficiency and propulsion technique during the initial stage of motor learning. Therefore, 70 naive able-bodied men received 12-min uninstructed wheelchair practice, consisting of three 4-min blocks separated by 2 min rest. Practice was performed on a motor-driven treadmill at a fixed belt speed and constant power output relative to body mass. Energy consumption and the kinetics of propulsion technique were continuously measured. Participants significantly increased their mechanical efficiency and changed their propulsion technique from a high frequency mode with a lot of negative work to a longer-slower movement pattern with less power losses. Furthermore a multi-level model showed propulsion technique to relate to mechanical efficiency. Finally improvers and non-improvers were identified. The non-improving group was already more efficient and had a better propulsion technique in the first block of practice (i.e., the fourth minute). These findings link propulsion technique to mechanical efficiency, support the importance of a correct propulsion technique for wheelchair users and show motor learning differences.

  17. Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

    Energy Technology Data Exchange (ETDEWEB)

    Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

    2008-07-01

    Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

  18. An Overview of SBIR Phase 2 Airbreathing Propulsion Technologies

    Science.gov (United States)

    Nguyen, Hung D.; Steele, Gynelle C.; Bitler, Dean W.

    2014-01-01

    Technological innovation is the overall focus of NASA's Small Business Innovation Research (SBIR) program. The program invests in the development of innovative concepts and technologies to help NASA's mission directorates address critical research and development needs for agency projects. This report highlights innovative SBIR Phase II projects from 2007-2012 specifically addressing areas in Airbreathing Propulsion which is one of six core competencies at NASA Glenn Research Center. There are twenty technologies featured with emphasis on a wide spectrum of applications such as with a Turbo-Brayton cryocooler for aircraft superconducting systems, braided composite rotorcraft structures, engine air brake, combustion control valve, flexible composite driveshaft, and much more. Each article in this booklet describes an innovation, technical objective, and highlights NASA commercial and industrial applications. This report serves as an opportunity for NASA personnel including engineers, researchers, and program managers to learn of NASA SBIR's capabilities that might be crosscutting into this technology area. As the result, it would cause collaborations and partnerships between the small companies and NASA Programs and Projects resulting in benefit to both SBIR companies and NASA.

  19. Swimming mechanics and propulsive efficiency in the chambered nautilus

    Science.gov (United States)

    Neil, Thomas R.; Askew, Graham N.

    2018-02-01

    The chambered nautilus (Nautilus pompilius) encounters severe environmental hypoxia during diurnal vertical movements in the ocean. The metabolic cost of locomotion (Cmet) and swimming performance depend on how efficiently momentum is imparted to the water and how long on-board oxygen stores last. While propulsive efficiency is generally thought to be relatively low in jet propelled animals, the low Cmet in Nautilus indicates that this is not the case. We measured the wake structure in Nautilus during jet propulsion swimming, to determine their propulsive efficiency. Animals swam with either an anterior-first or posterior-first orientation. With increasing swimming speed, whole cycle propulsive efficiency increased during posterior-first swimming but decreased during anterior-first swimming, reaching a maximum of 0.76. The highest propulsive efficiencies were achieved by using an asymmetrical contractile cycle in which the fluid ejection phase was relatively longer than the refilling phase, reducing the volume flow rate of the ejected fluid. Our results demonstrate that a relatively high whole cycle propulsive efficiency underlies the low Cmet in Nautilus, representing a strategy to reduce the metabolic demands in an animal that spends a significant part of its daily life in a hypoxic environment.

  20. Hybrid rocket propulsion systems for outer planet exploration missions

    Science.gov (United States)

    Jens, Elizabeth T.; Cantwell, Brian J.; Hubbard, G. Scott

    2016-11-01

    Outer planet exploration missions require significant propulsive capability, particularly to achieve orbit insertion. Missions to explore the moons of outer planets place even more demanding requirements on propulsion systems, since they involve multiple large ΔV maneuvers. Hybrid rockets present a favorable alternative to conventional propulsion systems for many of these missions. They typically enjoy higher specific impulse than solids, can be throttled, stopped/restarted, and have more flexibility in their packaging configuration. Hybrids are more compact and easier to throttle than liquids and have similar performance levels. In order to investigate the suitability of these propulsion systems for exploration missions, this paper presents novel hybrid motor designs for two interplanetary missions. Hybrid propulsion systems for missions to Europa and Uranus are presented and compared to conventional in-space propulsion systems. The hybrid motor design for each of these missions is optimized across a range of parameters, including propellant selection, O/F ratio, nozzle area ratio, and chamber pressure. Details of the design process are described in order to provide guidance for researchers wishing to evaluate hybrid rocket motor designs for other missions and applications.

  1. Chemical rocket propulsion a comprehensive survey of energetic materials

    CERN Document Server

    Shimada, Toru; Sinditskii, Valery; Calabro, Max

    2017-01-01

    Developed and expanded from the work presented at the New Energetic Materials and Propulsion Techniques for Space Exploration workshop in June 2014, this book contains new scientific results, up-to-date reviews, and inspiring perspectives in a number of areas related to the energetic aspects of chemical rocket propulsion. This collection covers the entire life of energetic materials from their conceptual formulation to practical manufacturing; it includes coverage of theoretical and experimental ballistics, performance properties, as well as laboratory-scale and full system-scale, handling, hazards, environment, ageing, and disposal. Chemical Rocket Propulsion is a unique work, where a selection of accomplished experts from the pioneering era of space propulsion and current technologists from the most advanced international laboratories discuss the future of chemical rocket propulsion for access to, and exploration of, space. It will be of interest to both postgraduate and final-year undergraduate students in...

  2. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  3. Integrated Propulsion Data System Public Web Site

    Science.gov (United States)

    Hamilton, Kimberly

    2001-01-01

    The Integrated Propulsion Data System's (IPDS) focus is to provide technologically-advanced philosophies of doing business at SSC that will enhance the existing operations, engineering and management strategies and provide insight and metrics to assess their daily impacts, especially as related to the Propulsion Test Directorate testing scenarios for the 21st Century.

  4. Configurations of hybrid-electric cars propulsion systems

    OpenAIRE

    Cundev, Dobri; Sarac, Vasilija; Stefanov, Goce

    2011-01-01

    Over the last few years, hybrid electric cars have taken significant role in automotive market. There are successful technological solutions of hybrid-electric propulsion systems implemented in commercial passenger cars. Every automobile manufacturer of hybrid vehicles has unique hybrid propulsion system. In this paper, all implemented systems are described, analyzed and compared.

  5. Fusion Reactions and Matter-Antimatter Annihilation for Space Propulsion

    Science.gov (United States)

    2005-07-13

    FUSION REACTIONS AND MATTER- ANTIMATTER ANNIHILATION FOR SPACE PROPULSION Claude DEUTSCH LPGP (UMR-CNRS 8578), Bât. 210, UPS, 91405 Orsay...REPORT TYPE N/A 3. DATES COVERED - 4. TITLE AND SUBTITLE šFusion Reactions And Matter- Antimatter Annihilation For Space Propulsion 5a...which is possible with successful MCF or ICF. Appropriate vessel designs will be presented for fusion as well as for antimatter propulsion. In

  6. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  7. Multiple NEO Rendezvous Using Solar Sail Propulsion

    Science.gov (United States)

    Johnson, Les; Alexander, Leslie; Fabisinski, Leo; Heaton, Andy; Miernik, Janie; Stough, Rob; Wright, Roosevelt; Young, Roy

    2012-01-01

    The NASA Marshall Space Flight Center (MSFC) Advanced Concepts Office performed an assessment of the feasibility of using a near-term solar sail propulsion system to enable a single spacecraft to perform serial rendezvous operations at multiple Near Earth Objects (NEOs) within six years of launch on a small-to-moderate launch vehicle. The study baselined the use of the sail technology demonstrated in the mid-2000 s by the NASA In-Space Propulsion Technology Project and is scheduled to be demonstrated in space by 2014 as part of the NASA Technology Demonstration Mission Program. The study ground rules required that the solar sail be the only new technology on the flight; all other spacecraft systems and instruments must have had previous space test and qualification. The resulting mission concept uses an 80-m X 80-m 3-axis stabilized solar sail launched by an Athena-II rocket in 2017 to rendezvous with 1999 AO10, Apophis and 2001 QJ142. In each rendezvous, the spacecraft will perform proximity operations for approximately 30 days. The spacecraft science payload is simple and lightweight; it will consist of only the multispectral imager flown on the Near Earth Asteroid Rendezvous (NEAR) mission to 433 Eros and 253 Mathilde. Most non-sail spacecraft systems are based on the Messenger mission spacecraft. This paper will describe the objectives of the proposed mission, the solar sail technology to be employed, the spacecraft system and subsystems, as well as the overall mission profile.

  8. Space Nuclear Thermal Propulsion Test Facilities Subpanel. Final report

    International Nuclear Information System (INIS)

    Allen, G.C.; Warren, J.W.; Martinell, J.; Clark, J.S.; Perkins, D.

    1993-04-01

    On 20 Jul. 1989, in commemoration of the 20th anniversary of the Apollo 11 lunar landing, President George Bush proclaimed his vision for manned space exploration. He stated, 'First for the coming decade, for the 1990's, Space Station Freedom, the next critical step in our space endeavors. And next, for the new century, back to the Moon. Back to the future. And this time, back to stay. And then, a journey into tomorrow, a journey to another planet, a manned mission to Mars.' On 2 Nov. 1989, the President approved a national space policy reaffirming the long range goal of the civil space program: to 'expand human presence and activity beyond Earth orbit into the solar system.' And on 11 May 1990, he specified the goal of landing Astronauts on Mars by 2019, the 50th anniversary of man's first steps on the Moon. To safely and ever permanently venture beyond near Earth environment as charged by the President, mankind must bring to bear extensive new technologies. These include heavy lift launch capability from Earth to low-Earth orbit, automated space rendezvous and docking of large masses, zero gravity countermeasures, and closed loop life support systems. One technology enhancing, and perhaps enabling, the piloted Mars missions is nuclear propulsion, with great benefits over chemical propulsion. Asserting the potential benefits of nuclear propulsion, NASA has sponsored workshops in Nuclear Electric Propulsion and Nuclear Thermal Propulsion and has initiated a tri-agency planning process to ensure that appropriate resources are engaged to meet this exciting technical challenge. At the core of this planning process, NASA, DOE, and DOD established six Nuclear Propulsion Technical Panels in 1991 to provide groundwork for a possible tri-agency Nuclear Propulsion Program and to address the President's vision by advocating an aggressive program in nuclear propulsion. To this end the Nuclear Electric Propulsion Technology Panel has focused it energies

  9. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  10. Mechanical efficiency of two commercial lever-propulsion mechanisms for manual wheelchair locomotion.

    Science.gov (United States)

    Lui, Jordon; MacGillivray, Megan K; Sheel, A William; Jeyasurya, Jeswin; Sadeghi, Mahsa; Sawatzky, Bonita Jean

    2013-01-01

    The purpose of this study was to (1) evaluate the mechanical efficiency (ME) of two commercially available lever-propulsion mechanisms for wheelchairs and (2) compare the ME of lever propulsion with hand rim propulsion within the same wheelchair. Of the two mechanisms, one contained a torsion spring while the other used a roller clutch design. We hypothesized that the torsion spring mechanism would increase the ME of propulsion due to a passive recovery stroke enabled by the mechanism. Ten nondisabled male participants with no prior manual wheeling experience performed submaximal exercise tests using both lever-propulsion mechanisms and hand rim propulsion on two different wheelchairs. Cardiopulmonary parameters including oxygen uptake (VO2), heart rate (HR), and energy expenditure (En) were determined. Total external power (Pext) was measured using a drag test protocol. ME was determined by the ratio of Pext to En. Results indicated no significant effect of lever-propulsion mechanism for all physiological measures tested. This suggests that the torsion spring did not result in a physiological benefit compared with the roller clutch mechanism. However, both lever-propulsion mechanisms showed decreased VO2 and HR and increased ME (as a function of slope) compared with hand rim propulsion (p propulsion mechanisms tested are more mechanically efficient than conventional hand rim propulsion, especially when slopes are encountered.

  11. Reusable Reentry Satellite (RRS): Propulsion system trade study

    Science.gov (United States)

    1990-01-01

    The purpose of the Reusable Reentry Satellite (RRS) Propulsion System Trade Study described in this summary report was to investigate various propulsion options available for incorporation on the RRS and to select the option best suited for RRS application. The design requirements for the RRS propulsion system were driven by the total impulse requirements necessary to operate within the performance envelope specified in the RRS System Requirements Documents. These requirements were incorporated within the Design Reference Missions (DRM's) identified for use in this and other subsystem trade studies. This study investigated the following propulsion systems: solid rocket, monopropellant, bipropellant (monomethyl hydrazine and nitrogen tetroxide or MMH/NTO), dual-mode bipropellant (hydrazine and nitrogen tetroxide or N2H4/NTO), liquid oxygen and liquid hydrogen (LO2/LH2), and an advanced design propulsion system using SDI-developed components. A liquid monopropellant blowdown propulsion system was found to be best suited for meeting the RRS requirements and is recommended as the baseline system. This system was chosen because it is the simplest of all investigated, has the fewest components, and is the most cost effective. The monopropellant system meets all RRS performance requirements and has the capability to provide a very accurate deorbit burn which minimizes reentry dispersions. In addition, no new hardware qualification is required for a monopropellant system. Although the bipropellant systems offered some weight savings capability for missions requiring large deorbit velocities, the advantage of a lower mass system only applies if the total vehicle design can be reduced to allow a cheaper launch vehicle to be used. At the time of this trade study, the overall RRS weight budget and launch vehicle selection were not being driven by the propulsion system selection. Thus, the added cost and complexity of more advanced systems did not warrant application.

  12. Ablative Laser Propulsion: An Update, Part I

    International Nuclear Information System (INIS)

    Pakhomov, Andrew V.; Cohen, Timothy; Lin Jun; Thompson, M. Shane; Herren, Kenneth A.

    2004-01-01

    This paper presents an updated review of studies on Ablative Laser Propulsion conducted by the Laser Propulsion Group (LPG) at the University of Alabama in Huntsville. In particular, we describe the newest results of our experimental study of specific impulses and coupling coefficients achieved by double-pulsed ablation of graphite, aluminum, copper and lead targets

  13. Worldwide Space Launch Vehicles and Their Mainstage Liquid Rocket Propulsion

    Science.gov (United States)

    Rahman, Shamim A.

    2010-01-01

    Space launch vehicle begins with a basic propulsion stage, and serves as a missile or small launch vehicle; many are traceable to the 1945 German A-4. Increasing stage size, and increasingly energetic propulsion allows for heavier payloads and greater. Earth to Orbit lift capability. Liquid rocket propulsion began with use of storable (UDMH/N2O4) and evolved to high performing cryogenics (LOX/RP, and LOX/LH). Growth versions of SLV's rely on strap-on propulsive stages of either solid propellants or liquid propellants.

  14. Hybrid Propulsion Demonstration Program 250K Hybrid Motor

    Science.gov (United States)

    Story, George; Zoladz, Tom; Arves, Joe; Kearney, Darren; Abel, Terry; Park, O.

    2003-01-01

    The Hybrid Propulsion Demonstration Program (HPDP) program was formed to mature hybrid propulsion technology to a readiness level sufficient to enable commercialization for various space launch applications. The goal of the HPDP was to develop and test a 250,000 pound vacuum thrust hybrid booster in order to demonstrate hybrid propulsion technology and enable manufacturing of large hybrid boosters for current and future space launch vehicles. The HPDP has successfully conducted four tests of the 250,000 pound thrust hybrid rocket motor at NASA's Stennis Space Center. This paper documents the test series.

  15. Test facilities for evaluating nuclear thermal propulsion systems

    International Nuclear Information System (INIS)

    Beck, D.F.; Allen, G.C.; Shipers, L.R.; Dobranich, D.; Ottinger, C.A.; Harmon, C.D.; Fan, W.C.; Todosow, M.

    1992-01-01

    Interagency panels evaluating nuclear thermal propulsion (NTP) development options have consistently recognized the need for constructing a major new ground test facility to support fuel element and engine testing. This paper summarizes the requirements, configuration, and baseline performance of some of the major subsystems designed to support a proposed ground test complex for evaluating nuclear thermal propulsion fuel elements and engines being developed for the Space Nuclear Thermal Propulsion (SNTP) program. Some preliminary results of evaluating this facility for use in testing other NTP concepts are also summarized

  16. Adaptation of a Filter Assembly to Assess Microbial Bioburden of Pressurant Within a Propulsion System

    Science.gov (United States)

    Benardini, James N.; Koukol, Robert C.; Schubert, Wayne W.; Morales, Fabian; Klatte, Marlin F.

    2012-01-01

    A report describes an adaptation of a filter assembly to enable it to be used to filter out microorganisms from a propulsion system. The filter assembly has previously been used for particulates greater than 2 micrometers. Projects that utilize large volumes of nonmetallic materials of planetary protection concern pose a challenge to their bioburden budget, as a conservative specification value of 30 spores per cubic centimeter is typically used. Helium was collected utilizing an adapted filtration approach employing an existing Millipore filter assembly apparatus used by the propulsion team for particulate analysis. The filter holder on the assembly has a 47-mm diameter, and typically a 1.2-5 micrometer pore-size filter is used for particulate analysis making it compatible with commercially available sterilization filters (0.22 micrometers) that are necessary for biological sampling. This adaptation to an existing technology provides a proof-of-concept and a demonstration of successful use in a ground equipment system. This adaptation has demonstrated that the Millipore filter assembly can be utilized to filter out microorganisms from a propulsion system, whereas in previous uses the filter assembly was utilized for particulates greater than 2 micrometers.

  17. 78 FR 33755 - Project Financing Loans

    Science.gov (United States)

    2013-06-05

    ... CFR Part 1710 [0572-AC21] Project Financing Loans AGENCY: Rural Utilities Service, USDA. ACTION... also considering regulations to clarify the agency's procedures for single asset/project financing... parameters necessary to more effectively and prudently use project financing in the RUS electric loan program...

  18. Nuclear electric propulsion for planetary science missions: NASA technology program planning

    International Nuclear Information System (INIS)

    Doherty, M.P.

    1993-05-01

    This paper presents the status of technology program planning to develop those Nuclear Electric Propulsion technologies needed to meet the advanced propulsion system requirements for planetary science missions in the next century. The technology program planning is based upon technologies with significant development heritage: ion electric propulsion and the SP-100 space nuclear power technologies. Detailed plans are presented for the required ion electric propulsion technology development and demonstration. Closer coordination between space nuclear power and space electric propulsion technology programs is a necessity as technology plans are being further refined in light of NEP concept definition and possible early NEP flight activities

  19. Research Activities on Special Propulsion in BUAA

    International Nuclear Information System (INIS)

    Tang Haibin; Wang Haixing; Liu Chang; Xiang Min; Yao Jie; Liu Yu

    2007-01-01

    An overview is presented of special propulsion research carried out in Beijing University of Aeronautics and Astronautics of China. The research activities are supported by NSFC (National Natural Science Foundation of China), other governmental agencies and industrial partners, which include experimental, analytical and numerical work related to arcjet thrusters, ion thrusters, plasma sail and other new concept propulsions

  20. Aeronautic propulsion systems; Propulseurs aeronautiques

    Energy Technology Data Exchange (ETDEWEB)

    Lepourry, P; Ciryci, R

    1992-12-31

    This book is devoted to airplane pilots having a private licence and who would like to take up a professional rank. It comprises 8 chapters dealing with: the different type of propulsion systems, turbojet, turbofan and piston engines; the propeller (characteristics, different types, functioning, protection systems..); the piston engines (4-stroke cycle, power and efficiency, description, characteristics); the gas generator and its limitations (air intake, combustion chamber, turbines, nozzles, fuel systems..); the performances of propulsion systems; the drive, control and instruments; and the use of engines. The last chapter is a self-evaluation questionnaire about the notions developed in the book. (J.S.)

  1. Antimatter Propulsion Developed by NASA

    Science.gov (United States)

    1999-01-01

    This Quick Time movie shows possible forms of an antimatter propulsion system being developed by NASA. Antimatter annihilation offers the highest possible physical energy density of any known reaction substance. It is about 10 billion times more powerful than that of chemical energy such as hydrogen and oxygen combustion. Antimatter would be the perfect rocket fuel, but the problem is that the basic component of antimatter, antiprotons, doesn't exist in nature and has to manufactured. The process of antimatter development is ongoing and making some strides, but production of this as a propulsion system is far into the future.

  2. Analysis of critical state response in thin films by AC susceptibility measurements

    Czech Academy of Sciences Publication Activity Database

    Youssef, A.; Švindrych, Z.; Hadač, J.; Janů, Zdeněk

    2008-01-01

    Roč. 18, č. 2 (2008), s. 1589-1592 ISSN 1051-8223 R&D Projects: GA ČR GA102/05/0942 Institutional research plan: CEZ:AV0Z10100520 Keywords : AC susceptibility * critical state * harmonics * thin film * axial magnetic-field * superconductor disks * cylinders Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.919, year: 2008

  3. Liquid Oxygen/Liquid Methane Integrated Power and Propulsion

    Science.gov (United States)

    Banker, Brian; Ryan, Abigail

    2016-01-01

    The proposed paper will cover ongoing work at the National Aeronautics and Space Administration (NASA) Johnson Space Center (JSC) on integrated power and propulsion for advanced human exploration. Specifically, it will present findings of the integrated design, testing, and operational challenges of a liquid oxygen / liquid methane (LOx/LCH4) propulsion brassboard and Solid Oxide Fuel Cell (SOFC) system. Human-Mars architectures point to an oxygen-methane economy utilizing common commodities, scavenged from the planetary atmosphere and soil via In-Situ Resource Utilization (ISRU), and common commodities across sub-systems. Due to the enormous mass gear-ratio required for human exploration beyond low-earth orbit, (for every 1 kg of payload landed on Mars, 226 kg will be required on Earth) increasing commonality between spacecraft subsystems such as power and propulsion can result in tremendous launch mass and volume savings. Historically, propulsion and fuel cell power subsystems have had little interaction outside of the generation (fuel cell) and consumption (propulsion) of electrical power. This was largely due to a mismatch in preferred commodities (hypergolics for propulsion; oxygen & hydrogen for fuel cells). Although this stove-piped approach benefits from simplicity in the design process, it means each subsystem has its own tanks, pressurization system, fluid feed system, etc. increasing overall spacecraft mass and volume. A liquid oxygen / liquid methane commodities architecture across propulsion and power subsystems would enable the use of common tankage and associated pressurization and commodity delivery hardware for both. Furthermore, a spacecraft utilizing integrated power and propulsion could use propellant residuals - propellant which could not be expelled from the tank near depletion due to hydrodynamic considerations caused by large flow demands of a rocket engine - to generate power after all propulsive maneuvers are complete thus utilizing

  4. Ship propulsion reactors technology

    International Nuclear Information System (INIS)

    Fribourg, Ch.

    2002-01-01

    This paper takes the state of the art on ship propulsion reactors technology. The french research programs with the corresponding technological stakes, the reactors specifications and advantages are detailed. (A.L.B.)

  5. High Voltage AC underground cable systems for power transmission

    DEFF Research Database (Denmark)

    Bak, Claus Leth; Silva, Filipe Miguel Faria da

    2016-01-01

    researching electrical engineering topics related to using underground cables for power transmission at EHV level and including the 420 kV level. The research topics were laid down by ET/AAU and Energinet.dk in the DANPAC (DANish Power systems with AC Cables) research project. The main topics are discussed...... on the basis of 39 references published by ET/AAU and Energinet.dk. Part I of the paper explains the events that lead to the research project, reactive power compensation, modelling for transient studies, including field measurements and improvements to the existing models, and temporary overvoltages due...... to resonances. Part II covers transient phenomena, harmonics in cables, system modelling for different phenomena, main and backup protections in cable-based networks, online fault detection and future trends....

  6. High Voltage AC underground cable systems for power transmission

    DEFF Research Database (Denmark)

    Bak, Claus Leth; Silva, Filipe Miguel Faria da

    2016-01-01

    researching electrical engineering topics related to using underground cables for power transmission at EHV level and including the 420 kV level. The research topics were laid down by ET/AAU and Energinet.dk in the DANPAC (DANish Power systems with Ac Cables) research project. The main topics are discussed...... on the basis of 39 references published by ET/AAU and Energinet.dk. Part I of the paper explains the events that lead to the research project, reactive power compensation, modelling for transient studies, including field measurements and improvements to the existing models, and temporary overvoltages due...... to resonances. Part II covers transient phenomena, harmonics in cables, system modelling for different phenomena, main and backup protections in cable-based networks, online fault detection and future trends....

  7. Nuclear electric propulsion for planetary science missions: NASA technology program planning

    International Nuclear Information System (INIS)

    Doherty, M.P.

    1993-01-01

    This paper presents the status of technology program planning to achieve readiness of Nuclear Electric Propulsion technologies needed to meet the advanced propulsion system requirements for planetary science missions in the next century. The technology program planning is based upon technologies of significant maturity: ion electric propulsion and the SP-100 space nulcear power technologies. Detailed plans are presented herein for the required ion electric propulsion technology development and demonstration. Closer coordination between space nuclear power and space electric propulsion technology programs is a necessity as technology plans are being further refined in light of NEP concept definition and possible early NEP flight activities

  8. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  9. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  10. The Economics of Advanced In-Space Propulsion

    Science.gov (United States)

    Bangalore, Manju; Dankanich, John

    2016-01-01

    The cost of access to space is the single biggest driver is commercial space sector. NASA continues to invest in both launch technology and in-space propulsion. Low-cost launch systems combined with advanced in-space propulsion offer the greatest potential market capture. Launch market capture is critical to national security and has a significant impact on domestic space sector revenue. NASA typically focuses on pushing the limits on performance. However, the commercial market is driven by maximum net revenue (profits). In order to maximum the infusion of NASA investments, the impact on net revenue must be known. As demonstrated by Boeing's dual launch, the Falcon 9 combined with all Electric Propulsion (EP) can dramatically shift the launch market from foreign to domestic providers.

  11. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  12. Aircraft Electric Propulsion Systems Applied Research at NASA

    Science.gov (United States)

    Clarke, Sean

    2015-01-01

    Researchers at NASA are investigating the potential for electric propulsion systems to revolutionize the design of aircraft from the small-scale general aviation sector to commuter and transport-class vehicles. Electric propulsion provides new degrees of design freedom that may enable opportunities for tightly coupled design and optimization of the propulsion system with the aircraft structure and control systems. This could lead to extraordinary reductions in ownership and operating costs, greenhouse gas emissions, and noise annoyance levels. We are building testbeds, high-fidelity aircraft simulations, and the first highly distributed electric inhabited flight test vehicle to begin to explore these opportunities.

  13. Options for development of space fission propulsion systems

    International Nuclear Information System (INIS)

    Houts, Mike; Van Dyke, Melissa; Godfroy, Tom; Pedersen, Kevin; Martin, James; Dickens, Ricky; Salvail, Pat; Hrbud, Ivana

    2001-01-01

    Fission technology can enable rapid, affordable access to any point in the solar system. Potential fission-based transportation options include high specific power continuous impulse propulsion systems and bimodal nuclear thermal rockets. Despite their tremendous potential for enhancing or enabling deep space and planetary missions, to date space fission systems have only been used in Earth orbit. The first step towards utilizing advanced fission propulsion systems is development of a safe, near-term, affordable fission system that can enhance or enable near-term missions of interest. An evolutionary approach for developing space fission propulsion systems is proposed

  14. High-Lift Propeller Noise Prediction for a Distributed Electric Propulsion Flight Demonstrator

    Science.gov (United States)

    Nark, Douglas M.; Buning, Pieter G.; Jones, William T.; Derlaga, Joseph M.

    2017-01-01

    Over the past several years, the use of electric propulsion technologies within aircraft design has received increased attention. The characteristics of electric propulsion systems open up new areas of the aircraft design space, such as the use of distributed electric propulsion (DEP). In this approach, electric motors are placed in many different locations to achieve increased efficiency through integration of the propulsion system with the airframe. Under a project called Scalable Convergent Electric Propulsion Technology Operations Research (SCEPTOR), NASA is designing a flight demonstrator aircraft that employs many "high-lift propellers" distributed upstream of the wing leading edge and two cruise propellers (one at each wingtip). As the high-lift propellers are operational at low flight speeds (take-off/approach flight conditions), the impact of the DEP configuration on the aircraft noise signature is also an important design consideration. This paper describes efforts toward the development of a mulit-fidelity aerodynamic and acoustic methodology for DEP high-lift propeller aeroacoustic modeling. Specifically, the PAS, OVERFLOW 2, and FUN3D codes are used to predict the aerodynamic performance of a baseline high-lift propeller blade set. Blade surface pressure results from the aerodynamic predictions are then used with PSU-WOPWOP and the F1A module of the NASA second generation Aircraft NOise Prediction Program to predict the isolated high-lift propeller noise source. Comparisons of predictions indicate that general trends related to angle of attack effects at the blade passage frequency are captured well with the various codes. Results for higher harmonics of the blade passage frequency appear consistent for the CFD based methods. Conversely, evidence of the need for a study of the effects of increased azimuthal grid resolution on the PAS based results is indicated and will be pursued in future work. Overall, the results indicate that the computational

  15. Prediction of applied forces in handrim wheelchair propulsion.

    Science.gov (United States)

    Lin, Chien-Ju; Lin, Po-Chou; Guo, Lan-Yuen; Su, Fong-Chin

    2011-02-03

    Researchers of wheelchair propulsion have usually suggested that a wheelchair can be properly designed using anthropometrics to reduce high mechanical load and thus reduce pain and damage to joints. A model based on physiological features and biomechanical principles can be used to determine anthropometric relationships for wheelchair fitting. To improve the understanding of man-machine interaction and the mechanism through which propulsion performance been enhanced, this study develops and validates an energy model for wheelchair propulsion. Kinematic data obtained from ten able-bodied and ten wheelchair-dependent users during level propulsion at an average velocity of 1m/s were used as the input of a planar model with the criteria of increasing efficiency and reducing joint load. Results demonstrate that for both experienced and inexperienced users, predicted handrim contact forces agree with experimental data through an extensive range of the push. Significant deviations that were mostly observed in the early stage of the push phase might result from the lack of consideration of muscle dynamics and wrist joint biomechanics. The proposed model effectively verified the handrim contact force patterns during dynamic propulsion. Users do not aim to generate mechanically most effective forces to avoid high loadings on the joints. Copyright © 2010 Elsevier Ltd. All rights reserved.

  16. Outer Planet Missions with Electric Propulsion Systems—Part I

    Directory of Open Access Journals (Sweden)

    Carlos Renato Huaura Solórzano

    2010-01-01

    Full Text Available For interplanetary missions, efficient electric propulsion systems can be used to increase the mass delivered to the destination. Outer planet exploration has experienced new interest with the launch of the Cassini and New Horizons Missions. At the present, new technologies are studied for better use of electric propulsion systems in missions to the outer planets. This paper presents low-thrust trajectories using the method of the transporting trajectory to Uranus, Neptune, and Pluto. They use nuclear and radio isotopic electric propulsion. These direct transfers have continuous electric propulsion of low power along the entire trajectory. The main goal of the paper is to optimize the transfers, that is, to provide maximum mass to be delivered to the outer planets.

  17. An analytical optimization method for electric propulsion orbit transfer vehicles

    International Nuclear Information System (INIS)

    Oleson, S.R.

    1993-01-01

    Due to electric propulsion's inherent propellant mass savings over chemical propulsion, electric propulsion orbit transfer vehicles (EPOTVs) are a highly efficient mode of orbit transfer. When selecting an electric propulsion device (ion, MPD, or arcjet) and propellant for a particular mission, it is preferable to use quick, analytical system optimization methods instead of time intensive numerical integration methods. It is also of interest to determine each thruster's optimal operating characteristics for a specific mission. Analytical expressions are derived which determine the optimal specific impulse (Isp) for each type of electric thruster to maximize payload fraction for a desired thrusting time. These expressions take into account the variation of thruster efficiency with specific impulse. Verification of the method is made with representative electric propulsion values on a LEO-to-GEO mission. Application of the method to specific missions is discussed

  18. Propulsion via flexible flapping in granular media

    Science.gov (United States)

    Peng, Zhiwei; Ding, Yang; Pietrzyk, Kyle; Elfring, Gwynn; Pak, On Shun

    2017-11-01

    Biological locomotion in nature is often achieved by the interaction between a flexible body and its surrounding medium. The interaction of a flexible body with granular media is less understood compared with viscous fluids partially due to its complex rheological properties. In this work, we explore the effect of flexibility on granular propulsion by considering a simple mechanical model in which a rigid rod is connected to a torsional spring that is under a displacement actuation using a granular resistive force theory. Through a combined numerical and asymptotic investigation, we characterize the propulsive dynamics of such a flexible flapper in relation to the actuation amplitude and spring stiffness, and we compare these dynamics with those observed in a viscous fluid. In addition, we demonstrate that the maximum possible propulsive force can be obtained in the steady propulsion limit with a finite spring stiffness and large actuation amplitude. These results may apply to the development of synthetic locomotive systems that exploit flexibility to move through complex terrestrial media. Funding for Z.P. and Y.D. was partially provided by NSFC 394 Grant No. 11672029 and NSAF-NSFC Grant No. U1530401.

  19. Nuclear propulsion for the space exploration initiative

    International Nuclear Information System (INIS)

    Stanley, M.L.

    1991-01-01

    President Bush's speech of July 20, 1989, outlining a goal to go back to the moon and then Mars initiated the Space Exploration Initiative (SEI). The US Department of Defense (DOD), US Department of Energy (DOE), and NASA have been working together in the planning necessary to initiate a program to develop a nuclear propulsion system. Applications of nuclear technology for in-space transfer of personnel and cargo between Earth orbit and lunar or Martian orbit are being considered as alternatives to chemical propulsion systems. Mission and system concept studies conducted over the past 30 yr have consistently indicated that use of nuclear technology can substantially reduce in-space propellant requirements. A variety of nuclear technology options are currently being studied, including nuclear thermal rockets, nuclear electrical propulsion systems, and hybrid nuclear thermal rockets/nuclear electric propulsion concepts. Concept performance in terms of thrust, weight, power, and efficiency are dependent, and appropriate concept application is mission dependent (i.e., lunar, Mars, cargo, personnel, trajectory, transit time, payload). A comprehensive evaluation of mission application, technology performance capability and maturity, technology development programmatics, and safety characteristics is required to optimize both technology and mission selection to support the Presidential initiative

  20. Challenges of future aircraft propulsion: A review of distributed propulsion technology and its potential application for the all electric commercial aircraft

    Science.gov (United States)

    Gohardani, Amir S.; Doulgeris, Georgios; Singh, Riti

    2011-07-01

    This paper highlights the role of distributed propulsion technology for future commercial aircraft. After an initial historical perspective on the conceptual aspects of distributed propulsion technology and a glimpse at numerous aircraft that have taken distributed propulsion technology to flight, the focal point of the review is shifted towards a potential role this technology may entail for future commercial aircraft. Technological limitations and challenges of this specific technology are also considered in combination with an all electric aircraft concept, as means of predicting the challenges associated with the design process of a next generation commercial aircraft.

  1. The multidisciplinary design optimization of a distributed propulsion blended-wing-body aircraft

    Science.gov (United States)

    Ko, Yan-Yee Andy

    The purpose of this study is to examine the multidisciplinary design optimization (MDO) of a distributed propulsion blended-wing-body (BWB) aircraft. The BWB is a hybrid shape resembling a flying wing, placing the payload in the inboard sections of the wing. The distributed propulsion concept involves replacing a small number of large engines with many smaller engines. The distributed propulsion concept considered here ducts part of the engine exhaust to exit out along the trailing edge of the wing. The distributed propulsion concept affects almost every aspect of the BWB design. Methods to model these effects and integrate them into an MDO framework were developed. The most important effect modeled is the impact on the propulsive efficiency. There has been conjecture that there will be an increase in propulsive efficiency when there is blowing out of the trailing edge of a wing. A mathematical formulation was derived to explain this. The formulation showed that the jet 'fills in' the wake behind the body, improving the overall aerodynamic/propulsion system, resulting in an increased propulsive efficiency. The distributed propulsion concept also replaces the conventional elevons with a vectored thrust system for longitudinal control. An extension of Spence's Jet Flap theory was developed to estimate the effects of this vectored thrust system on the aircraft longitudinal control. It was found to provide a reasonable estimate of the control capability of the aircraft. An MDO framework was developed, integrating all the distributed propulsion effects modeled. Using a gradient based optimization algorithm, the distributed propulsion BWB aircraft was optimized and compared with a similarly optimized conventional BWB design. Both designs are for an 800 passenger, 0.85 cruise Mach number and 7000 nmi mission. The MDO results found that the distributed propulsion BWB aircraft has a 4% takeoff gross weight and a 2% fuel weight. Both designs have similar planform shapes

  2. Turboprop Propulsion Mechanic.

    Science.gov (United States)

    Chanute AFB Technical Training Center, IL.

    This instructional package consists of a plan of instruction, glossary, and student handouts and exercises for use in training Air Force personnel to become turboprop propulsion mechanics. Addressed in the individual lessons of the course are the following: common hand tools, hardware, measuring devices, and safety wiring; aircraft and engine…

  3. NASA's Launch Propulsion Systems Technology Roadmap

    Science.gov (United States)

    McConnaughey, Paul K.; Femminineo, Mark G.; Koelfgen, Syri J.; Lepsch, Roger A; Ryan, Richard M.; Taylor, Steven A.

    2012-01-01

    Safe, reliable, and affordable access to low-Earth (LEO) orbit is necessary for all of the United States (US) space endeavors. In 2010, NASA s Office of the Chief Technologist commissioned 14 teams to develop technology roadmaps that could be used to guide the Agency s and US technology investment decisions for the next few decades. The Launch Propulsion Systems Technology Area (LPSTA) team was tasked to address the propulsion technology challenges for access to LEO. The developed LPSTA roadmap addresses technologies that enhance existing solid or liquid propulsion technologies and their related ancillary systems or significantly advance the technology readiness level (TRL) of less mature systems like airbreathing, unconventional, and other launch technologies. In developing this roadmap, the LPSTA team consulted previous NASA, military, and industry studies as well as subject matter experts to develop their assessment of this field, which has fundamental technological and strategic impacts for US space capabilities.

  4. Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

    Science.gov (United States)

    Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

    2012-01-01

    The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

  5. Ultra-high temperature direct propulsion

    International Nuclear Information System (INIS)

    Araj, K.J.; Slovik, G.; Powell, J.R.; Ludewig, H.

    1987-01-01

    Potential advantages of ultra-high exhaust temperature (3000 K - 4000 K) direct propulsion nuclear rockets are explored. Modifications to the Particle Bed Reactor (PBR) to achieve these temperatures are described. Benefits of ultra-high temperature propulsion are discussed for two missions - orbit transfer (ΔV = 5546 m/s) and interplanetary exploration (ΔV = 20000 m/s). For such missions ultra-high temperatures appear to be worth the additional complexity. Thrust levels are reduced substantially for a given power level, due to the higher enthalpy caused by partial disassociation of the hydrogen propellant. Though technically challenging, it appears potentially feasible to achieve such ultra high temperatures using the PBR

  6. Hybrid Propulsion Technology for Robotic Science Missions, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — C3 Propulsion's Hybrid Propulsion Technology will be applied to a NASA selected Sample Return Mission. Phase I will demonstrate Proof-of-Principle and Phase II will...

  7. An Intelligent Propulsion Control Architecture to Enable More Autonomous Vehicle Operation

    Science.gov (United States)

    Litt, Jonathan S.; Sowers, T. Shane; Simon, Donald L.; Owen, A. Karl; Rinehart, Aidan W.; Chicatelli, Amy K.; Acheson, Michael J.; Hueschen, Richard M.; Spiers, Christopher W.

    2018-01-01

    This paper describes an intelligent propulsion control architecture that coordinates with the flight control to reduce the amount of pilot intervention required to operate the vehicle. Objectives of the architecture include the ability to: automatically recognize the aircraft operating state and flight phase; configure engine control to optimize performance with knowledge of engine condition and capability; enhance aircraft performance by coordinating propulsion control with flight control; and recognize off-nominal propulsion situations and to respond to them autonomously. The hierarchical intelligent propulsion system control can be decomposed into a propulsion system level and an individual engine level. The architecture is designed to be flexible to accommodate evolving requirements, adapt to technology improvements, and maintain safety.

  8. Institute for Computational Mechanics in Propulsion (ICOMP)

    Science.gov (United States)

    Keith, Theo G., Jr. (Editor); Balog, Karen (Editor); Povinelli, Louis A. (Editor)

    2001-01-01

    The Institute for Computational Mechanics in Propulsion (ICOMP) was formed to develop techniques to improve problem-solving capabilities in all aspects of computational mechanics related to propulsion. ICOMP is operated by the Ohio Aerospace Institute (OAI) and funded via numerous cooperative agreements by the NASA Glenn Research Center in Cleveland, Ohio. This report describes the activities at ICOMP during 1999, the Institute's fourteenth year of operation.

  9. Comprehensive report of aeropropulsion, space propulsion, space power, and space science applications of the Lewis Research Center

    Science.gov (United States)

    1988-01-01

    The research activities of the Lewis Research Center for 1988 are summarized. The projects included are within basic and applied technical disciplines essential to aeropropulsion, space propulsion, space power, and space science/applications. These disciplines are materials science and technology, structural mechanics, life prediction, internal computational fluid mechanics, heat transfer, instruments and controls, and space electronics.

  10. Individual muscle contributions to push and recovery subtasks during wheelchair propulsion.

    Science.gov (United States)

    Rankin, Jeffery W; Richter, W Mark; Neptune, Richard R

    2011-04-29

    Manual wheelchair propulsion places considerable physical demand on the upper extremity and is one of the primary activities associated with the high prevalence of upper extremity overuse injuries and pain among wheelchair users. As a result, recent effort has focused on determining how various propulsion techniques influence upper extremity demand during wheelchair propulsion. However, an important prerequisite for identifying the relationships between propulsion techniques and upper extremity demand is to understand how individual muscles contribute to the mechanical energetics of wheelchair propulsion. The purpose of this study was to use a forward dynamics simulation of wheelchair propulsion to quantify how individual muscles deliver, absorb and/or transfer mechanical power during propulsion. The analysis showed that muscles contribute to either push (i.e., deliver mechanical power to the handrim) or recovery (i.e., reposition the arm) subtasks, with the shoulder flexors being the primary contributors to the push and the shoulder extensors being the primary contributors to the recovery. In addition, significant activity from the shoulder muscles was required during the transition between push and recovery, which resulted in increased co-contraction and upper extremity demand. Thus, strengthening the shoulder flexors and promoting propulsion techniques that improve transition mechanics have much potential to reduce upper extremity demand and improve rehabilitation outcomes. Copyright © 2011 Elsevier Ltd. All rights reserved.

  11. The influence of speed and grade on wheelchair propulsion hand pattern.

    Science.gov (United States)

    Slowik, Jonathan S; Requejo, Philip S; Mulroy, Sara J; Neptune, Richard R

    2015-11-01

    The hand pattern used during manual wheelchair propulsion (i.e., full-cycle hand path) can provide insight into an individual's propulsion technique. However, previous analyses of hand patterns have been limited by their focus on a single propulsion condition and reliance on subjective qualitative characterization methods. The purpose of this study was to develop a set of objective quantitative parameters to characterize hand patterns and determine the influence of propulsion speed and grade of incline on the patterns preferred by manual wheelchair users. Kinematic and kinetic data were collected from 170 experienced manual wheelchair users on an ergometer during three conditions: level propulsion at their self-selected speed, level propulsion at their fastest comfortable speed and graded propulsion (8%) at their level self-selected speed. Hand patterns were quantified using a set of objective parameters, and differences across conditions were identified. Increased propulsion speed resulted in a shift away from under-rim hand patterns. Increased grade of incline resulted in the hand remaining near the handrim throughout the cycle. Manual wheelchair users change their hand pattern based on task-specific constraints and goals. Further work is needed to investigate how differences between hand patterns influence upper extremity demand and potentially lead to the development of overuse injuries and pain. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. AcMNPV

    African Journals Online (AJOL)

    USER

    2010-08-16

    Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

  13. Integrated propulsion for near-Earth space missions. Volume 1: Executive summary

    Science.gov (United States)

    Dailey, C. L.; Meissinger, H. F.; Lovberg, R. H.; Zafran, S.

    1981-01-01

    Tradeoffs between electric propulsion system mass ratio and transfer time from LEO to GEO were conducted parametrically for various thruster efficiency, specific impulse, and other propulsion parameters. A computer model was developed for performing orbit transfer calculations which included the effects of aerodynamic drag, radiation degradation, and occultation. The tradeoff results showed that thruster technology areas for integrated propulsion should be directed towards improving primary thruster efficiency in the range from 1500 to 2500 seconds, and be continued towards reducing specific mass. Comparison of auxiliary propulsion systems showed large total propellant mass savings with integrated electric auxiliary propulsion. Stationkeeping is the most demanding on orbit propulsion requirement. At area densities above 0.5 sq m/kg, East-West stationkeeping requirements from solar pressure exceed North-South stationkeeping requirements from gravitational forces. A solar array pointing strategy was developed to minimize the effects of atmospheric drag at low altitude, enabling electric propulsion to initiate orbit transfer at Shuttle's maximum cargo carrying altitude. Gravity gradient torques are used during ascent to sustain the spacecraft roll motion required for optimum solar array illumination. A near optimum cover glass thickness of 6 mils was established for LEO to GEO transfer.

  14. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  15. Using Additive Manufacturing to Print a CubeSat Propulsion System

    Science.gov (United States)

    Marshall, William M.

    2015-01-01

    CubeSats are increasingly being utilized for missions traditionally ascribed to larger satellites CubeSat unit (1U) defined as 10 cm x 10 cm x 11 cm. Have been built up to 6U sizes. CubeSats are typically built up from commercially available off-the-shelf components, but have limited capabilities. By using additive manufacturing, mission specific capabilities (such as propulsion), can be built into a system. This effort is part of STMD Small Satellite program Printing the Complete CubeSat. Interest in propulsion concepts for CubeSats is rapidly gaining interest-Numerous concepts exist for CubeSat scale propulsion concepts. The focus of this effort is how to incorporate into structure using additive manufacturing. End-use of propulsion system dictates which type of system to develop-Pulse-mode RCS would require different system than a delta-V orbital maneuvering system. Team chose an RCS system based on available propulsion systems and feasibility of printing using a materials extrusion process. Initially investigated a cold-gas propulsion system for RCS applications-Materials extrusion process did not permit adequate sealing of part to make this a functional approach.

  16. Aircraft Nuclear Propulsion Program: Quarterly Progress Report for Period Ending December 31, 1956, Part 1 - 5

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, W. H. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Cramer, S. J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Miller, A. J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    1957-03-12

    This quarterly progress report of the Aircraft Nuclear Propulsion Project at ORNL records the technical progress of the research on circulating-fuel reactors and other ANP research at the Laboratory under its Contract W-7405-eng-26. The report is divided into five major parts: 1. Aircraft Reactor Engineering, 2. Chemistry, 3. Metallurgy, 4. Heat Transfer and Physical Properties, Radiation Damage, and Fuel Recovery and Reprocessing, and 5. Reactor Shielding. The ANP Project is comprised of about 550 technical and scientific personnel engaged in many phases of research directed toward the achievement of nuclear propulsion of aircraft. A considerable portion of this research is performed in support of the work of other organizations participating in the national ANP effort. However, the bulk of the ANP research at ORNL is directed toward the development of a circulating-fuel type of reactor. The design, construction, and operation of the Aircraft Reactor Test (ART), with the cooperation of the Pratt & Whitney Aircraft Division, are the current objectives of the project. The ART is to be a power plant system that will include a 60-Mw circulating fuel reflector-moderator reactor and adequate means for heat disposal. Operation of the system will be for the purpose of determining feasibility and for studying the problems associated with the design, construction, and operation of a high-power circulating-fuel refIector-moderated aircraft reactor system.

  17. Recent advances in nuclear powered electric propulsion for space exploration

    International Nuclear Information System (INIS)

    Cassady, R. Joseph; Frisbee, Robert H.; Gilland, James H.; Houts, Michael G.; LaPointe, Michael R.; Maresse-Reading, Colleen M.; Oleson, Steven R.; Polk, James E.; Russell, Derrek; Sengupta, Anita

    2008-01-01

    Nuclear and radioisotope powered electric thrusters are being developed as primary in space propulsion systems for potential future robotic and piloted space missions. Possible applications for high-power nuclear electric propulsion include orbit raising and maneuvering of large space platforms, lunar and Mars cargo transport, asteroid rendezvous and sample return, and robotic and piloted planetary missions, while lower power radioisotope electric propulsion could significantly enhance or enable some future robotic deep space science missions. This paper provides an overview of recent US high-power electric thruster research programs, describing the operating principles, challenges, and status of each technology. Mission analysis is presented that compares the benefits and performance of each thruster type for high priority NASA missions. The status of space nuclear power systems for high-power electric propulsion is presented. The paper concludes with a discussion of power and thruster development strategies for future radioisotope electric propulsion systems

  18. Recent advances in nuclear powered electric propulsion for space exploration

    Energy Technology Data Exchange (ETDEWEB)

    Cassady, R. Joseph [Aerojet Corp., Redmond, CA (United States); Frisbee, Robert H. [Jet Propulsion Laboratory, Pasadena, CA (United States); Gilland, James H. [Ohio Aerospace Institute, Cleveland, OH (United States); Houts, Michael G. [NASA Marshall Space Flight Center, Huntsville, AL 35812 (United States); LaPointe, Michael R. [NASA Marshall Space Flight Center, Huntsville, AL 35812 (United States)], E-mail: michael.r.lapointe@nasa.gov; Maresse-Reading, Colleen M. [Jet Propulsion Laboratory, Pasadena, CA (United States); Oleson, Steven R. [NASA Glenn Research Center, Cleveland, OH (United States); Polk, James E. [Jet Propulsion Laboratory, Pasadena, CA (United States); Russell, Derrek [Northrop Grumman Space Technology, Redondo Beach, CA (United States); Sengupta, Anita [Jet Propulsion Laboratory, Pasadena, CA (United States)

    2008-03-15

    Nuclear and radioisotope powered electric thrusters are being developed as primary in space propulsion systems for potential future robotic and piloted space missions. Possible applications for high-power nuclear electric propulsion include orbit raising and maneuvering of large space platforms, lunar and Mars cargo transport, asteroid rendezvous and sample return, and robotic and piloted planetary missions, while lower power radioisotope electric propulsion could significantly enhance or enable some future robotic deep space science missions. This paper provides an overview of recent US high-power electric thruster research programs, describing the operating principles, challenges, and status of each technology. Mission analysis is presented that compares the benefits and performance of each thruster type for high priority NASA missions. The status of space nuclear power systems for high-power electric propulsion is presented. The paper concludes with a discussion of power and thruster development strategies for future radioisotope electric propulsion systems.

  19. Propulsion materials

    Energy Technology Data Exchange (ETDEWEB)

    Wall, Edward J. [U.S. Dept. of Energy, Washington, D.C. (United States); Sullivan, Rogelio A. [U.S. Dept. of Energy, Washington, D.C. (United States); Gibbs, Jerry L. [U.S. Dept. of Energy, Washington, D.C. (United States)

    2008-01-01

    The Department of Energy’s (DOE’s) Office of Vehicle Technologies (OVT) is pleased to introduce the FY 2007 Annual Progress Report for the Propulsion Materials Research and Development Program. Together with DOE national laboratories and in partnership with private industry and universities across the United States, the program continues to engage in research and development (R&D) that provides enabling materials technology for fuel-efficient and environmentally friendly commercial and passenger vehicles.

  20. State-of-the-Art for Small Satellite Propulsion Systems

    Science.gov (United States)

    Parker, Khary I.

    2016-01-01

    SmallSats are a low cost access to space with an increasing need for propulsion systems. NASA, and other organizations, will be using SmallSats that require propulsion systems to: a) Conduct high quality near and far reaching on-orbit research and b) Perform technology demonstrations. Increasing call for high reliability and high performing for SmallSat components. Many SmallSat propulsion technologies are currently under development: a) Systems at various levels of maturity and b) Wide variety of systems for many mission applications.

  1. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  2. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  3. Selection of topologies for the PHOTONERGY{sup TM} project. Optimised design and control of inverter for photovoltaic systems: the AC-module

    Energy Technology Data Exchange (ETDEWEB)

    Baekhoej Kjaer, S.

    2002-06-01

    The PHOTONERGY{sup TM} project (also known as the former 'SolcelleInverter' project) is by this report carried into its third stage; the selection of a suitable topology for the AC-Module inverter. The selection of a suitable topology is based on State-Of-The-Art analysis a specifications and a comparison of four grid-tied inverters and nine dc/dc converters. This implies 23 possible combinations, from which nine is investigated with respect to efficiency in six working points, the number of components and to some extent also the rating of the components. The conclusion is that the target of a European efficiency of 93.7% is hard to achieve. But four of the examined, and two newly discovered, inverters are recommended for a further examination by means of estimations, calculations and simulations of: cost, complexity, robustness, efficiency and mass-production. The system-layout is also examined. The first layout implies that the PV-Module and the inverter is integrated into one unit and the second layout involves that the inverter is placed indoor. The layouts are compared with respect to cable-losses, enclosure demanding and lifetime. The conclusion is somehow ambiguous and a further investigation should be initiated in order to get a clear result. (au)

  4. Mars Hybrid Propulsion System Trajectory Analysis. Part II; Cargo Missions

    Science.gov (United States)

    Chai, Patrick R.; Merrill, Raymond G.; Qu, Min

    2015-01-01

    NASA's Human Spaceflight Architecture Team is developing a reusable hybrid transportation architecture in which both chemical and electric propulsion systems are used to send crew and cargo to Mars destinations such as Phobos, Deimos, the surface of Mars, and other orbits around Mars. By combining chemical and electrical propulsion into a single spaceship and applying each where it is more effective, the hybrid architecture enables a series of Mars trajectories that are more fuel-efficient than an all chemical architecture without significant increases in flight times. This paper shows the feasibility of the hybrid transportation architecture to pre-deploy cargo to Mars and Phobos in support of the Evolvable Mars Campaign crew missions. The analysis shows that the hybrid propulsion stage is able to deliver all of the current manifested payload to Phobos and Mars through the first three crew missions. The conjunction class trajectory also allows the hybrid propulsion stage to return to Earth in a timely fashion so it can be reused for additional cargo deployment. The 1,100 days total trip time allows the hybrid propulsion stage to deliver cargo to Mars every other Earth-Mars transit opportunity. For the first two Mars surface mission in the Evolvable Mars Campaign, the short trip time allows the hybrid propulsion stage to be reused for three round-trip journeys to Mars, which matches the hybrid propulsion stage's designed lifetime for three round-trip crew missions to the Martian sphere of influence.

  5. Laser propulsion activity in South Africa

    CSIR Research Space (South Africa)

    Michaelis, MM

    2006-07-01

    Full Text Available hemisphere are becoming excited at the prospect of a considerable reduction in the cost of launch to low Earth orbit (LEO) by means of laser propulsion (LP) (see ref. 1). We argue here that developing nations also should assess the potential of a cheaper... of the grandiose scheme of ‘Space Port Kilimanjaro’ (Fig. 5), envis- aged by various authors becoming a reality, South African scien- tists, engineers and financiers would benefit. Kilimanjaro is regarded by some13 as the prime location for laser propulsion...

  6. Advanced Propulsion Physics Lab: Eagleworks Investigations

    Science.gov (United States)

    Scogin, Tyler

    2014-01-01

    Eagleworks Laboratory is an advanced propulsions physics laboratory with two primary investigations currently underway. The first is a Quantum Vacuum Plasma Thruster (QVPT or Q-thrusters), an advanced electric propulsion technology in the development and demonstration phase. The second investigation is in Warp Field Interferometry (WFI). This is an investigation of Dr. Harold "Sonny" White's theoretical physics models for warp field equations using optical experiments in the Electro Optical laboratory (EOL) at Johnson Space Center. These investigations are pursuing technology necessary to enable human exploration of the solar system and beyond.

  7. Fish's Muscles Distortion and Pectoral Fins Propulsion of Lift-Based Mode

    Science.gov (United States)

    Yang, S. B.; Han, X. Y.; Qiu, J.

    As a sort of MPF(median and/or paired fin propulsion), pectoral fins propulsion makes fish easier to maneuver than other propulsion, according to the well-established classification scheme proposed by Webb in 1984. Pectoral fins propulsion is classified into oscillatory propulsion, undulatory propulsion and compound propulsion. Pectoral fins oscillatory propulsion, is further ascribable to two modes: drag-based mode and lift-based mode. And fish exhibits strong cruise ability by using lift-based mode. Therefore to robot fish design using pectoral fins lift-based mode will bring a new revolution to resources exploration in blue sea. On the basis of the wave plate theory, a kinematic model of fish’s pectoral fins lift-based mode is established associated with the behaviors of cownose ray (Rhinoptera bonasus) in the present work. In view of the power of fish’s locomotion from muscle distortion, it would be helpful benefit to reveal the mechanism of fish’s locomotion variation dependent on muscles distortion. So this study puts forward the pattern of muscles distortion of pectoral fins according to the character of skeletons and muscles of cownose ray in morphology and simulates the kinematics of lift-based mode using nonlinear analysis software. In the symmetrical fluid field, the model is simulated left-right symmetrically or asymmetrically. The results qualitatively show how muscles distortion determines the performance of fish locomotion. Finally the efficient muscles distortion associated with the preliminary dynamics is induced.

  8. Revisiting alpha decay-based near-light-speed particle propulsion

    International Nuclear Information System (INIS)

    Zhang, Wenwu; Liu, Zhen; Yang, Yang; Du, Shiyu

    2016-01-01

    Interplanet and interstellar travels require long-term propulsion of spacecrafts, whereas the conventional schemes of propulsion are limited by the velocity of the ejected mass. In this study, alpha particles released by nuclear decay are considered as a potential solution for long-time acceleration. The principle of near-light-speed particle propulsion (NcPP) was elucidated and the stopping and range of ions in matter (SRIM) was used to predict theoretical accelerations. The results show that NcPP by means of alpha decay is feasible for long-term spacecraft propulsion and posture adjustment in space. A practical NcPP sail can achieve a speed >150 km/s and reach the brink of the solar system faster than a mass equivalent solar sail. Finally, to significantly improve the NcPP sail, the hypothesis of stimulated acceleration of nuclear decay (SAND) was proposed, which may shorten the travel time to Mars to within 20 days. - Highlights: • SRIM was used to study the alpha particle penetration depth and efficiency. • Correlation between thickness of decayable foil and propulsion force was established. • With the hypothesis of SAND, the travel time to Mars may be shortened to <20 days.

  9. Electric Motors for Non-Cryogenic Hybrid Electric and Turboelectric Propulsion

    Science.gov (United States)

    Duffy, Kirsten P.

    2015-01-01

    NASA Glenn Research Center is investigating hybrid electric and turboelectric propulsion concepts for future aircraft to reduce fuel burn, emissions, and noise. Systems studies show that the weight and efficiency of the electric system components need to be improved for this concept to be feasible. However, advances in motor component materials such as soft magnetic materials, hard magnetic materials, conductors, thermal insulation, and structural materials are expected in the coming years, and should improve motor performance. This study investigates several motor types for a one megawatt application, and projects the motor performance benefits of new component materials that might be available in the coming decades.

  10. Performance enhancement using power beaming for electric propulsion earth orbital transporters

    International Nuclear Information System (INIS)

    Dagle, J.E.

    1991-01-01

    An electric propulsion Earth orbital transport vehicle (EOTV) can effectively deliver large payloads using much less propellant than chemical transfer methods. By using an EOTV instead of a chemical upper stage, either a smaller launch vehicle can be used for the same satellite mass or a larger satellite can be deployed using the same launch vehicle. However, the propellant mass savings from using the higher specific impulse of electric propulsion may not be enough to overcome the disadvantage of the added mass and cost of the electric propulsion power source. Power system limitations have been a major factor delaying the acceptance and use of electric propulsion. This paper outlines the power requirements of electric propulsion technology being developed today, including arcjets, magnetoplasmadynamic (MPD) thrusters, and ion engines. Power supply characteristics are discussed for nuclear, solar, and power-beaming systems. Operational characteristics are given for each, as are the impacts of the power supply alternative on the overall craft performance. Because of its modular nature, the power-beaming approach is able to meet the power requirements of all three electric propulsion types. Also, commonality of approach allows different electric propulsion approaches to be powered by a single power supply approach. Power beaming exhibits better flexibility and performance than on-board nuclear or solar power systems

  11. Successful neural network projects at the Idaho National Engineering Laboratory

    International Nuclear Information System (INIS)

    Cordes, G.A.

    1991-01-01

    This paper presents recent and current projects at the Idaho National Engineering Laboratory (INEL) that research and apply neural network technology. The projects are summarized in the paper and their direct application to space reactor power and propulsion systems activities is discussed. 9 refs., 10 figs., 3 tabs

  12. Low ac loss geometries in YBCO coated conductors

    International Nuclear Information System (INIS)

    Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

  13. Low ac loss geometries in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

    2007-10-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

  14. Results from a large-scale MHD propulsion experiment

    International Nuclear Information System (INIS)

    Petrick, M.; Libera, J.; Bouillard, J.X.; Pierson, E.S.; Hill, D.

    1992-01-01

    This paper reports on magnetohydrodynamic (MHD) thrusters which have long been recognized as potentially attractive candidates for ship propulsion because such systems eliminate the conventional rotating drive components. The MHD thruster is essentially an electromagnet (EM) pump operating in seawater. An electrical current is passed directly through the seawater and interacts with an applied magnetic field; the interaction of the magnetic field and the electrode current in the seawater results in a Lorentz force acting on the water, and the reaction to this force propels the vessel forward. The concept of EM propulsion has been examined periodically during the past 35 years as an alternative method of propulsion for surface ships and submersibles. The conclusions reached in early studies were that MHD thrusters restricted to fields of 2T (the state-of-the-art at that time) were impractical and very inefficient. With the evolution of superconducting magnet technology, later studies investigated the performance of MHD thrusters with much higher magnetic field strengths and concluded that at higher fields (>6 T) practical MHD propulsion systems appear possible

  15. INSPACE CHEMICAL PROPULSION SYSTEMS AT NASA's MARSHALL SPACE FLIGHT CENTER: HERITAGE AND CAPABILITIES

    Science.gov (United States)

    McRight, P. S.; Sheehy, J. A.; Blevins, J. A.

    2005-01-01

    NASA s Marshall Space Flight Center (MSFC) is well known for its contributions to large ascent propulsion systems such as the Saturn V rocket and the Space Shuttle external tank, solid rocket boosters, and main engines. This paper highlights a lesser known but very rich side of MSFC-its heritage in the development of in-space chemical propulsion systems and its current capabilities for spacecraft propulsion system development and chemical propulsion research. The historical narrative describes the flight development activities associated with upper stage main propulsion systems such as the Saturn S-IVB as well as orbital maneuvering and reaction control systems such as the S-IVB auxiliary propulsion system, the Skylab thruster attitude control system, and many more recent activities such as Chandra, the Demonstration of Automated Rendezvous Technology (DART), X-37, the X-38 de-orbit propulsion system, the Interim Control Module, the US Propulsion Module, and multiple technology development activities. This paper also highlights MSFC s advanced chemical propulsion research capabilities, including an overview of the center s Propulsion Systems Department and ongoing activities. The authors highlight near-term and long-term technology challenges to which MSFC research and system development competencies are relevant. This paper concludes by assessing the value of the full range of aforementioned activities, strengths, and capabilities in light of NASA s exploration missions.

  16. RSMASS-D nuclear thermal propulsion and bimodal system mass models

    Science.gov (United States)

    King, Donald B.; Marshall, Albert C.

    1997-01-01

    Two relatively simple models have been developed to estimate reactor, radiation shield, and balance of system masses for a particle bed reactor (PBR) nuclear thermal propulsion concept and a cermet-core power and propulsion (bimodal) concept. The approach was based on the methodology developed for the RSMASS-D models. The RSMASS-D approach for the reactor and shield sub-systems uses a combination of simple equations derived from reactor physics and other fundamental considerations along with tabulations of data from more detailed neutron and gamma transport theory computations. Relatively simple models are used to estimate the masses of other subsystem components of the nuclear propulsion and bimodal systems. Other subsystem components include instrumentation and control (I&C), boom, safety systems, radiator, thermoelectrics, heat pipes, and nozzle. The user of these models can vary basic design parameters within an allowed range to achieve a parameter choice which yields a minimum mass for the operational conditions of interest. Estimated system masses are presented for a range of reactor power levels for propulsion for the PBR propulsion concept and for both electrical power and propulsion for the cermet-core bimodal concept. The estimated reactor system masses agree with mass predictions from detailed calculations with xx percent for both models.

  17. An N+3 Technology Level Reference Propulsion System

    Science.gov (United States)

    Jones, Scott M.; Haller, William J.; Tong, Michael To-Hing

    2017-01-01

    An N+3 technology level engine, suitable as a propulsion system for an advanced single-aisle transport, was developed as a reference cycle for use in technology assessment and decision-making efforts. This reference engine serves three main purposes: it provides thermodynamic quantities at each major engine station, it provides overall propulsion system performance data for vehicle designers to use in their analyses, and it can be used for comparison against other proposed N+3 technology-level propulsion systems on an equal basis. This reference cycle is meant to represent the expected capability of gas turbine engines in the N+3 timeframe given reasonable extrapolations of technology improvements and the ability to take full advantage of those improvements.

  18. Staking-out projected boundaries of natural property Vršac Mountains using the RTK GPS/glonass method

    Directory of Open Access Journals (Sweden)

    Gučević Jelena

    2012-01-01

    Full Text Available The existing topographic and cadastral maps of the former Yugoslav republics are in Gauss-Krüger projection on Bessel ellipsoid. For the collected GPS data to comply with the existing cartographic material, it is necessary to provide the transformation parameters from WGS84 to Bessel ellipsoid and according to the principles of cartographic mapping, to make mappings in the plane of the State Coordinate System (SCS. The aim of this research is to present the surveying activities necessary for the establishment and maintenance of digital cartographic basis, which is shown in the test area of “VRŠAC MOUNTAINS”, a Serbian region with outstanding characteristics. In order to establish a connection between the collected data, it is necessary to primarily calculate the parameters of transformation from WGS84 into the SCS. After the vectorisation of projected boundaries from bases made in the SCS, the transformation of vectorised boundary lines from SCS into the WGS84 is carried out, followed by staking the boundaries. To understand the fundamental differences in the methodology of using GPS receivers, it is important to emphasise that the concept of GPS determination of the coordinates is generally divided into absolute and relative positioning. If the correct procedure of GPS positioning, applied to certain environmental conditions, is not followed, the error up to 200 m could be expected. Conclusions are drawn about the selection of staking methods, related to the applied instruments and specific field conditions. The stakeout procedures are given in accordance with the principles of geodetic positioning. [Projekat Ministarstva nauke Republike Srbije, br. 043007: Istraživanje klimatskih promena i njihovog uticaja na životnu sredinu: praćenje uticaja, adaptacija i ublažavanje

  19. Propulsive efficiency of frog swimming with different feet and swimming patterns

    Directory of Open Access Journals (Sweden)

    Fan Jizhuang

    2017-04-01

    Full Text Available Aquatic and terrestrial animals have different swimming performances and mechanical efficiencies based on their different swimming methods. To explore propulsion in swimming frogs, this study calculated mechanical efficiencies based on data describing aquatic and terrestrial webbed-foot shapes and swimming patterns. First, a simplified frog model and dynamic equation were established, and hydrodynamic forces on the foot were computed according to computational fluid dynamic calculations. Then, a two-link mechanism was used to stand in for the diverse and complicated hind legs found in different frog species, in order to simplify the input work calculation. Joint torques were derived based on the virtual work principle to compute the efficiency of foot propulsion. Finally, two feet and swimming patterns were combined to compute propulsive efficiency. The aquatic frog demonstrated a propulsive efficiency (43.11% between those of drag-based and lift-based propulsions, while the terrestrial frog efficiency (29.58% fell within the range of drag-based propulsion. The results illustrate the main factor of swimming patterns for swimming performance and efficiency.

  20. Study on Vibration of Marine Diesel-Electric Hybrid Propulsion System

    OpenAIRE

    Nengqi Xiao; Ruiping Zhou; Xiang Xu; Xichen Lin

    2016-01-01

    This study analyzes the characteristics of hybrid propulsion shafting and builds mathematical models and vibration equations of shafting using the lumped parameter method. Main focus is on the asymmetric double diesel propulsion shafting operation process and the impact of the phase angle and motor excitation on torsional vibration of shafting. Model result is validated by testing results conducted on double diesel propulsion shafting bench. Mathematical model and model-building methods of sh...

  1. Electric Propulsion Research Building (EPRB)

    Data.gov (United States)

    Federal Laboratory Consortium — The Electric Propulsion Research Building (EPRB) capability centers on its suite of vacuum chambers, which are configured to meet the unique requirements related to...

  2. Development of software to improve AC power quality on large spacecraft

    Science.gov (United States)

    Kraft, L. Alan

    1991-01-01

    To insure the reliability of a 20 kHz, alternating current (AC) power system on spacecraft, it is essential to analyze its behavior under many adverse operating conditions. Some of these conditions include overloads, short circuits, switching surges, and harmonic distortions. Harmonic distortions can become a serious problem. It can cause malfunctions in equipment that the power system is supplying, and, during distortions such as voltage resonance, it can cause equipment and insulation failures due to the extreme peak voltages. To address the harmonic distortion issue, work was begun under the 1990 NASA-ASEE Summer Faculty Fellowship Program. Software, originally developed by EPRI, called HARMFLO, a power flow program capable of analyzing harmonic conditions on three phase, balanced, 60 Hz AC power systems, was modified to analyze single phase, 20 kHz, AC power systems. Since almost all of the equipment used on spacecraft power systems is electrically different from equipment used on terrestrial power systems, it was also necessary to develop mathematical models for the equipment to be used on the spacecraft. The modelling was also started under the same fellowship work period. Details of the modifications and models completed during the 1990 NASA-ASEE Summer Faculty Fellowship Program can be found in a project report. As a continuation of the work to develop a complete package necessary for the full analysis of spacecraft AC power system behavior, deployment work has continued through NASA Grant NAG3-1254. This report details the work covered by the above mentioned grant.

  3. Guide to Flow Measurement for Electric Propulsion Systems

    Science.gov (United States)

    Frieman, Jason D.; Walker, Mitchell L. R.; Snyder, Steve

    2013-01-01

    In electric propulsion (EP) systems, accurate measurement of the propellant mass flow rate of gas or liquid to the thruster and external cathode is a key input in the calculation of thruster efficiency and specific impulse. Although such measurements are often achieved with commercial mass flow controllers and meters integrated into propellant feed systems, the variability in potential propellant options and flow requirements amongst the spectrum of EP power regimes and devices complicates meter selection, integration, and operation. At the direction of the Committee on Standards for Electric Propulsion Testing, a guide was jointly developed by members of the electric propulsion community to establish a unified document that contains the working principles, methods of implementation and analysis, and calibration techniques and recommendations on the use of mass flow meters in laboratory and spacecraft electric propulsion systems. The guide is applicable to EP devices of all types and power levels ranging from microthrusters to high-power ion engines and Hall effect thrusters. The establishment of a community standard on mass flow metering will help ensure the selection of the proper meter for each application. It will also improve the quality of system performance estimates by providing comprehensive information on the physical phenomena and systematic errors that must be accounted for during the analysis of flow measurement data. This paper will outline the standard methods and recommended practices described in the guide titled "Flow Measurement for Electric Propulsion Systems."

  4. Propulsion Physics Under the Changing Density Field Model

    Science.gov (United States)

    Robertson, Glen A.

    2011-01-01

    To grow as a space faring race, future spaceflight systems will requires new propulsion physics. Specifically a propulsion physics model that does not require mass ejection without limiting the high thrust necessary to accelerate within or beyond our solar system and return within a normal work period or lifetime. In 2004 Khoury and Weltman produced a density dependent cosmology theory they called Chameleon Cosmology, as at its nature, it is hidden within known physics. This theory represents a scalar field within and about an object, even in the vacuum. Whereby, these scalar fields can be viewed as vacuum energy fields with definable densities that permeate all matter; having implications to dark matter/energy with universe acceleration properties; implying a new force mechanism for propulsion physics. Using Chameleon Cosmology, the author has developed a new propulsion physics model, called the Changing Density Field (CDF) Model. This model relates to density changes in these density fields, where the density field density changes are related to the acceleration of matter within an object. These density changes in turn change how an object couples to the surrounding density fields. Whereby, thrust is achieved by causing a differential in the coupling to these density fields about an object. Since the model indicates that the density of the density field in an object can be changed by internal mass acceleration, even without exhausting mass, the CDF model implies a new propellant-less propulsion physics model

  5. AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

    Science.gov (United States)

    El-Nahass, M. M.; Ali, H. A. M.

    2012-06-01

    AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

  6. Hydrodynamics of Peristaltic Propulsion

    Science.gov (United States)

    Athanassiadis, Athanasios; Hart, Douglas

    2014-11-01

    A curious class of animals called salps live in marine environments and self-propel by ejecting vortex rings much like jellyfish and squid. However, unlike other jetting creatures that siphon and eject water from one side of their body, salps produce vortex rings by pumping water through siphons on opposite ends of their hollow cylindrical bodies. In the simplest cases, it seems like some species of salp can successfully move by contracting just two siphons connected by an elastic body. When thought of as a chain of timed contractions, salp propulsion is reminiscent of peristaltic pumping applied to marine locomotion. Inspired by salps, we investigate the hydrodynamics of peristaltic propulsion, focusing on the scaling relationships that determine flow rate, thrust production, and energy usage in a model system. We discuss possible actuation methods for a model peristaltic vehicle, considering both the material and geometrical requirements for such a system.

  7. Propulsion Systems Laboratory, Bldg. 125

    Data.gov (United States)

    Federal Laboratory Consortium — The Propulsion Systems Laboratory (PSL) is NASAs only ground test facility capable of providing true altitude and flight speed simulation for testing full scale gas...

  8. Green Liquid Monopropellant Thruster for In-space Propulsion, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Physical Sciences Inc. and AMPAC In-space Propulsion propose to develop a unique chemical propulsion system for the next generation NASA science spacecraft and...

  9. On use of hybrid rocket propulsion for suborbital vehicles

    Science.gov (United States)

    Okninski, Adam

    2018-04-01

    While the majority of operating suborbital rockets use solid rocket propulsion, recent advancements in the field of hybrid rocket motors lead to renewed interest in their use in sounding rockets. This paper presents results of optimisation of sounding rockets using hybrid propulsion. An overview of vehicles under development during the last decade, as well as heritage systems is provided. Different propellant combinations are discussed and their performance assessment is given. While Liquid Oxygen, Nitrous Oxide and Nitric Acid have been widely tested with various solid fuels in flight, Hydrogen Peroxide remains an oxidiser with very limited sounding rocket applications. The benefits of hybrid propulsion for sounding rockets are given. In case of hybrid rocket motors the thrust curve can be optimised for each flight, using a flow regulator, depending on the payload and mission. Results of studies concerning the optimal burn duration and nozzle selection are given. Specific considerations are provided for the Polish ILR-33 "Amber" sounding rocket. Low regression rates, which up to date were viewed as a drawback of hybrid propulsion may be used to the benefit of maximising rocket performance if small solid rocket boosters are used during the initial flight period. While increased interest in hybrid propulsion is present, no up-to-date reference concerning use of hybrid rocket propulsion for sounding rockets is available. The ultimate goal of the paper is to provide insight into the sensitivity of different design parameters on performance of hybrid sounding rockets and delve into the potential and challenges of using hybrid rocket technology for expendable suborbital applications.

  10. Integrated propulsion for near-Earth space missions. Volume 2: Technical

    Science.gov (United States)

    Dailey, C. L.; Meissinger, H. F.; Lovberg, R. H.; Zafran, S.

    1981-01-01

    The calculation approach is described for parametric analysis of candidate electric propulsion systems employed in LEO to GEO missions. Occultation relations, atmospheric density effects, and natural radiation effects are presented. A solar cell cover glass tradeoff is performed to determine optimum glass thickness. Solar array and spacecraft pointing strategies are described for low altitude flight and for optimum array illumination during ascent. Mass ratio tradeoffs versus transfer time provide direction for thruster technology improvements. Integrated electric propulsion analysis is performed for orbit boosting, inclination change, attitude control, stationkeeping, repositioning, and disposal functions as well as power sharing with payload on orbit. Comparison with chemical auxiliary propulsion is made to quantify the advantages of integrated propulsion in terms of weight savings and concomittant launch cost savings.

  11. The Ion Propulsion System for the Asteroid Redirect Robotic Mission

    Science.gov (United States)

    Herman, Daniel A.; Santiago, Walter; Kamhawi, Hani; Polk, James E.; Snyder, John Steven; Hofer, Richard; Sekerak, Michael

    2016-01-01

    The Asteroid Redirect Robotic Mission is a Solar Electric Propulsion Technology Demonstration Mission (ARRM) whose main objectives are to develop and demonstrate a high-power solar electric propulsion capability for the Agency and return an asteroidal mass for rendezvous and characterization in a companion human-crewed mission. This high-power solar electric propulsion capability, or an extensible derivative of it, has been identified as a critical part of NASA's future beyond-low-Earth-orbit, human-crewed exploration plans. This presentation presents the conceptual design of the ARRM ion propulsion system, the status of the NASA in-house thruster and power processing development activities, the status of the planned technology maturation for the mission through flight hardware delivery, and the status of the mission formulation and spacecraft acquisition.

  12. Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

    Science.gov (United States)

    Han, Xiaomin; Li, Guojing; Zhang, Shuqun

    2017-01-01

    Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

  13. Force application during handcycling and handrim wheelchair propulsion: an initial comparison.

    Science.gov (United States)

    Arnet, Ursina; van Drongelen, Stefan; Veeger, D H; van der Woude L, H V

    2013-12-01

    The aim of the study was to evaluate the external applied forces, the effectiveness of force application and the net shoulder moments of handcycling in comparison with handrim wheelchair propulsion at different inclines. Ten able-bodied men performed standardized exercises on a treadmill at inclines of 1%, 2.5% and 4% with an instrumented handbike and wheelchair that measured three-dimensional propulsion forces. The results showed that during handcycling significantly lower mean forces were applied at inclines of 2.5% (P propulsion. The force effectiveness did not differ between the devices (P = .757); however, the effectiveness did increase with higher inclines during handcycling whereas it stayed constant over all inclines for wheelchair propulsion. The resulting peak net shoulder moments were lower for handcycling compared with wheelchair propulsion at all inclines (P < .001). These results confirm the assumption that handcycling is physically less straining.

  14. Bibliography of Books and Published Reports on Gas Turbines, Jet Propulsion, and Rocket Power Plants

    Science.gov (United States)

    1951-06-01

    Ink , New York, 1945. W. Ley, Rockets. Viking Press. New York. 1945. LI. S. Zim, Rockets and jets. Harcourt Brace, New York, 1945. Jet propulsion...Hausenblas, Design nomograms for turbine stages. Motortechnische Zeit. 11, 96 (Aug. 1950). S. L. Koutz et al., Effect of beat and power extraction on...Edelman, The pulsating engine-its evolution and future prospects. SAE Quart. Trans. 1, 204 (1947). R. McLarren, Project Squid probes pulsejet. Aviation

  15. A highly versatile autonomous underwater vehicle with biomechanical propulsion

    NARCIS (Netherlands)

    Simons, D.G.; Bergers, M.M.C.; Henrion, S.; Hulzenga, J.I.J.; Jutte, R.W.; Pas, W.M.G.; Van Schravendijk, M.; Vercruyssen, T.G.A.; Wilken, A.P.

    2009-01-01

    An autonomous underwater vehicle with a biomechanical propulsion system is a possible answer to the demand for small, silent sensor platforms in many fields. The design of Galatea, a bio-mimetic AUV, involves four aspects: hydrodynamic shape, the propulsion, the motion control systems and payload.

  16. STG-ET: DLR electric propulsion test facility

    Directory of Open Access Journals (Sweden)

    Andreas Neumann

    2017-04-01

    Full Text Available DLR operates the High Vacuum Plume Test Facility Göttingen – Electric Thrusters (STG-ET. This electric propulsion test facility has now accumulated several years of EP-thruster testing experience. Special features tailored to electric space propulsion testing like a large vacuum chamber mounted on a low vibration foundation, a beam dump target with low sputtering, and a performant pumping system characterize this facility. The vacuum chamber is 12.2m long and has a diameter of 5m. With respect to accurate thruster testing, the design focus is on accurate thrust measurement, plume diagnostics, and plume interaction with spacecraft components. Electric propulsion thrusters have to run for thousands of hours, and with this the facility is prepared for long-term experiments. This paper gives an overview of the facility, and shows some details of the vacuum chamber, pumping system, diagnostics, and experiences with these components.

  17. Artist's concept of Antimatter propulsion system

    Science.gov (United States)

    1999-01-01

    This is an artist's rendition of an antimatter propulsion system. Matter - antimatter arnihilation offers the highest possible physical energy density of any known reaction substance. It is about 10 billion times more powerful than that of chemical engergy such as hydrogen and oxygen combustion. Antimatter would be the perfect rocket fuel, but the problem is that the basic component of antimatter, antiprotons, doesn't exist in nature and has to manufactured. The process of antimatter development is on-going and making some strides, but production of this as a propulsion system is far into the future.

  18. Solar Electric Propulsion Technology Development for Electric Propulsion

    Science.gov (United States)

    Mercer, Carolyn R.; Kerslake, Thomas W.; Scheidegger, Robert J.; Woodworth, Andrew A.; Lauenstein, Jean-Marie

    2015-01-01

    NASA is developing technologies to prepare for human exploration missions to Mars. Solar electric propulsion (SEP) systems are expected to enable a new cost effective means to deliver cargo to the Mars surface. Nearer term missions to Mars moons or near-Earth asteroids can be used to both develop and demonstrate the needed technology for these future Mars missions while demonstrating new capabilities in their own right. This presentation discusses recent technology development accomplishments for high power, high voltage solar arrays and power management that enable a new class of SEP missions.

  19. Numerical simulation of the flow around a steerable propulsion unit

    International Nuclear Information System (INIS)

    Pacuraru, F; Lungu, A; Ungureanu, C; Marcu, O

    2010-01-01

    Azimuth propulsion units have become during the last decade a more and more popular solution for all kinds of vessels. Azimuth thruster system, combining the propulsion and steering units of conventional ships replaces traditional propellers and lengthy drive shafts and rudders ensuring an excellent vessel steering. In many cases the interaction between the propeller and other components of the propulsion system strongly affects the inflow to the propeller and therefore its performance. The correct estimation of this influence is important for propulsion systems which consist of more than one element, such as pods (shaft, gondola and propeller), ducted propellers (duct, struts and propeller) or bow thrusters (ship form, tunnel, gondola and propeller). The paper proposes a numerical investigation based on RANS computation for solving the viscous flow around an azimuth thruster system to provide a detailed insight into the critical flow regions for determining the optimum inclination angle for struts, for studying the hydrodynamic interactions between various components of the system, for predicting the hydrodynamic performance of the propulsion system and to investigate regions with possible flow separations.

  20. Solar System Exploration Augmented by In-Situ Resource Utilization: Mercury and Saturn Propulsion Investigations

    Science.gov (United States)

    Palaszewski, Bryan

    2016-01-01

    Human and robotic missions to Mercury and Saturn are presented and analyzed with a range of propulsion options. Historical studies of space exploration, in-situ resource utilization (ISRU), and industrialization all point to the vastness of natural resources in the solar system. Advanced propulsion benefitted from these resources in many ways. While advanced propulsion systems were proposed in these historical studies, further investigation of nuclear options using high power nuclear thermal and nuclear pulse propulsion as well as advanced chemical propulsion can significantly enhance these scenarios. Updated analyses based on these historical visions will be presented. Nuclear thermal propulsion and ISRU enhanced chemical propulsion landers are assessed for Mercury missions. At Saturn, nuclear pulse propulsion with alternate propellant feed systems and Titan exploration with chemical propulsion options are discussed. In-situ resource utilization was found to be critical in making Mercury missions more amenable for human visits. At Saturn, refueling using local atmospheric mining was found to be difficult to impractical, while refueling the Saturn missions from Uranus was more practical and less complex.

  1. Institute for Computational Mechanics in Propulsion (ICOMP). 10

    Science.gov (United States)

    Keith, Theo G., Jr. (Editor); Balog, Karen (Editor); Povinelli, Louis A. (Editor)

    1996-01-01

    The Institute for Computational Mechanics in Propulsion (ICOMP) is operated by the Ohio Aerospace Institute (OAI) and funded under a cooperative agreement by the NASA Lewis Research Center in Cleveland, Ohio. The purpose of ICOMP is to develop techniques to improve problem-solving capabilities in all aspects of computational mechanics related to propulsion. This report describes the activities at ICOUP during 1995.

  2. Numerical Propulsion System Simulation (NPSS): An Award Winning Propulsion System Simulation Tool

    Science.gov (United States)

    Stauber, Laurel J.; Naiman, Cynthia G.

    2002-01-01

    The Numerical Propulsion System Simulation (NPSS) is a full propulsion system simulation tool used by aerospace engineers to predict and analyze the aerothermodynamic behavior of commercial jet aircraft, military applications, and space transportation. The NPSS framework was developed to support aerospace, but other applications are already leveraging the initial capabilities, such as aviation safety, ground-based power, and alternative energy conversion devices such as fuel cells. By using the framework and developing the necessary components, future applications that NPSS could support include nuclear power, water treatment, biomedicine, chemical processing, and marine propulsion. NPSS will dramatically reduce the time, effort, and expense necessary to design and test jet engines. It accomplishes that by generating sophisticated computer simulations of an aerospace object or system, thus enabling engineers to "test" various design options without having to conduct costly, time-consuming real-life tests. The ultimate goal of NPSS is to create a numerical "test cell" that enables engineers to create complete engine simulations overnight on cost-effective computing platforms. Using NPSS, engine designers will be able to analyze different parts of the engine simultaneously, perform different types of analysis simultaneously (e.g., aerodynamic and structural), and perform analysis in a more efficient and less costly manner. NPSS will cut the development time of a new engine in half, from 10 years to 5 years. And NPSS will have a similar effect on the cost of development: new jet engines will cost about a billion dollars to develop rather than two billion. NPSS is also being applied to the development of space transportation technologies, and it is expected that similar efficiencies and cost savings will result. Advancements of NPSS in fiscal year 2001 included enhancing the NPSS Developer's Kit to easily integrate external components of varying fidelities, providing

  3. Planetary explorer liquid propulsion study

    Science.gov (United States)

    Mckevitt, F. X.; Eggers, R. F.; Bolz, C. W.

    1971-01-01

    An analytical evaluation of several candidate monopropellant hydrazine propulsion system approaches is conducted in order to define the most suitable configuration for the combined velocity and attitude control system for the Planetary Explorer spacecraft. Both orbiter and probe-type missions to the planet Venus are considered. The spacecraft concept is that of a Delta launched spin-stabilized vehicle. Velocity control is obtained through preprogrammed pulse-mode firing of the thrusters in synchronism with the spacecraft spin rate. Configuration selection is found to be strongly influenced by the possible error torques induced by uncertainties in thruster operation and installation. The propulsion systems defined are based on maximum use of existing, qualified components. Ground support equipment requirements are defined and system development testing outlined.

  4. Reactors. Nuclear propulsion ships

    International Nuclear Information System (INIS)

    Fribourg, Ch.

    2001-01-01

    This article has for object the development of nuclear-powered ships and the conception of the nuclear-powered ship. The technology of the naval propulsion P.W.R. type reactor is described in the article B.N.3 141 'Nuclear Boilers ships'. (N.C.)

  5. Road load simulator tests of the Gould phase 1 functional model silicon controlled rectifier ac motor controller for electric vehicles

    Science.gov (United States)

    Gourash, F.

    1984-01-01

    The test results for a functional model ac motor controller for electric vehicles and a three-phase induction motor which were dynamically tested on the Lewis Research Center road load simulator are presented. Results show that the controller has the capability to meet the SAE-J227a D cycle test schedule and to accelerate a 1576-kg (3456-lb) simulated vehicle to a cruise speed of 88.5 km/hr (55 mph). Combined motor controller efficiency is 72 percent and the power inverter efficiency alone is 89 percent for the cruise region of the D cycle. Steady state test results for motoring, regeneration, and thermal data obtained by operating the simulator as a conventional dynamometer are in agreement with the contractor's previously reported data. The regeneration test results indicate that a reduction in energy requirements for urban driving cycles is attainable with regenerative braking. Test results and data in this report serve as a data base for further development of ac motor controllers and propulsion systems for electric vehicles. The controller uses state-of-the-art silicon controlled rectifier (SCR) power semiconductors and microprocessor-based logic and control circuitry. The controller was developed by Gould Laboratories under a Lewis contract for the Department of Energy's Electric and Hybrid Vehicle program.

  6. Road load simulator tests of the Gould phase 1 functional model silicon controlled rectifier ac motor controller for electric vehicles

    Science.gov (United States)

    Gourash, F.

    1984-02-01

    The test results for a functional model ac motor controller for electric vehicles and a three-phase induction motor which were dynamically tested on the Lewis Research Center road load simulator are presented. Results show that the controller has the capability to meet the SAE-J227a D cycle test schedule and to accelerate a 1576-kg (3456-lb) simulated vehicle to a cruise speed of 88.5 km/hr (55 mph). Combined motor controller efficiency is 72 percent and the power inverter efficiency alone is 89 percent for the cruise region of the D cycle. Steady state test results for motoring, regeneration, and thermal data obtained by operating the simulator as a conventional dynamometer are in agreement with the contractor's previously reported data. The regeneration test results indicate that a reduction in energy requirements for urban driving cycles is attainable with regenerative braking. Test results and data in this report serve as a data base for further development of ac motor controllers and propulsion systems for electric vehicles. The controller uses state-of-the-art silicon controlled rectifier (SCR) power semiconductors and microprocessor-based logic and control circuitry. The controller was developed by Gould Laboratories under a Lewis contract for the Department of Energy's Electric and Hybrid Vehicle program.

  7. Propulsion Utilizing Laser-Driven Ponderomotive Fields for Deep-Space Missions

    International Nuclear Information System (INIS)

    Williams, George J.; Gilland, James H.

    2009-01-01

    The generation of large amplitude electric fields in plasmas by high-power lasers has been studied for several years in the context of high-energy particle acceleration. Fields on the order of GeV/m are generated in the plasma wake of the laser by non-linear ponderomotive forces. The laser fields generate longitudinal and translational electron plasma waves with phase velocities close to the speed of light. These fields and velocities offer the potential to revolutionize spacecraft propulsion, leading to extended deep space robotic probes. Based on these initial calculations, plasma acceleration by means of laser-induced ponderomotive forces appears to offer significant potential for spacecraft propulsion. Relatively high-efficiencies appear possible with proper beam conditioning, resulting in an order of magnitude more thrust than alternative concepts for high I SP (>10 5 s) and elimination of the primary life-limiting erosion phenomena associated with conventional electric propulsion systems. Ponderomotive propulsion readily lends itself to beamed power which might overcome some of the constraints of power-limited propulsion concepts. A preliminary assessment of the impact of these propulsion systems for several promising configurations on mission architectures has been conducted. Emphasizing interstellar and interstellar-precursor applications, performance and technical requirements are identified for a number of missions. The use of in-situ plasma and gas for propellant is evaluated as well.

  8. Nuclear electric propulsion: A better, safer, cheaper transportation system for human exploration of Mars

    International Nuclear Information System (INIS)

    Clark, J.S.; George, J.A.; Gefert, L.P.; Doherty, M.P.; Sefcik, R.J.

    1994-03-01

    NASA has completed a preliminary mission and systems study of nuclear electric propulsion (NEP) systems for 'split-sprint' human exploration and related robotic cargo missions to Mars. This paper describes the study, the mission architecture selected, the NEP system and technology development needs, proposed development schedules, and estimated development costs. Since current administration policy makers have delayed funding for key technology development activities that could make Mars exploration missions a reality in the near future, NASA will have time to evaluate various alternate mission options, and it appears prudent to ensure that Mars mission plans focus on astronaut and mission safety, while reducing costs to acceptable levels. The split-sprint nuclear electric propulsion system offers trip times comparable to nuclear thermal propulsion (NTP) systems, while providing mission abort opportunities that are not possible with 'reference' mission architectures. Thus, NEP systems offer short transit times for the astronauts, reducing the exposure of the crew to intergalactic cosmic radiation. The high specific impulse of the NEP system, which leads to very low propellant requirements, results in significantly lower 'initial mass in low earth orbit' (IMLEO). Launch vehicle packaging studies show that the NEP system can be launched, assembled, and deployed, with about one less 240-metric-ton heavy lift launch vehicle (HLLV) per mission opportunity - a very Technology development cost of the nuclear reactor for an NEP system would be shared with the proposed nuclear surface power systems, since nuclear systems will be required to provide substantial electrical power on the surface of Mars. The NEP development project plan proposed includes evolutionary technology development for nuclear electric propulsion systems that expands upon SP-100 (Space Power - 100 kw(e)) technology that has been developed for lunar and Mars surface nuclear power

  9. An Overview of the NASA Aviation Safety Program Propulsion Health Monitoring Element

    Science.gov (United States)

    Simon, Donald L.

    2000-01-01

    The NASA Aviation Safety Program (AvSP) has been initiated with aggressive goals to reduce the civil aviation accident rate, To meet these goals, several technology investment areas have been identified including a sub-element in propulsion health monitoring (PHM). Specific AvSP PHM objectives are to develop and validate propulsion system health monitoring technologies designed to prevent engine malfunctions from occurring in flight, and to mitigate detrimental effects in the event an in-flight malfunction does occur. A review of available propulsion system safety information was conducted to help prioritize PHM areas to focus on under the AvSP. It is noted that when a propulsion malfunction is involved in an aviation accident or incident, it is often a contributing factor rather than the sole cause for the event. Challenging aspects of the development and implementation of PHM technology such as cost, weight, robustness, and reliability are discussed. Specific technology plans are overviewed including vibration diagnostics, model-based controls and diagnostics, advanced instrumentation, and general aviation propulsion system health monitoring technology. Propulsion system health monitoring, in addition to engine design, inspection, maintenance, and pilot training and awareness, is intrinsic to enhancing aviation propulsion system safety.

  10. Nanoscale swimmers: hydrodynamic interactions and propulsion of molecular machines

    Science.gov (United States)

    Sakaue, T.; Kapral, R.; Mikhailov, A. S.

    2010-06-01

    Molecular machines execute nearly regular cyclic conformational changes as a result of ligand binding and product release. This cyclic conformational dynamics is generally non-reciprocal so that under time reversal a different sequence of machine conformations is visited. Since such changes occur in a solvent, coupling to solvent hydrodynamic modes will generally result in self-propulsion of the molecular machine. These effects are investigated for a class of coarse grained models of protein machines consisting of a set of beads interacting through pair-wise additive potentials. Hydrodynamic effects are incorporated through a configuration-dependent mobility tensor, and expressions for the propulsion linear and angular velocities, as well as the stall force, are obtained. In the limit where conformational changes are small so that linear response theory is applicable, it is shown that propulsion is exponentially small; thus, propulsion is nonlinear phenomenon. The results are illustrated by computations on a simple model molecular machine.

  11. Heavy Vehicle Propulsion Materials: Recent Progress and Future Plans

    International Nuclear Information System (INIS)

    D. Ray Johnson; Sidney Diamond

    2001-01-01

    The Heavy Vehicle Propulsion Materials Program provides enabling materials technology for the U.S. DOE Office of Heavy Vehicle Technologies (OHVT). The technical agenda for the program is based on an industry assessment and the technology roadmap for the OHVT. A five-year program plan was published in 2000. Major efforts in the program are materials for diesel engine fuel systems, exhaust aftertreatment, and air handling. Additional efforts include diesel engine valve-train materials, structural components, and thermal management. Advanced materials, including high-temperature metal alloys, intermetallics, cermets, ceramics, amorphous materials, metal- and ceramic-matrix composites, and coatings, are investigated for critical engine applications. Selected technical issues and planned and ongoing projects as well as brief summaries of several technical highlights are given

  12. Preliminary Assessment of Using Gelled and Hybrid Propellant Propulsion for VTOL/SSTO Launch Systems

    Science.gov (United States)

    Palaszewski, Bryan; OLeary, Robert; Pelaccio, Dennis G.

    1998-01-01

    A novel, reusable, Vertical-Takeoff-and-Vertical-Takeoff-and-Landing, Single-Stage-to-Orbit (VTOL/SSTO) launch system concept, named AUGMENT-SSTO, is presented in this paper to help quantify the advantages of employing gelled and hybrid propellant propulsion system options for such applications. The launch vehicle system concept considered uses a highly coupled, main high performance liquid oxygen/liquid hydrogen (LO2/LH2) propulsion system, that is used only for launch, while a gelled or hybrid propellant propulsion system auxiliary propulsion system is used during final orbit insertion, major orbit maneuvering, and landing propulsive burn phases of flight. Using a gelled or hybrid propellant propulsion system for major orbit maneuver burns and landing has many advantages over conventional VTOL/SSTO concepts that use LO2/LH2 propulsion system(s) burns for all phases of flight. The applicability of three gelled propellant systems, O2/H2/Al, O2/RP-1/Al, and NTO/MMH/Al, and a state-of-the-art (SOA) hybrid propulsion system are examined in this study. Additionally, this paper addresses the applicability of a high performance gelled O2/H2 propulsion system to perform the primary, as well as the auxiliary propulsion system functions of the vehicle.

  13. Formation of nuclear splicing factor compatments is independent of lamins A/C

    Czech Academy of Sciences Publication Activity Database

    Večeřová, Jaromíra; Koberna, Karel; Malínský, Jan; Sullivan, T.; Stewart, C. L.; Raška, Ivan; Misteli, T.

    2003-01-01

    Roč. 1, č. 5 (2003), s. S35 ISSN 1214-021X. [Conference on Cell Biology /5./. České Budějovice, 08.09.2003-10.09.2003] R&D Projects: GA ČR GA304/02/0342; GA ČR GA304/03/1121; GA ČR GA304/01/0729 Institutional research plan: CEZ:MSM 111100003 Keywords : lamins A/C Subject RIV: EA - Cell Biology

  14. Engineering Design of the ITER AC/DC Power Supplies

    International Nuclear Information System (INIS)

    Oh, B. H.; Lee, K. W.; Hwang, C. K.; Jin, J. T.; Chang, D. S.; Kim, T. S.

    2009-02-01

    To design high power pulse power supplies, especially in huge power supplies have not designed till now, it is necessary to analyze a system's characteristics and relations with another systems as well as to know high voltage, high current control technologies. Contents of this project are; - Study for the engineering designs changed recently by ITER Organization(IO) and writing specifications for the power supplies to reduce project risk. - Detailed analysis of the AC/DC Converters and writing subtask reports on the Task Agreement. - Study for thyristor numbers, DCR's specifications for Korea-China sharing meetings. - Study for the grounding systems of the ITER power supply system. The results may used as one of reference for practical designs of the high power coil power supplies and also may used in various field such as electroplating, plasma arc furnaces, electric furnaces

  15. RNA interference suppression of mucin 5AC (MUC5AC reduces the adhesive and invasive capacity of human pancreatic cancer cells

    Directory of Open Access Journals (Sweden)

    Yamada Nobuya

    2010-05-01

    Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.

  16. LANDSAT/MMS propulsion module design. Tas4.4: Concept design

    Science.gov (United States)

    Mansfield, J. M.; Etheridge, F. G.; Indrikis, J.

    1976-01-01

    Evaluations are presented of alternative LANDSAT follow-on launch configurations to derive the propulsion requirements for the multimission modular spacecraft (MMS). Two basic types were analyzed including use of conventional launch vehicles and shuttle supported missions. It was concluded that two sizes of modular hydrazine propulsion modules would provide the most cost-effective combination for future missions of this spacecraft. Conceptual designs of the selected propulsion modules were performed to the depth permitting determination of mass properties and estimated costs.

  17. Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.

    Science.gov (United States)

    Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo

    2016-09-01

    Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged

  18. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  19. Solar electric propulsion for Mars transport vehicles

    Science.gov (United States)

    Hickman, J. M.; Curtis, H. B.; Alexander, S. W.; Gilland, J. H.; Hack, K. J.; Lawrence, C.; Swartz, C. K.

    1990-01-01

    Solar electric propulsion (SEP) is an alternative to chemical and nuclear powered propulsion systems for both piloted and unpiloted Mars transport vehicles. Photovoltaic solar cell and array technologies were evaluated as components of SEP power systems. Of the systems considered, the SEP power system composed of multijunction solar cells in an ENTECH domed fresnel concentrator array had the least array mass and area. Trip times to Mars optimized for minimum propellant mass were calculated. Additionally, a preliminary vehicle concept was designed.

  20. Antimatter propulsion, status and prospects

    Science.gov (United States)

    Howe, Steven D.; Hynes, Michael V.

    1986-01-01

    The use of advanced propulsion techniques must be considered if the currently envisioned launch date of the manned Mars mission were delayed until 2020 or later. Within the next thirty years, technological advances may allow such methods as beaming power to the ship, inertial-confinement fusion, or mass-conversion of antiprotons to become feasible. A propulsion system with an ISP of around 5000 s would allow the currently envisioned mission module to fly to Mars in 3 months and would require about one million pounds to be assembled in Earth orbit. Of the possible methods to achieve this, the antiproton mass-conversion reaction offers the highest potential, the greatest problems, and the most fascination. Increasing the production rates of antiprotons is a high priority task at facilities around the world. The application of antiprotons to propulsion requires the coupling of the energy released in the mass-conversion reaction to thrust-producing mechanisms. Recent proposals entail using the antiprotons to produce inertial confinement fusion or to produce negative muons which can catalyze fusion. By increasing the energy released per antiproton, the effective cost, (dollars/joule) can be reduced. These proposals and other areas of research can be investigated now. These short term results will be important in assessing the long range feasibility of an antiproton powered engine.

  1. Transport AC losses in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  2. Effects of Daily Physical Activity Level on Manual Wheelchair Propulsion Technique in Full-Time Manual Wheelchair Users During Steady-State Treadmill Propulsion.

    Science.gov (United States)

    Dysterheft, Jennifer; Rice, Ian; Learmonth, Yvonne; Kinnett-Hopkins, Dominque; Motl, Robert

    2017-07-01

    To examine whether differences in propulsion technique as a function of intraindividual variability occur as a result of shoulder pain and physical activity (PA) level in full-time manual wheelchair users (MWUs). Observational study. Research laboratory. Adults (N=14) with spinal cord injury (mean age: 30.64±11.08) who used a wheelchair for >80% of daily ambulation and were free of any condition that could be worsened by PA. Not applicable. PA level was measured using the Physical Activity Scale for Individuals with Physical Disabilities (PASIPD), and shoulder pain was measured using the Wheelchair User's Shoulder Pain Index (WUSPI) survey. Mean and intraindividual variability propulsion metrics were measured for propulsion analysis. WUSPI scores indicated participants experienced low levels of shoulder pain. The results of the Spearman rank-order correlation revealed that PASIPD scores were significantly related to mean contact angle (r s =-.57) and stroke frequency (r s =.60) as well as to coefficient of variation of peak force (r s =.63), peak torque (r s =.59), contact angle (r s =.73), and stroke frequency (r s =.60). WUSPI scores were significantly correlated with only mean peak force (P=.02). No significant correlations were observed between PASIPD, WUSPI, and body mass index scores. Differences in propulsion technique were observed on the basis of PA levels. Participants with higher PASIPD scores used a more injurious stroke technique when propelling at higher speeds. This may indicate that active individuals who use injurious stroke mechanics may be at higher risk of injury. A strong relation was found between peak propulsion forces and shoulder pain. Rehabilitation professionals should emphasize the use of a protective stroke technique in both inactive and active MWUs during exercise and faster propulsion. Copyright © 2016 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.

  3. CFD for hypersonic propulsion

    Science.gov (United States)

    Povinelli, Louis A.

    1991-01-01

    An overview is given of research activity on the application of computational fluid dynamics (CDF) for hypersonic propulsion systems. After the initial consideration of the highly integrated nature of air-breathing hypersonic engines and airframe, attention is directed toward computations carried out for the components of the engine. A generic inlet configuration is considered in order to demonstrate the highly three dimensional viscous flow behavior occurring within rectangular inlets. Reacting flow computations for simple jet injection as well as for more complex combustion chambers are then discussed in order to show the capability of viscous finite rate chemical reaction computer simulations. Finally, the nozzle flow fields are demonstrated, showing the existence of complex shear layers and shock structure in the exhaust plume. The general issues associated with code validation as well as the specific issue associated with the use of CFD for design are discussed. A prognosis for the success of CFD in the design of future propulsion systems is offered.

  4. CORBASec Used to Secure Distributed Aerospace Propulsion Simulations

    Science.gov (United States)

    Blaser, Tammy M.

    2003-01-01

    The NASA Glenn Research Center and its industry partners are developing a Common Object Request Broker (CORBA) Security (CORBASec) test bed to secure their distributed aerospace propulsion simulations. Glenn has been working with its aerospace propulsion industry partners to deploy the Numerical Propulsion System Simulation (NPSS) object-based technology. NPSS is a program focused on reducing the cost and time in developing aerospace propulsion engines. It was developed by Glenn and is being managed by the NASA Ames Research Center as the lead center reporting directly to NASA Headquarters' Aerospace Technology Enterprise. Glenn is an active domain member of the Object Management Group: an open membership, not-for-profit consortium that produces and manages computer industry specifications (i.e., CORBA) for interoperable enterprise applications. When NPSS is deployed, it will assemble a distributed aerospace propulsion simulation scenario from proprietary analytical CORBA servers and execute them with security afforded by the CORBASec implementation. The NPSS CORBASec test bed was initially developed with the TPBroker Security Service product (Hitachi Computer Products (America), Inc., Waltham, MA) using the Object Request Broker (ORB), which is based on the TPBroker Basic Object Adaptor, and using NPSS software across different firewall products. The test bed has been migrated to the Portable Object Adaptor architecture using the Hitachi Security Service product based on the VisiBroker 4.x ORB (Borland, Scotts Valley, CA) and on the Orbix 2000 ORB (Dublin, Ireland, with U.S. headquarters in Waltham, MA). Glenn, GE Aircraft Engines, and Pratt & Whitney Aircraft are the initial industry partners contributing to the NPSS CORBASec test bed. The test bed uses Security SecurID (RSA Security Inc., Bedford, MA) two-factor token-based authentication together with Hitachi Security Service digital-certificate-based authentication to validate the various NPSS users. The test

  5. Development of Liquid Propulsion Systems Testbed at MSFC

    Science.gov (United States)

    Alexander, Reginald; Nelson, Graham

    2016-01-01

    As NASA, the Department of Defense and the aerospace industry in general strive to develop capabilities to explore near-Earth, Cis-lunar and deep space, the need to create more cost effective techniques of propulsion system design, manufacturing and test is imperative in the current budget constrained environment. The physics of space exploration have not changed, but the manner in which systems are developed and certified needs to change if there is going to be any hope of designing and building the high performance liquid propulsion systems necessary to deliver crew and cargo to the further reaches of space. To further the objective of developing these systems, the Marshall Space Flight Center is currently in the process of formulating a Liquid Propulsion Systems testbed, which will enable rapid integration of components to be tested and assessed for performance in integrated systems. The manifestation of this testbed is a breadboard engine configuration (BBE) with facility support for consumables and/or other components as needed. The goal of the facility is to test NASA developed elements, but can be used to test articles developed by other government agencies, industry or academia. Joint government/private partnership is likely the approach that will be required to enable efficient propulsion system development. MSFC has recently tested its own additively manufactured liquid hydrogen pump, injector, and valves in a BBE hot firing. It is rapidly building toward testing the pump and a new CH4 injector in the BBE configuration to demonstrate a 22,000 lbf, pump-fed LO2/LCH4 engine for the Mars lander or in-space transportation. The value of having this BBE testbed is that as components are developed they may be easily integrated in the testbed and tested. MSFC is striving to enhance its liquid propulsion system development capability. Rapid design, analysis, build and test will be critical to fielding the next high thrust rocket engine. With the maturity of the

  6. Fish biorobotics: kinematics and hydrodynamics of self-propulsion.

    Science.gov (United States)

    Lauder, George V; Anderson, Erik J; Tangorra, James; Madden, Peter G A

    2007-08-01

    As a result of years of research on the comparative biomechanics and physiology of moving through water, biologists and engineers have made considerable progress in understanding how animals moving underwater use their muscles to power movement, in describing body and appendage motion during propulsion, and in conducting experimental and computational analyses of fluid movement and attendant forces. But it is clear that substantial future progress in understanding aquatic propulsion will require new lines of attack. Recent years have seen the advent of one such new avenue that promises to greatly broaden the scope of intellectual opportunity available to researchers: the use of biorobotic models. In this paper we discuss, using aquatic propulsion in fishes as our focal example, how using robotic models can lead to new insights in the study of aquatic propulsion. We use two examples: (1) pectoral fin function, and (2) hydrodynamic interactions between dorsal and caudal fins. Pectoral fin function is characterized by considerable deformation of individual fin rays, as well as spanwise (along the length) and chordwise (across the fin) deformation and area change. The pectoral fin can generate thrust on both the outstroke and instroke. A robotic model of the pectoral fin replicates this result, and demonstrates the effect of altering stroke kinematics on the pattern of force production. The soft dorsal fin of fishes sheds a distinct vortex wake that dramatically alters incoming flow to the tail: the dorsal fin and caudal fin act as dual flapping foils in series. This design can be replicated with a dual-foil flapping robotic device that demonstrates this phenomenon and allows examination of regions of the flapping performance space not available to fishes. We show how the robotic flapping foil device can also be used to better understand the significance of flexible propulsive surfaces for locomotor performance. Finally we emphasize the utility of self

  7. NASA's Pursuit of Low-Noise Propulsion for Low-Boom Commercial Supersonic Vehicles

    Science.gov (United States)

    Bridges, James; Brown, Clifford A.; Seidel, Jonathan A.

    2018-01-01

    Since 2006, when the Fundamental Aeronautics Program was instituted within NASA's Aeronautics Mission Directorate, there has been a Project looking at the technical barriers to commercial supersonic flight. Among the barriers is the noise produced by aircraft during landing and takeoff. Over the years that followed, research was carried out at NASA aeronautics research centers, often in collaboration with academia and industry, addressing the problem. In 2013, a high-level milestone was established, described as a Technical Challenge, with the objective of demonstrating the feasibility of a low-boom supersonic airliner that could meet current airport noise regulations. The Technical Challenge was formally called "Low Noise Propulsion for Low Boom Aircraft", and was completed in late 2016. This paper reports the technical findings from this Technical Challenge, reaching back almost 10 years to review the technologies and tools that were developed along the way. It also discusses the final aircraft configuration and propulsion systems required for a supersonic civilian aircraft to meet noise regulations using the technologies available today. Finally, the paper documents the model-scale tests that validated the acoustic performance of the study aircraft.

  8. Hierarchical Discrete Event Supervisory Control of Aircraft Propulsion Systems

    Science.gov (United States)

    Yasar, Murat; Tolani, Devendra; Ray, Asok; Shah, Neerav; Litt, Jonathan S.

    2004-01-01

    This paper presents a hierarchical application of Discrete Event Supervisory (DES) control theory for intelligent decision and control of a twin-engine aircraft propulsion system. A dual layer hierarchical DES controller is designed to supervise and coordinate the operation of two engines of the propulsion system. The two engines are individually controlled to achieve enhanced performance and reliability, necessary for fulfilling the mission objectives. Each engine is operated under a continuously varying control system that maintains the specified performance and a local discrete-event supervisor for condition monitoring and life extending control. A global upper level DES controller is designed for load balancing and overall health management of the propulsion system.

  9. Multi-disciplinary coupling for integrated design of propulsion systems

    Science.gov (United States)

    Chamis, C. C.; Singhal, S. N.

    1993-01-01

    Effective computational simulation procedures are described for modeling the inherent multi-disciplinary interactions for determining the true response of propulsion systems. Results are presented for propulsion system responses including multi-discipline coupling effects via (1) coupled multi-discipline tailoring, (2) an integrated system of multidisciplinary simulators, (3) coupled material-behavior/fabrication-process tailoring, (4) sensitivities using a probabilistic simulator, and (5) coupled materials/structures/fracture/probabilistic behavior simulator. The results show that the best designs can be determined if the analysis/tailoring methods account for the multi-disciplinary coupling effects. The coupling across disciplines can be used to develop an integrated interactive multi-discipline numerical propulsion system simulator.

  10. Nuclear Thermal Propulsion Development Risks

    Science.gov (United States)

    Kim, Tony

    2015-01-01

    There are clear advantages of development of a Nuclear Thermal Propulsion (NTP) for a crewed mission to Mars. NTP for in-space propulsion enables more ambitious space missions by providing high thrust at high specific impulse ((is) approximately 900 sec) that is 2 times the best theoretical performance possible for chemical rockets. Missions can be optimized for maximum payload capability to take more payload with reduced total mass to orbit; saving cost on reduction of the number of launch vehicles needed. Or missions can be optimized to minimize trip time significantly to reduce the deep space radiation exposure to the crew. NTR propulsion technology is a game changer for space exploration to Mars and beyond. However, 'NUCLEAR' is a word that is feared and vilified by some groups and the hostility towards development of any nuclear systems can meet great opposition by the public as well as from national leaders and people in authority. The public often associates the 'nuclear' word with weapons of mass destruction. The development NTP is at risk due to unwarranted public fears and clear honest communication of nuclear safety will be critical to the success of the development of the NTP technology. Reducing cost to NTP development is critical to its acceptance and funding. In the past, highly inflated cost estimates of a full-scale development nuclear engine due to Category I nuclear security requirements and costly regulatory requirements have put the NTP technology as a low priority. Innovative approaches utilizing low enriched uranium (LEU). Even though NTP can be a small source of radiation to the crew, NTP can facilitate significant reduction of crew exposure to solar and cosmic radiation by reducing trip times by 3-4 months. Current Human Mars Mission (HMM) trajectories with conventional propulsion systems and fuel-efficient transfer orbits exceed astronaut radiation exposure limits. Utilizing extra propellant from one additional SLS launch and available

  11. Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

    Directory of Open Access Journals (Sweden)

    Pijar Riza Anugerah

    2015-10-01

    Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

  12. American Institute of Beamed Energy Propulsion: An Introduction

    International Nuclear Information System (INIS)

    Pakhomov, Andrew V.

    2008-01-01

    To date ISBEP remains the main forum addressing the science and engineering of beamed energy propulsion. Hopefully, it will continue to serve BEP community in this capacity for years to come. The need for organization acting beyond ISBEP was discussed since the second symposium. This paper will address the following question: if our community is ready for having its own organization, a BEP institute, what new it should bring comparing to already existing conference. Such organization, an American Institute on Beamed Energy Propulsion (AIBEP) was recently established. The institute is designed as a nonprofit corporation serving the purpose 'to promote the ideas, concepts and benefits of beamed-energy propulsion to research community, industry and society at large'. The goals of the institute, expected outcomes and benefits of the organization and its membership will be discussed

  13. Development of Cubesat Propulsion Systems

    Data.gov (United States)

    National Aeronautics and Space Administration — The overall objective of this IRAD will be to develop a propulsion system that can be cheaply and reliably used for NASA GSFC cubesat missions. Reliability will be...

  14. Electric Motor Considerations for Non-Cryogenic Hybrid Electric and Turboelectric Propulsion

    Science.gov (United States)

    Duffy, Kirsten P.

    2015-01-01

    NASA Glenn Research Center is investigating hybrid electric and turboelectric propulsion concepts for future aircraft to reduce fuel burn, emissions, and noise. Systems studies show that the weight and efficiency of the electric system components need to be improved for this concept to be feasible. However, advances in motor component materials such as soft magnetic materials, hard magnetic materials, conductors, thermal insulation, and structural materials are expected in the coming years, and should improve motor performance. This study investigates several motor types for a one megawatt application, and projects the motor performance benefits of new component materials that might be available in the coming decades.

  15. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  16. Propulsion Powertrain Real-Time Simulation Using Hardware-in-the-Loop (HIL) for Aircraft Electric Propulsion System

    Science.gov (United States)

    Choi, Benjamin B.; Brown, Gerald V.

    2017-01-01

    It is essential to design a propulsion powertrain real-time simulator using the hardware-in-the-loop (HIL) system that emulates an electrified aircraft propulsion (EAP) systems power grid. This simulator would enable us to facilitate in-depth understanding of the system principles, to validate system model analysis and performance prediction, and to demonstrate the proof-of-concept of the EAP electrical system. This paper describes how subscale electrical machines with their controllers can mimic the power components in an EAP powertrain. In particular, three powertrain emulations are presented to mimic 1) a gas turbo-=shaft engine driving a generator, consisting of two permanent magnet (PM) motors with brushless motor drives, coupled by a shaft, 2) a motor driving a propulsive fan, and 3) a turbo-shaft engine driven fan (turbofan engine) operation. As a first step towards the demonstration, experimental dynamic characterization of the two motor drive systems, coupled by a mechanical shaft, were performed. The previously developed analytical motor models1 were then replaced with the experimental motor models to perform the real-time demonstration in the predefined flight path profiles. This technique can convert the plain motor system into a unique EAP power grid emulator that enables rapid analysis and real-time simulation performance using hardware-in-the-loop (HIL).

  17. NASA Green Propulsion Technologies Pushing Aviation to New Heights

    Science.gov (United States)

    Free, James M.; Jennings, Francis T.; Adanich, Emery; Del Rosario, Ruben; Felder, James L.

    2014-01-01

    Center Director Free is providing the Keynote at the Disruptive Propulsion Conference, sponsored by Cranfield University, Cranfield, Bedfordshire, England in November. Director Free will be presenting a PowerPoint presentation titled, NASA Green Propulsion Technologies Pushing Aviation to New Heights at both the conference and a meeting at the Royal Aeronautical Society.

  18. Optimal propulsion of an undulating slender body with anisotropic friction.

    Science.gov (United States)

    Darbois Texier, Baptiste; Ibarra, Alejandro; Melo, Francisco

    2018-01-24

    This study investigates theoretically and numerically the propulsive sliding of a slender body. The body sustains a transverse and propagative wave along its main axis, and undergoes anisotropic friction caused by its surface texture sliding on the floor. A model accounting for the anisotropy of frictional forces acting on the body is implemented. This describes the propulsive force and gives the optimal undulating parameters for efficient forward propulsion. The optimal wave characteristics are effectively compared to the undulating motion of a slithering snakes, as well as with the motion of sandfish lizards swimming through the sand. Furthermore, numerical simulations have indicated the existence of certain specialized segments along the body that are highly efficient for propulsion, explaining why snakes lift parts of their body while slithering. Finally, the inefficiency of slithering as a form of locomotion to ascend a slope is discussed.

  19. High Voltage Hall Accelerator Propulsion System Development for NASA Science Missions

    Science.gov (United States)

    Kamhawi, Hani; Haag, Thomas; Huang, Wensheng; Shastry, Rohit; Pinero, Luis; Peterson, Todd; Dankanich, John; Mathers, Alex

    2013-01-01

    NASA Science Mission Directorates In-Space Propulsion Technology Program is sponsoring the development of a 3.8 kW-class engineering development unit Hall thruster for implementation in NASA science and exploration missions. NASA Glenn Research Center and Aerojet are developing a high fidelity high voltage Hall accelerator (HiVHAc) thruster that can achieve specific impulse magnitudes greater than 2,700 seconds and xenon throughput capability in excess of 300 kilograms. Performance, plume mappings, thermal characterization, and vibration tests of the HiVHAc engineering development unit thruster have been performed. In addition, the HiVHAc project is also pursuing the development of a power processing unit (PPU) and xenon feed system (XFS) for integration with the HiVHAc engineering development unit thruster. Colorado Power Electronics and NASA Glenn Research Center have tested a brassboard PPU for more than 1,500 hours in a vacuum environment, and a new brassboard and engineering model PPU units are under development. VACCO Industries developed a xenon flow control module which has undergone qualification testing and will be integrated with the HiVHAc thruster extended duration tests. Finally, recent mission studies have shown that the HiVHAc propulsion system has sufficient performance for four Discovery- and two New Frontiers-class NASA design reference missions.

  20. THERMIONIC AC GENERATION

    Science.gov (United States)

    is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

  1. An Evaluation of Electric Motors for Ship Propulsion

    Science.gov (United States)

    2003-06-01

    AIM). Permanent magnet motors are more power dense than a comparatively sized in- duction motor. The permanent magnet motor has been chosen to...study. They include the axial flux, the ra- dial flux, and the transverse flux permanent magnet motors . Each motor has its unique advantages...to be ideal for ship propulsion, work is ongoing to develop the PMSM for ship propulsion. Permanent magnet motors are expected to have significant

  2. FY2010 Annual Progress Report for Propulsion Materials

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Patrick B. [Office of Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States); Schutte, Carol L. [Office of Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States); Gibbs, Jerry L. [Office of Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States)

    2011-01-01

    The Propulsion Materials Technology actively supports the energy security and reduction of greenhouse emissions goals of the Vehicle Technologies Program by developing advanced materials that enable development of higher efficiency powertrains for ground transportation. Propulsion Materials works closely with the other disciplines within the VT Program to identify the materials properties essential for the development of cost-effective, highly efficient, and environmentally friendly next-generation heavy and light duty powertrains.

  3. The Iodine Satellite (iSat) Project Development Towards Critical Design Review (CDR)

    Science.gov (United States)

    Dankanich, John W.; Selby, Michael; Polzin, Kurt A.; Kamhawi, Hani; Hickman, Tyler; Byrne, Larry

    2016-01-01

    Despite the prevalence of Small Satellites in recent years, the systems flown to date have very limited propulsion capability. SmallSats are typically secondary payloads and have significant constraints for volume, mass, and power in addition to limitations on the use of hazardous propellants or stored energy (i.e. high pressure vessels). These constraints limit the options for SmallSat maneuverability. NASA's Space Technology Mission Directorate approved the iodine Satellite flight project for a rapid demonstration of iodine Hall thruster technology in a 12U configuration under the Small Spacecraft Technology Program. The project formally began in FY15 as a partnership between NASA MSFC, NASA GRC, and Busek Co, Inc., with the Air Force supporting the propulsion technology maturation. The team is in final preparation of the Critical Design Review prior to initiating the fabrication and integration phase of the project. The iSat project is on schedule for a launch opportunity in November 2017.

  4. An Overview of Brazilian Developments in Beamed Energy Aerospace Propulsion and Vehicle Performance Control

    International Nuclear Information System (INIS)

    Minucci, M. A. S.

    2008-01-01

    Beamed energy propulsion and beamed energy vehicle performance control concepts are equally promising and challenging. In Brazil, the two concepts are being currently investigated at the Prof Henry T Nagamatsu Laboratory of Aerothermodynamics and Hypersonics, of the Institute for Advanced Studies--IEAv, in collaboration with the Rensselaer Polytechnic Institute--RPI, Troy, NY, and the United States Air force Research Laboratory-AFRL. Until recently, only laser energy addition for hypersonic flow control was being investigated at the Laboratory using a 0.3 m nozzle exit diameter hypersonic shock tunnel, T2, and two 7 joule CO 2 TEA lasers. Flow visualization, model pressure and heat flux measurements of the laser energy addition perturbed flow around a model were produced as a result of this joint IEAv-RPI investigation. Presently, with the participation of AFRL and the newly commissioned 0.6 m. nozzle exit diameter hypersonic shock tunnel, T3, a more ambitious project is underway. Two 400 Joule Lumonics 620 CO 2 TEA lasers will deliver a 20 cm X 25 cm propulsive laser beam to a complete laser propelled air breather/rocket hypersonic engine, located inside T3 test section. Schlieren photographs of the flow inside de engine as well as surface and heat flux measurements will be performed for free stream Mach numbers ranging from 6 to 25. The present paper discusses past, present and future Brazilian activities on beamed energy propulsion and related technologies

  5. Applying design principles to fusion reactor configurations for propulsion in space

    International Nuclear Information System (INIS)

    Carpenter, S.A.; Deveny, M.E.; Schulze, N.R.

    1993-01-01

    The application of fusion power to space propulsion requires rethinking the engineering-design solution to controlled-fusion energy. Whereas the unit cost of electricity (COE) drives the engineering-design solution for utility-based fusion reactor configurations; initial mass to low earth orbit (IMLEO), specific jet power (kW(thrust)/kg(engine)), and reusability drive the engineering-design solution for successful application of fusion power to space propulsion. Three design principles (DP's) were applied to adapt and optimize three candidate-terrestrial-fusion-reactor configurations for propulsion in space. The three design principles are: provide maximum direct access to space for waste radiation, operate components as passive radiators to minimize cooling-system mass, and optimize the plasma fuel, fuel mix, and temperature for best specific jet power. The three candidate terrestrial fusion reactor configurations are: the thermal barrier tandem mirror (TBTM), field reversed mirror (FRM), and levitated dipole field (LDF). The resulting three candidate space fusion propulsion systems have their IMLEO minimized and their specific jet power and reusability maximized. A preliminary rating of these configurations was performed, and it was concluded that the leading engineering-design solution to space fusion propulsion is a modified TBTM that we call the Mirror Fusion Propulsion System (MFPS)

  6. 21 CFR 880.6320 - AC-powered medical examination light.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

  7. Power Processing Unit For Micro Satellite Electric Propulsion System

    Directory of Open Access Journals (Sweden)

    Savvas Spiridon

    2017-01-01

    Full Text Available The Micro Satellite Electric Propulsion System (MEPS program has been originated by the increasing need to provide a low-cost and low-power Electric Propulsion System (EPS for small satellites ( 92%, small size and weight and high reliability. Its functional modules and preliminary results obtained at breadboard level are also presented.

  8. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Gould, O.L.

    1996-01-01

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  9. Cryogenic propulsion for lunar and Mars missions

    Science.gov (United States)

    Redd, Larry

    1988-01-01

    Future missions to the moon and Mars have been investigated with regard to propulsion system selection. The results of this analysis show that near state-of-the-art LO2/LH2 propulsion technology provides a feasible means of performing lunar missions and trans-Mars injections. In other words, existing cryogenic space engines with certain modifications and product improvements would be suitable for these missions. In addition, present day cryogenic system tankage and structural weights appear to scale reasonably when sizing for large payload and high energy missions such as sending men to Mars.

  10. Mars mission performance enhancement with hybrid nuclear propulsion

    Energy Technology Data Exchange (ETDEWEB)

    Dagle, J. E. [Pacific Northwest Lab., Richland, WA (United States); Noffsinger, K. E. [Pacific Northwest Lab., Richland, WA (United States); Segna, D. R. [USDOE Richland Operations Office, WA (United States)

    1992-01-01

    Nuclear electric propulsion (NEP), compared with chemical and nuclear thermal propulsion (NTP), can effectively deliver the same mass to Mars using much less propellant, consequently requiring less mass delivered to Earth orbit. The lower thrust of NEP requires a spiral trajectory near planetary bodies, which significantly increases the travel time. Although the total travel time is long, the portion of the flight time spent during interplanetary transfer is shorter, because the vehicle is thrusting for much longer periods of time. This has led to the supposition that NEP, although very attractive for cargo missions, is not suitable for piloted missions to Mars. However, with the application of a hybrid application of a hybrid approach to propulsion, the benefits of NEP can be utilized while drastically reducing the overall travel time required. Development of a dual-mode system, which utilizes high-thrust NTP to propel the spacecraft from the planetary gravitational influence and low-thrust NEP to accelerate in interplanetary space, eliminates the spiral trajectory and results in a much faster transit time than could be obtained by either NEP or NTP alone. This results in a mission profile with a lower initial mass in low Earth orbit. In addition, the propulsion system would have the capability to provide electrical power for mission applications.

  11. A hierarchy for modeling high speed propulsion systems

    Science.gov (United States)

    Hartley, Tom T.; Deabreu, Alex

    1991-01-01

    General research efforts on reduced order propulsion models for control systems design are overviewed. Methods for modeling high speed propulsion systems are discussed including internal flow propulsion systems that do not contain rotating machinery such as inlets, ramjets, and scramjets. The discussion is separated into four sections: (1) computational fluid dynamics model for the entire nonlinear system or high order nonlinear models; (2) high order linearized model derived from fundamental physics; (3) low order linear models obtained from other high order models; and (4) low order nonlinear models. Included are special considerations on any relevant control system designs. The methods discussed are for the quasi-one dimensional Euler equations of gasdynamic flow. The essential nonlinear features represented are large amplitude nonlinear waves, moving normal shocks, hammershocks, subsonic combustion via heat addition, temperature dependent gases, detonation, and thermal choking.

  12. Hybrid Propulsion Systems for Remotely Piloted Aircraft Systems

    Directory of Open Access Journals (Sweden)

    Mithun Abdul Sathar Eqbal

    2018-03-01

    Full Text Available The development of more efficient propulsion systems for aerospace vehicles is essential to achieve key objectives. These objectives are to increase efficiency while reducing the amount of carbon-based emissions. Hybrid electric propulsion (HEP is an ideal means to maintain the energy density of hydrocarbon-based fuels and utilize energy-efficient electric machines. A system that integrates different propulsion systems into a single system, with one being electric, is termed an HEP system. HEP systems have been studied previously and introduced into Land, Water, and Aerial Vehicles. This work presents research into the use of HEP systems in Remotely Piloted Aircraft Systems (RPAS. The systems discussed in this paper are Internal Combustion Engine (ICE–Electric Hybrid systems, ICE–Photovoltaic (PV Hybrid systems, and Fuel-Cell Hybrid systems. The improved performance characteristics in terms of fuel consumption and endurance are discussed.

  13. Intelligent Propulsion System Foundation Technology: Summary of Research

    Science.gov (United States)

    2008-01-01

    The purpose of this cooperative agreement was to develop a foundation of intelligent propulsion technologies for NASA and industry that will have an impact on safety, noise, emissions, and cost. These intelligent engine technologies included sensors, electronics, communications, control logic, actuators, smart materials and structures, and system studies. Furthermore, this cooperative agreement helped prepare future graduates to develop the revolutionary intelligent propulsion technologies that will be needed to ensure pre-eminence of the U.S. aerospace industry. This Propulsion 21 - Phase 11 program consisted of four primary research areas and associated work elements at Ohio universities: 1.0 Turbine Engine Prognostics, 2.0 Active Controls for Emissions and Noise Reduction, 3.0 Active Structural Controls and Performance, and 4.0 System Studies and Integration. Phase l, which was conducted during the period August 1, 2003, through September 30, 2004, has been reported separately.

  14. Comparison of shoulder load during power-assisted and purely hand-rim wheelchair propulsion.

    Science.gov (United States)

    Kloosterman, Marieke G M; Eising, Hilde; Schaake, Leendert; Buurke, Jaap H; Rietman, Johan S

    2012-06-01

    Repetitive forces and moments are among the work requirements of hand-rim wheelchair propulsion that are related to shoulder injuries. No previous research has been published about the influence of power-assisted wheelchair propulsion on these work requirements. The purpose of our study was therefore to determine the influence of power-assisted propulsion on shoulder biomechanics and muscle activation patterns. We also explored the theoretical framework for the effectiveness of power-assisted propulsion in preventing shoulder injuries by decreasing the work requirements of hand-rim wheelchair propulsion. Nine non-wheelchair users propelled a hand-rim wheelchair on a treadmill at 0.9 m/s. Shoulder biomechanics, and muscle activation patterns, were compared between propulsion with and without power-assist. Propulsion frequency did not differ significantly between the two conditions (Wilcoxon Signed Rank test/significance level/effect size:4/.314/-.34). During power-assisted propulsion we found significantly decreased maximum shoulder flexion and internal rotation angles (1/.015/-.81 and 0/.008/-.89) and decreased peak force on the rim (0/.008/-.89). This resulted in decreased shoulder flexion, adduction and internal rotation moments (2/.021/-.77; 0/.008/-.89 and 1/.011/-.85) and decreased forces at the shoulder in the posterior, superior and lateral directions (2/.021/-.77; 2/.008/-.89 and 2/.024/-.75). Muscle activation in the pectoralis major, posterior deltoid and triceps brachii was also decreased (2/.038/-.69; 1/.015/-.81 and 1/.021/-.77). Power-assist influenced the work requirements of hand-rim wheelchair propulsion by healthy subjects. It was primarily the kinetics at rim and shoulder which were influenced by power-assisted propulsion. Additional research with actual hand-rim wheelchair users is required before extrapolation to routine clinical practice. Copyright © 2011 Elsevier Ltd. All rights reserved.

  15. The Study about Application of Transportation System of the Superconductive Electromagnetism Propulsion in the Harbor

    OpenAIRE

    涌井, 和也; 荻原, 宏康

    1999-01-01

    Electromagnetic propulsion is promising technique for a linear motor car, a ship and a space ship, in future. W. A Rice developed an electromagnetic pump for the liquid metal transfer. There are two electromagnetic propulsions : a superconductive electricity propulsion and a superconductive electromagnetic propulsion. A superconductive electricity propulsion ship uses a screw driven by a superconducting motor. This technique has merits of excellent navigation-ability, and the free degree of t...

  16. Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

    Directory of Open Access Journals (Sweden)

    Amir V. Tavakoli

    2017-09-01

    Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

  17. Integrated Flight and Propulsion Controls for Advanced Aircraft Configurations

    Science.gov (United States)

    Merrill, Walter; Garg, Sanjay

    1995-01-01

    The research vision of the NASA Lewis Research Center in the area of integrated flight and propulsion controls technologies is described. In particular the Integrated Method for Propulsion and Airframe Controls developed at the Lewis Research Center is described including its application to an advanced aircraft configuration. Additionally, future research directions in integrated controls are described.

  18. Mars Exploration Rovers Propulsive Maneuver Design

    Science.gov (United States)

    Potts, Christopher L.; Raofi, Behzad; Kangas, Julie A.

    2004-01-01

    The Mars Exploration Rovers Spirit and Opportunity successfully landed respectively at Gusev Crater and Meridiani Planum in January 2004. The rovers are essentially robotic geologists, sent on a mission to search for evidence in the rocks and soil pertaining to the historical presence of water and the ability to possibly sustain life. In order to conduct NASA's 'follow the water' strategy on opposite sides of the planet Mars, an interplanetary journey of over 300 million miles culminated with historic navigation precision. Rigorous trajectory targeting and control was necessary to achieve the atmospheric entry requirements for the selected landing sites. The propulsive maneuver design challenge was to meet or exceed these requirements while preserving the necessary design margin to accommodate additional project concerns. Landing site flexibility was maintained for both missions after launch, and even after the first trajectory correction maneuver for Spirit. The final targeting strategy was modified to improve delivery performance and reduce risk after revealing constraining trajectory control characteristics. Flight results are examined and summarized for the six trajectory correction maneuvers that were planned for each mission.

  19. Ionic liquid propellants: future fuels for space propulsion.

    Science.gov (United States)

    Zhang, Qinghua; Shreeve, Jean'ne M

    2013-11-11

    Use of green propellants is a trend for future space propulsion. Hypergolic ionic liquid propellants, which are environmentally-benign while exhibiting energetic performances comparable to hydrazine, have shown great potential to meet the requirements of developing nontoxic high-performance propellant formulations for space propulsion applications. This Concept article presents a review of recent advances in the field of ionic liquid propellants. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Evaluation of the use of on-board spacecraft energy storage for electric propulsion missions

    Science.gov (United States)

    Poeschel, R. L.; Palmer, F. M.

    1983-01-01

    On-board spacecraft energy storage represents an under utilized resource for some types of missions that also benefit from using relatively high specific impulse capability of electric propulsion. This resource can provide an appreciable fraction of the power required for operating the electric propulsion subsystem in some missions. The most probable mission requirement for utilization of this energy is that of geostationary satellites which have secondary batteries for operating at high power levels during eclipse. The study summarized in this report selected four examples of missions that could benefit from use of electric propulsion and on-board energy storage. Engineering analyses were performed to evaluate the mass saved and economic benefit expected when electric propulsion and on-board batteries perform some propulsion maneuvers that would conventionally be provided by chemical propulsion. For a given payload mass in geosynchronous orbit, use of electric propulsion in this manner typically provides a 10% reduction in spacecraft mass.