Radiation polymerisable compositions containing 3-sorboyloxy-2-hydroxypropyl groups

International Nuclear Information System (INIS)

Green, G.E.

1976-01-01

Compounds having at least three 3-sorboyloxy-2-hydroxypropyl groups directly attached to ether oxygen atoms are polymerised by exposure to actinic radiation, preferably in the presence of a sensitizer such as Michler's ketone or benzoin. The compounds may be obtained by the reaction either of sorbic acid with a substance having at least three glycidyl ether groups or of glycidyl sorbate with a substance having at least three phenolic or alcoholic hydroxyl groups: if desired, not all of the glycidyl groups may be consumed, so that, after actinically induced polymerisation, the epoxide-containing polymer may be cross-linked by reaction with a curing agent for epoxide resins. The compounds are useful in making printed circuits or printing plates for offset printing

Pigmented binding material which can be photo-polymerised by UV radiation

Energy Technology Data Exchange (ETDEWEB)

McGinniss, V C

1977-10-20

The invention concerns the improvement of a binding material which can be photo-polymerised by UV radiation, which contains aromatic hydrocarbons and ethylene unsaturated film material. Coatings with a film thickness of about 2 x 5 to 21 x 5 ..mu..m are made from this. In order to harden ethylene unsaturated binding material in the presence of pigments which are made opaque by UV and laser energy and to polymerise it, an additive consisting of a synergistic sensitising mixture is necessary, which consists of three components, all of whose variations are described in detail.

Advances in Phillips Polymerisation Catalysis : In-situ Synthesis of Light Linear Alpha Olefins

OpenAIRE

Cicmil, D.

2016-01-01

Polyethylene (PE) presents a large class of polymers with an exponentially growing consumption worldwide. Although possessing a relatively simple chemical formula of the repeating CHx units, the chain length, the type and length of the branching, and density, offer a wide scope of possible PE grades, each suitable for different types of commercial application. Since the 1950s, several types of ethylene polymerisation catalysts and polymerisation processes have been developed. Linear low densi...

Role of distonic dimer radical cations in the radiation-induced polymerisation of vinyl ethers

International Nuclear Information System (INIS)

Naumov, Sergej; Janovsky, Igor; Knolle, Wolfgang; Mehnert, Reiner

2005-01-01

The experimental low-temperature EPR results and the quantum chemical calculations suggest that dimer radical cations of cyclic and aliphatic vinyl ethers (VE) plays a key role in starting of radiation-induced polymerisation. The main species observed at high 2,3-dihydrofuran (DHF), 2,3-dihydropyran (DHP) and VE concentration is the dimer radical cation. In the case of cyclic VE the dimer radical cation transforms through H-abstraction from neutral molecule into a carbocation and radical, which could start both cationic and free-radical polymerisation. However, in the case of aliphatic VE no further reactive species, which could start polymerisation, were observed. This is caused (in agreement with experiment and quantum chemical calculations) by the very high stability of dimer radical cation and calculated endothermity of H-abstraction reaction by dimer radical cation from monomer

New perspectives on the dynamics of AC and DC plasma arcs exposed to cross-fields

International Nuclear Information System (INIS)

Abdo, Youssef; Rohani, Vandad; Cauneau, François; Fulcheri, Laurent

2017-01-01

Interactions between an arc and external fields are crucially important for the design and the optimization of modern plasma torches. Multiple studies have been conducted to help better understand the behavior of DC and AC current arcs exposed to external and ‘ self-induced ’ magnetic fields, but the theoretical foundations remain very poorly explored. An analytical investigation has therefore been carried out in order to study the general behavior of DC and AC arcs under the effect of random cross-fields. A simple differential equation describing the general behavior of a planar DC or AC arc has been obtained. Several dimensionless numbers that depend primarily on arc and field parameters and the main arc characteristics (temperature, electric field strength) have also been determined. Their magnitude indicates the general tendency pattern of the arc evolution. The analytical results for many case studies have been validated using an MHD numerical model. The main purpose of this investigation was deriving a practical analytical model for the electric arc, rendering possible its stabilization and control, and the enhancement of the plasma torch power. (paper)

New perspectives on the dynamics of AC and DC plasma arcs exposed to cross-fields

Science.gov (United States)

Abdo, Youssef; Rohani, Vandad; Cauneau, François; Fulcheri, Laurent

2017-02-01

Interactions between an arc and external fields are crucially important for the design and the optimization of modern plasma torches. Multiple studies have been conducted to help better understand the behavior of DC and AC current arcs exposed to external and ‘self-induced’ magnetic fields, but the theoretical foundations remain very poorly explored. An analytical investigation has therefore been carried out in order to study the general behavior of DC and AC arcs under the effect of random cross-fields. A simple differential equation describing the general behavior of a planar DC or AC arc has been obtained. Several dimensionless numbers that depend primarily on arc and field parameters and the main arc characteristics (temperature, electric field strength) have also been determined. Their magnitude indicates the general tendency pattern of the arc evolution. The analytical results for many case studies have been validated using an MHD numerical model. The main purpose of this investigation was deriving a practical analytical model for the electric arc, rendering possible its stabilization and control, and the enhancement of the plasma torch power.

Polymerisation of fibrin αC-domains promotes endothelial cell migration and proliferation.

Science.gov (United States)

Yakovlev, S; Mikhailenko, I; Tsurupa, G; Belkin, A M; Medved, L

2014-12-01

Upon conversion of fibrinogen into fibrin, fibrinogen αC-domains containing the RGD recognition motif form ordered αC polymers. Our previous study revealed that polymerisation of these domains promotes integrin-dependent adhesion and spreading of endothelial cells, as well as integrin-mediated activation of the FAK and ERK1/2 signalling pathways. The major goal of this study was to test the impact of αC-domain polymerisation on endothelial cell migration and proliferation during wound healing, and to clarify the mechanism underlying superior activity of αC polymers toward endothelial cells. In an in vitro wound healing assay, confluent endothelial cell monolayers on tissue culture plates coated with the αC monomer or αC polymers were wounded by scratching and wound closure was monitored by time-lapse videomicroscopy. Although the plates were coated with equal amounts of αC species, as confirmed by ELISA, wound closure by the cells occurred much faster on αC polymers, indicating that αC-domain polymerisation promotes cell migration and proliferation. In agreement, endothelial cell proliferation was also more efficient on αC polymers, as revealed by cell proliferation assay. Wound closure on both types of substrates was equally inhibited by the integrin-blocking GRGDSP peptide and a specific antagonist of the ERK1/2 signalling pathway. In contrast, blocking the FAK signaling pathway by a specific antagonist decreased wound closure only on αC polymers. These results indicate that polymerisation of the αC-domains enhances integrin-dependent endothelial cell migration and proliferation mainly through the FAK signalling pathway. Furthermore, clustering of integrin-binding RGD motifs in αC polymers is the major mechanism triggering these events.

NDK Interacts with FtsZ and Converts GDP to GTP to Trigger FtsZ Polymerisation--A Novel Role for NDK.

Science.gov (United States)

Mishra, Saurabh; Jakkala, Kishor; Srinivasan, Ramanujam; Arumugam, Muthu; Ranjeri, Raghavendra; Gupta, Prabuddha; Rajeswari, Haryadi; Ajitkumar, Parthasarathi

2015-01-01

Nucleoside diphosphate kinase (NDK), conserved across bacteria to humans, synthesises NTP from NDP and ATP. The eukaryotic homologue, the NDPK, uses ATP to phosphorylate the tubulin-bound GDP to GTP for tubulin polymerisation. The bacterial cytokinetic protein FtsZ, which is the tubulin homologue, also uses GTP for polymerisation. Therefore, we examined whether NDK can interact with FtsZ to convert FtsZ-bound GDP and/or free GDP to GTP to trigger FtsZ polymerisation. Recombinant and native NDK and FtsZ proteins of Mycobacterium smegmatis and Mycobacterium tuberculosis were used as the experimental samples. FtsZ polymersation was monitored using 90° light scattering and FtsZ polymer pelleting assays. The γ32P-GTP synthesised by NDK from GDP and γ32P-ATP was detected using thin layer chromatography and quantitated using phosphorimager. The FtsZ bound 32P-GTP was quantitated using phosphorimager, after UV-crosslinking, followed by SDS-PAGE. The NDK-FtsZ interaction was determined using Ni2+-NTA-pulldown assay and co-immunoprecipitation of the recombinant and native proteins in vitro and ex vivo, respectively. NDK triggered instantaneous polymerisation of GDP-precharged recombinant FtsZ in the presence of ATP, similar to the polymerisation of recombinant FtsZ (not GDP-precharged) upon the direct addition of GTP. Similarly, NDK triggered polymerisation of recombinant FtsZ (not GDP-precharged) in the presence of free GDP and ATP as well. Mutant NDK, partially deficient in GTP synthesis from ATP and GDP, triggered low level of polymerisation of MsFtsZ, but not of MtFtsZ. As characteristic of NDK's NTP substrate non-specificity, it used CTP, TTP, and UTP also to convert GDP to GTP, to trigger FtsZ polymerisation. The NDK of one mycobacterial species could trigger the polymerisation of the FtsZ of another mycobacterial species. Both the recombinant and the native NDK and FtsZ showed interaction with each other in vitro and ex vivo, alluding to the possibility of direct

NDK Interacts with FtsZ and Converts GDP to GTP to Trigger FtsZ Polymerisation - A Novel Role for NDK

Science.gov (United States)

Mishra, Saurabh; Jakkala, Kishor; Srinivasan, Ramanujam; Arumugam, Muthu; Ranjeri, Raghavendra; Gupta, Prabuddha; Rajeswari, Haryadi; Ajitkumar, Parthasarathi

2015-01-01

Introduction Nucleoside diphosphate kinase (NDK), conserved across bacteria to humans, synthesises NTP from NDP and ATP. The eukaryotic homologue, the NDPK, uses ATP to phosphorylate the tubulin-bound GDP to GTP for tubulin polymerisation. The bacterial cytokinetic protein FtsZ, which is the tubulin homologue, also uses GTP for polymerisation. Therefore, we examined whether NDK can interact with FtsZ to convert FtsZ-bound GDP and/or free GDP to GTP to trigger FtsZ polymerisation. Methods Recombinant and native NDK and FtsZ proteins of Mycobacterium smegmatis and Mycobacterium tuberculosis were used as the experimental samples. FtsZ polymersation was monitored using 90° light scattering and FtsZ polymer pelleting assays. The γ32P-GTP synthesised by NDK from GDP and γ32P-ATP was detected using thin layer chromatography and quantitated using phosphorimager. The FtsZ bound 32P-GTP was quantitated using phosphorimager, after UV-crosslinking, followed by SDS-PAGE. The NDK-FtsZ interaction was determined using Ni2+-NTA-pulldown assay and co-immunoprecipitation of the recombinant and native proteins in vitro and ex vivo, respectively. Results NDK triggered instantaneous polymerisation of GDP-precharged recombinant FtsZ in the presence of ATP, similar to the polymerisation of recombinant FtsZ (not GDP-precharged) upon the direct addition of GTP. Similarly, NDK triggered polymerisation of recombinant FtsZ (not GDP-precharged) in the presence of free GDP and ATP as well. Mutant NDK, partially deficient in GTP synthesis from ATP and GDP, triggered low level of polymerisation of MsFtsZ, but not of MtFtsZ. As characteristic of NDK’s NTP substrate non-specificity, it used CTP, TTP, and UTP also to convert GDP to GTP, to trigger FtsZ polymerisation. The NDK of one mycobacterial species could trigger the polymerisation of the FtsZ of another mycobacterial species. Both the recombinant and the native NDK and FtsZ showed interaction with each other in vitro and ex vivo, alluding

Study of plasma equilibrium during the AC current reversal phase in STOR-M

International Nuclear Information System (INIS)

Xiao, C.

2002-01-01

Alternating current (AC) tokamak operation and equilibrium studies have been performed on the STOR-M tokamak. The recent experiments have achieved consistent smooth current reversal through the implementation of a hybrid digital-analog position controller and by careful density control. In order to study the plasma equilibrium during the current reversal phase with negligible rotational transform, a segmented limiter with four isolated conducting plates has been installed. The plates can be connected outside the vacuum vessel, which allows measurements of currents flowing between limiter plates. When the current reversal is smooth with zero dwell time, the hydrogen line emission level and electron density remain finite, indicating a finite particle confinement. The current from the top to the bottom limiter plate is also finite and its direction is consistent with that of the grad-B drift. The observation suggests that the limiter and other conducting structures surrounding the plasmas plays the role, during the current reversal phase of AC tokamak operation, to short out the charge separation arising from the grad-B drift and to maintain a finite particle confinement. (author)

Photo-initiated polymerisation of 1,8-octanedithiol and styrene

International Nuclear Information System (INIS)

Ang, J.B.; Hill, D.J.T.; Pomery, P.J.; Whittaker, A.K.

1998-01-01

Full text: Photo-initiated polymerisation of the thiol-ene system has been well investigated. Its applications include adhesives, coatings and opthalmic lenses. It is unlike the usual UV curable polymeric systems which are predominantly based on acrylates. Typically, acrylate systems are not strictly stoichiometric reactions. The thiol-ene process is a reactive composition based on the stoichiometric reaction of olefins (enes, acrylates) and thiols (mercaptans), which polymerise on exposure to UV light. A unique feature of the thiol-ene system is that the reaction is not inhibited by dissolved or ambient oxygen within the system, thereby eliminating the termination reaction which occurs in acrylate systems. The mechanism of the thiol-ene reaction is a step growth addition process which propagates by a free radical chain mechanism to yield the anti-Markovnikov product scheme. The majority of thiol-ene systems investigated focus on multifunctional moieties of thiol and olefin to produce highly cross-linked networks. This discussion will focus on kinetic information obtained from a linear system comprised of a disfunctional thiol (1,8-octanedithiol) and styrene initiated by a UV light source

Radiation initiated polymerisation of phenyl methacrylate

International Nuclear Information System (INIS)

Raghunath, S.; Rao, M.H.; Rao, K.N.

1983-01-01

Radiation initiated polymerisation of phenyl methacrylate has been studied at various dose rates and temperature. Predominant chain transfer to the monomer was observed and ksub(tran)/Ksub(p) the chain transfer constant ratio was found to be 4 x 10 -2 .ksub(p)/ksub(tsup(1/2)) value determined by the kinetic data and the molecular weight data were 0.0821 and 0.0198, respectively. IR studies of polymer at low conversion showed the presence of terminal unsaturation which disappeared at saturation conversion, thus showing its participation in the formation of a three dimensional network. (author)

Reuse of spent bleaching earth by polymerisation of residual organics.

Science.gov (United States)

Beshara, Abdelhamid; Cheeseman, Christopher R

2014-10-01

Spent bleaching earth (SBE) is a waste generated by the edible oil industry that currently has limited options for beneficial reuse. In excess of ∼2 million tonnes per year of SBE is generated world-wide with major quantities available in the middle-east where significant volumes of edible oils are produced. Low pressure compaction followed by heat treatment at 150°C causes polymerisation of the residual organic components in SBE and this produces monolithic samples with high unconfined compressive strengths (54MPa). SBE can therefore be used to manufacture novel clay blocks for use in construction that are bonded by polymerised vegetable oil. This represents a new, innovative and resource efficient application for SBE. In this research, commercial SBE has been characterised and the effects of key processing variables (temperature and compaction pressure) on the compressive strength, porosity and density of the SBE clay blocks are reported and the mechanisms responsible for strength development are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

AC plasma electrolytic oxidation of magnesium with zirconia nanoparticles

International Nuclear Information System (INIS)

Arrabal, R.; Matykina, E.; Viejo, F.; Skeldon, P.; Thompson, G.E.; Merino, M.C.

2008-01-01

The incorporation of monoclinic zirconia nanoparticles and their subsequent transformation is examined for coatings formed on magnesium by plasma electrolytic oxidation under AC conditions in silicate electrolyte. The coatings are shown to comprise two main layers, with nanoparticles entering the coating at the coating surface and through short-circuit paths to the region of the interface between the inner and outer coating layers. Under local heating of microdischarges, the zirconia reacts with magnesium species to form Mg 2 Zr 5 O 12 in the outer coating layer. Relatively little zirconium is present in the inner coating layer. In contrast, silicon species are present in both coating layers, with reduced amounts in the inner layer

Transfer functions of laminar premixed flames subjected to forcing by acoustic waves, AC electric fields, and non-thermal plasma discharges

KAUST Repository

Lacoste, Deanna

2016-06-23

The responses of laminar methane-air flames to forcing by acoustic waves, AC electric fields, and nanosecond repetitively pulsed (NRP) glow discharges are reported here. The experimental setup consists of an axisymmetric burner with a nozzle made from a quartz tube. Three different flame geometries have been studied: conical, M-shaped and V-shaped flames. A central stainless steel rod is used as a cathode for the electric field and plasma excitations. The acoustic forcing is obtained with a loudspeaker located at the bottom part of the burner. For forcing by AC electric fields, a metallic grid is placed above the rod and connected to an AC power supply. Plasma forcing is obtained by applying high-voltage pulses of 10-ns duration applied at 10 kHz, between the rod and an annular stainless steel ring, placed at the outlet of the quartz tube. The chemiluminescence of CH is used to determine the heat release rate fluctuations. For forcing by acoustic waves and plasma, the geometry of the flame plays a key role in the response of the combustion, while the flame shape does not affect the response of the combustion to electric field forcing. The flame response to acoustic forcing of about 10% of the incoming flow is similar to those obtained in the literature. The flames are found to be responsive to an AC electric field across the whole range of frequencies studied. A forcing mechanism, based on the generation of ionic wind, is proposed. The gain of the transfer function obtained for plasma forcing is found to be up to 5 times higher than for acoustic forcing. A possible mechanism of plasma forcing is introduced.

Transfer functions of laminar premixed flames subjected to forcing by acoustic waves, AC electric fields, and non-thermal plasma discharges

KAUST Repository

Lacoste, Deanna; Xiong, Yuan; Moeck, Jonas P.; Chung, Suk-Ho; Roberts, William L.; Cha, Min

2016-01-01

The responses of laminar methane-air flames to forcing by acoustic waves, AC electric fields, and nanosecond repetitively pulsed (NRP) glow discharges are reported here. The experimental setup consists of an axisymmetric burner with a nozzle made from a quartz tube. Three different flame geometries have been studied: conical, M-shaped and V-shaped flames. A central stainless steel rod is used as a cathode for the electric field and plasma excitations. The acoustic forcing is obtained with a loudspeaker located at the bottom part of the burner. For forcing by AC electric fields, a metallic grid is placed above the rod and connected to an AC power supply. Plasma forcing is obtained by applying high-voltage pulses of 10-ns duration applied at 10 kHz, between the rod and an annular stainless steel ring, placed at the outlet of the quartz tube. The chemiluminescence of CH is used to determine the heat release rate fluctuations. For forcing by acoustic waves and plasma, the geometry of the flame plays a key role in the response of the combustion, while the flame shape does not affect the response of the combustion to electric field forcing. The flame response to acoustic forcing of about 10% of the incoming flow is similar to those obtained in the literature. The flames are found to be responsive to an AC electric field across the whole range of frequencies studied. A forcing mechanism, based on the generation of ionic wind, is proposed. The gain of the transfer function obtained for plasma forcing is found to be up to 5 times higher than for acoustic forcing. A possible mechanism of plasma forcing is introduced.

Immobilisation of homogeneous olefin polymerisation catalysts. Factors influencing activity and stability

NARCIS (Netherlands)

Severn, J.R.; Chadwick, J.C.

2013-01-01

The activity and stability of homogeneous olefin polymerisation catalysts, when immobilised on a support, are dependent on both chemical and physical effects. Chemical factors affecting catalyst activity include the ease of formation of the active species, which is strongly dependent on the

Depigmented-polymerised allergoids favour regulatory over effector T cells: enhancement by 1α, 25-dihydroxyvitamin D3.

Science.gov (United States)

Urry, Zoe L; Richards, David F; Black, Cheryl; Morales, Maria; Carnés, Jerónimo; Hawrylowicz, Catherine M; Robinson, Douglas S

2014-05-29

Allergen immunotherapy (SIT) is the only treatment for allergic disease capable of modifying disease long term. To reduce the risk of anaphylaxis from SIT, allergen-extracts have been modified by polymerisation with glutaraldehyde to reduce IgE binding. It is suggested that these allergoid extracts also have reduced T cell activity, which could compromise clinical efficacy. Effective SIT is thought to act through regulatory T cells (Tregs) rather than activation of effector T cells. There is no published data on the activity of modified extracts on Tregs. We compared the capacity of modified (depigmented-polymerised) versus unmodified (native) allergen extracts of grass pollen and house dust mite to stimulate proliferation/cytokine production and to modulate Treg/effector T cell frequency in cultures of peripheral blood mononuclear cells (PBMC), from volunteers sensitised to both allergens in vitro. Depigmented-polymerised allergen extracts stimulated less proliferation of PBMC, and reduced effector cell numbers after 7 days in culture than did native extracts. However, the frequency of Foxp3+ Tregs in cultures were similar to those seen with native extract so that ratios of regulatory to effector T cells were significantly increased in cultures stimulated with depigmented-polymerised extracts. Addition of 1α, 25-dihydroxyvitamin D3 further favoured Treg, and reduced effector cytokine production, but not interleukin-10. Depigmented-polymerised allergen extracts appear to favour Treg expansion over activation of effector T cells and this may relate to their demonstrated efficacy and safety in SIT. 1α, 25-dihydroxyvitamin D3 further reduces effector T cell activation by allergen extracts and may be a useful adjuvant for SIT.

Glass transition temperature of hard chairside reline materials after post-polymerisation treatments.

Science.gov (United States)

Urban, Vanessa M; Machado, Ana L; Alves, Marinês O; Maciel, Adeilton P; Vergani, Carlos E; Leite, Edson R

2010-09-01

This study evaluated the effect of post-polymerisation treatments on the glass transition temperature (T(g)) of five hard chairside reline materials (Duraliner II-D, Kooliner-K, New Truliner-N, Ufi Gel hard-U and Tokuso Rebase Fast-T). Specimens (10 x 10 x 1 mm) were made following the manufacturers' instructions and divided into three groups (n = 5). Control group specimens were left untreated. Specimens from the microwave group were irradiated with pre-determined power/time combinations, and specimens from the water-bath group were immersed in hot water at 55 degrees C for 10 min. Glass transition ( degrees C) was performed by differential scanning calorimetry. Data were analysed using anova, followed by post hoc Tukey's test (alpha = 0.05). Both post-polymerisation treatments promoted a significant (p glass transition of material Kooliner, with the effect being more pronounced for microwave irradiation.

Novel additives in radiation polymerisation processes. Significance of molecular weight data in their application to grafting, curing and composite formation

International Nuclear Information System (INIS)

Garnett, J.L.; Mohajerani, S.; Viengkhou, V.; Loo-Teck NG

1995-01-01

The role of additives in accelerating rates of reaction has been investigated in the following related radiation polymerisation processes, i.e simple homopolymerisation, grafting, WPC formation and curing. Additives used include mineral acid, polyfunctional monomers, urea and thermal and photochemical initiators. Molecular weight analysis carried out on the polymers formed in the presence of the additives indicate that both chemical and physical processes are involved in the mechanism of the polymerisation reaction. Chemical processes (free radicals) lead to an enhancement in initial rate of polymerisation whilst the physical parameter involves partitioning of reagents during reaction. Both chemical and physical processes are shown to act in concert to influence both polymer yield and properties

Plasma antennas driven by 5–20 kHz AC power supply

Energy Technology Data Exchange (ETDEWEB)

Zhao, Jiansen, E-mail: 67093058@qq.com; Chen, Yuli; Sun, Yang; Wu, Huafeng; Liu, Yue; Yuan, Qiumeng [Merchant Marine College, Shanghai Maritime University, Shanghai, 201306 (China)

2015-12-15

The experiments described in this work were performed with the aim of introducing a new plasma antenna that was excited by a 5–20 kHz alternating current (AC) power supply, where the antenna was transformed into a U-shape. The results show that the impedance, voltage standing-wave ratio (VSWR), radiation pattern and gain characteristics of the antenna can be controlled rapidly by varying not only the discharge power, but also by varying the discharge frequency in the range from 5 to 20 kHz. When the discharge frequency is adjusted from 10 to 12 kHz, the gain is higher within a relatively broad frequency band and the switch-on time is less than 1 ms when the discharge power is less than 5 W, meaning that the plasma antenna can be turned on and off rapidly.

Chimeric polymers formed from a monomer capable of free radical, oxidative and electrochemical polymerisation.

Science.gov (United States)

Lakshmi, Dhana; Whitcombe, Michael J; Davis, Frank; Chianella, Iva; Piletska, Elena V; Guerreiro, Antonio; Subrahmanyam, Sreenath; Brito, Paula S; Fowler, Steven A; Piletsky, Sergey A

2009-05-21

A new monomer, which incorporates both aniline and methacrylamide functional groups, was shown to possess orthogonal polymerisation behaviour to produce conjugated polyaniline suitable for a wide range of applications.

Gas permeability of thin polyimide foils prepared by in-situ polymerisation

International Nuclear Information System (INIS)

Stolarz, Anna; Varlam, Mihai; Wellum, Roger

2008-01-01

The entrance windows to the gas detector chambers as well as to the target containers used in high-energy and high-intensity accelerators must be as thin as possible to minimise energy losses of the particles used in astrophysics and nuclear physics studies. Because of their good physical properties, polyimide foils are often considered as suitable material for such windows, but commercially available foils, having a thickness greater than 7-8 μm (>1 mg/cm 2 ), would cause energy losses of particles significant for some nuclear reactions studied. Foils prepared by in-situ polymerisation can, however, be as thin as 0.07 μm (∼10 μg/cm 2 ). The permeability of 4 μm foils produced by in-situ polymerisation has been measured at room temperature for He and Ar. For He measurements were performed in the pressure range of 4-70 mbar and for Ar in the range of 20-140 mbar and the permeability was found to be in good agreement with the values published for the thicker commercial foils

A 100-kW three-phase ac plasma furnace for spheroidization of aluminum silicate particles

International Nuclear Information System (INIS)

Gold, D.; Bonet, C.; Chauvin, G.; Geinaert, G.; Mathieu, A.C.; Millet, J.

1981-01-01

A 100-kW three-phase ac plasma furnace with sheathed copper electrodes (sheathing gas: air) is presented. It is used for spheroidizing ''chamotte'' (refractory-fired clay) particles having a smooth, pore-free surface. A simple, one-dimensional numerical model for the heat transfer to the particles explains the maximum processing rate and the detrimental influence of an inhomogeneous particle size distribution

Developed Hybrid Model for Propylene Polymerisation at Optimum Reaction Conditions

Directory of Open Access Journals (Sweden)

Mohammad Jakir Hossain Khan

2016-02-01

Full Text Available A statistical model combined with CFD (computational fluid dynamic method was used to explain the detailed phenomena of the process parameters, and a series of experiments were carried out for propylene polymerisation by varying the feed gas composition, reaction initiation temperature, and system pressure, in a fluidised bed catalytic reactor. The propylene polymerisation rate per pass was considered the response to the analysis. Response surface methodology (RSM, with a full factorial central composite experimental design, was applied to develop the model. In this study, analysis of variance (ANOVA indicated an acceptable value for the coefficient of determination and a suitable estimation of a second-order regression model. For better justification, results were also described through a three-dimensional (3D response surface and a related two-dimensional (2D contour plot. These 3D and 2D response analyses provided significant and easy to understand findings on the effect of all the considered process variables on expected findings. To diagnose the model adequacy, the mathematical relationship between the process variables and the extent of polymer conversion was established through the combination of CFD with statistical tools. All the tests showed that the model is an excellent fit with the experimental validation. The maximum extent of polymer conversion per pass was 5.98% at the set time period and with consistent catalyst and co-catalyst feed rates. The optimum conditions for maximum polymerisation was found at reaction temperature (RT 75 °C, system pressure (SP 25 bar, and 75% monomer concentration (MC. The hydrogen percentage was kept fixed at all times. The coefficient of correlation for reaction temperature, system pressure, and monomer concentration ratio, was found to be 0.932. Thus, the experimental results and model predicted values were a reliable fit at optimum process conditions. Detailed and adaptable CFD results were capable

Modulation of release kinetics by plasma polymerization of ampicillin-loaded β -TCP ceramics

International Nuclear Information System (INIS)

Labay, C; Buxadera-Palomero, J; Avilés, M; Canal, C; Ginebra, M P

2016-01-01

Beta-tricalcium phosphate ( β -TCP) bioceramics are employed in bone repair surgery. Their local implantation in bone defects puts them in the limelight as potential materials for local drug delivery. However, obtaining suitable release patterns fitting the required therapeutics is a challenge. Here, plasma polymerization of ampicillin-loaded β -TCP is studied for the design of a novel antibiotic delivery system. Polyethylene glycol-like (PEG-like) coating of β -TCP by low pressure plasma polymerization was performed using diglyme as precursor, and nanometric PEG-like layers were obtained by simple and double plasma polymerization processes. A significant increase in hydrophobicity, and the presence of plasma polymer was visible on the surface by SEM and quantified by XPS. As a main consequence of the plasma polymerisation, the release kinetics were successfully modified, avoiding burst release, and slowing down the initial rate of release leading to a 4.5 h delay in reaching the same antibiotic release percentage, whilst conservation of the activity of the antibiotic was simultaneously maintained. Thus, plasma polymerisation on the surface of bioceramics may be a good strategy to design controlled drug delivery matrices for local bone therapies. (paper)

Diagnostic studies of ac-driven plasmas in saline solutions: the effect of frequency on the plasma behavior

International Nuclear Information System (INIS)

Chang, Hung-wen; Hsu, Cheng-che

2011-01-01

The effect of frequency on the characteristics of plasmas in saline solution driven by 50-1000 Hz ac power is studied. Two distinct modes, namely bubble and jetting modes, are identified. The bubble mode occurs under low frequencies. In this mode, a millimeter-sized bubble is tightly attached to the electrode tip and oscillates with the applied voltage. With an increase in frequency, it shows the jetting mode, in which bubbles, hundreds of micometers in diameter, are continuously formed and jetted away from the electrode surface. Such a significant change in the bubble behavior influences the power input at a given applied voltage and significantly affects the plasma behavior. In spite of the fact that no significant difference is seen in the optical emission spectra, the broadening of the H β peak shows that the bubble mode has a lower electron density than that of the jetting mode. The temporally resolved optical emission intensities show light emission in the negative half of the power period regardless of the modes. This shows clearly that the driving frequency significantly influences the bubble dynamics, which in turn alters the plasma behavior.

Adaptive control using a hybrid-neural model: application to a polymerisation reactor

Directory of Open Access Journals (Sweden)

Cubillos F.

2001-01-01

Full Text Available This work presents the use of a hybrid-neural model for predictive control of a plug flow polymerisation reactor. The hybrid-neural model (HNM is based on fundamental conservation laws associated with a neural network (NN used to model the uncertain parameters. By simulations, the performance of this approach was studied for a peroxide-initiated styrene tubular reactor. The HNM was synthesised for a CSTR reactor with a radial basis function neural net (RBFN used to estimate the reaction rates recursively. The adaptive HNM was incorporated in two model predictive control strategies, a direct synthesis scheme and an optimum steady state scheme. Tests for servo and regulator control showed excellent behaviour following different setpoint variations, and rejecting perturbations. The good generalisation and training capacities of hybrid models, associated with the simplicity and robustness characteristics of the MPC formulations, make an attractive combination for the control of a polymerisation reactor.

Bonding auto-polymerising acrylic resin to acrylic denture teeth.

LENUS (Irish Health Repository)

Nagle, Susan

2009-09-01

This study investigated the effect of surface treatments on the shear bond strength of an auto-polymerising acrylic resin cured to acrylic denture teeth. The surface treatments included a combination of grit-blasting and\\/or wetting the surface with monomer. Samples were prepared and then stored in water prior to shear testing. The results indicated that the application of monomer to the surface prior to bonding did not influence the bond strength. Grit blasting was found to significantly increase the bond strength.

Advanced analytical methods for the structure elucidation of polystyrene-b-poly(n-butyl acrylate) block copolymers prepared by reverse iodine transfer polymerisation

Energy Technology Data Exchange (ETDEWEB)

Wright, Trevor Gavin; Pfukwa, Helen; Pasch, Harald, E-mail: hpasch@sun.ac.za

2015-09-10

Reverse iodine transfer polymerisation (RITP) is a living radical polymerisation technique that has shown to be feasible in synthesising segmented styrene-acrylate copolymers. Polymers synthesised via RITP are typically only described regarding their bulk properties using nuclear magnetic resonance spectroscopy and size exclusion chromatography. To fully understand the complex composition of the polymerisation products and the RITP reaction mechanism, however, it is necessary to use a combination of advanced analytical methods. In the present RITP procedure, polystyrene was synthesised first and then used as a macroinitiator to synthesise polystyrene-block-poly(n-butyl acrylate) (PS-b-PBA) block copolymers. For the first time, these PS-b-PBA block copolymers were analysed by a combination of SEC, in situ{sup 1}H NMR and HPLC. {sup 1}H NMR was used to determine the copolymer composition and the end group functionality of the samples, while SEC and HPLC were used to confirm the formation of block copolymers. Detailed information on the living character of the RITP process was obtained. - Highlights: • Comprehensive analysis of novel block copolymers. • Polymers were prepared for the first time by reverse iodine transfer polymerisation. • Combination of SEC, NMR, kinetic NMR, HPLC and comprehensive 2D-HPLC was used. • Detailed information about complex molecular composition and polymerisation kinetics was obtained.

Radiation initiated polymerisation of phenyl methacrylate. [Gamma radiation

Energy Technology Data Exchange (ETDEWEB)

Raghunath, S.; Rao, M.H.; Rao, K.N. (Bhabha Atomic Research Centre, Bombay (India). Chemistry Div.)

1983-01-01

Radiation initiated polymerisation of phenyl methacrylate has been studied at various dose rates and temperature. Predominant chain transfer to the monomer was observed and ksub(tran)/Ksub(p) the chain transfer constant ratio was found to be 4 x 10/sup -2/.ksub(p)/ksub(tsup(1/2)) value determined by the kinetic data and the molecular weight data were 0.0821 and 0.0198, respectively. IR studies of polymer at low conversion showed the presence of terminal unsaturation which disappeared at saturation conversion, thus showing its participation in the formation of a three dimensional network.

Comparing Ns-DBD vs Ac-DBD plasma actuation mechanisms on a NACA 0012 airfoil

Science.gov (United States)

Singh, Ashish; Durasiewicz, Claudia; Little, Jesse

2017-11-01

A NACA 0012 airfoil is used to study ns-DBD and ac-DBD plasma actuators at a Reynolds number of 740,000 (U∞=40 m/s). Ns-DBD plasma actuators are hypothesized to work on the principle of joule heating whereas ac-DBD actuators add momentum to the flow. Short duration forcing at a time scale much smaller than the convective time based on model chord is employed to study the control mechanism and flow field response. 2-D PIV carried out over a convective time range of 0-10 is used to study the flow structure. The results show the breakup of shear layer vorticity at the point of actuation followed by reattachment to the suction side of the airfoil and finally stall again. These events are very similar between the two actuators and indicate a similar flow response to different perturbation types. The pulse energies are varied and the response shows little change. The results are compared to other transitory separation control studies using more conventional actuators. The detailed study of these two control mechanisms with the separated flow over an airfoil helps to shed light on the evolution of the flow control process. Additional results on a simplified model problem (low speed mixing layer) are included to provide context. Supported by U.S. Army Research Office (W911NF-14-1-0662).

DC response of dust to low frequency AC signals

Science.gov (United States)

McKinlay, Michael; Konopka, Uwe; Thomas, Edward

2017-10-01

Macroscopic changes in the shape and equilibrium position of clouds of charged microparticles suspended in a plasma have been observed in response to low frequency AC signals. In these experiments, dusty plasmas consisting of 2-micron diameter silica microspheres suspended between an anode and cathode in an argon, DC glow discharge plasma are produced in a grounded, 6-way cross vacuum chamber. An AC signal, produced by a function generator and amplified by a bipolar op-amp, is superimposed onto the potential from the cathode. The frequencies of the applied AC signals, ranging from tens to hundreds of kHz, are comparable to the ion-neutral collision frequency; well below the ion/electron plasma frequencies, but also considerably higher than the dust plasma frequency. This presentation will detail the experimental setup, present documentation and categorization of observations of the dust response, and present an initial model of the response. This work is supported by funding from the US Dept. of Energy, Grant Number DE-SC0016330, and by the National Science Foundation, Grant Number PHY-1613087.

Characterization of Plasma-Polymerized 4-vinyl pyridine on Poly(Ethylene Terephthalate) film for anti-microbial properties

DEFF Research Database (Denmark)

Jiang, Juan; Winther-Jensen, Bjørn; Kjær, Erik Michael

2005-01-01

As an efficient way to create an anti-bacterial function on polymer surfaces, we have used plasma polymerisation to create a poly-4-vinyl-pyridine coating on the surface of a common polymer, PET, a polymerisation process that we have shown also works well on several other polymers. We have found....... The mechanical strength of the bond between the substrate and the surface layer has been tested by several methods, and the antibacterial effect of the surface layer with and without silver nano particles has been estimated by measuring electrical resistance as a function of time. The bacteria investigated were...

Influence of polymerisation on the reversibility of low-energy proton exchange reactions by Para-Aminothiolphenol

NARCIS (Netherlands)

Balakrishnan, Divya; Lamblin, Guillaume; Thomann, Jean Sebastien; Guillot, Jerome; Duday, David; Van Den Berg, Albert; Olthuis, Wouter; Pascual-García, César

2017-01-01

The reversibility of redox processes is an important function for sensing and molecular electronic devices such as pH reporters or molecular switches. Here we report the electrochemical behaviour and redox reversibility of para-aminothiolphenol (PATP) after different polymerisation methods. We used

Influence of various irradiation processes on the mechanical properties and polymerisation kinetics of bulk-fill resin based composites.

Science.gov (United States)

Ilie, Nicoleta; Keßler, Andreas; Durner, Jürgen

2013-08-01

To assess the effect of irradiation time and distance of the light tip on the micro-mechanical properties and polymerisation kinetics of two bulk-fill resin-based composites at simulated clinically relevant filling depth. Micro-mechanical properties (Vickers hardness (HV), depth of cure (DOC) and indentation modulus (E)) and polymerisation kinetics (real-time increase of degree of cure (DC)) of two bulk-fill resin-based composites (Tetric EvoCeram(®) Bulk Fill, Ivoclar Vivadent and x-tra base, Voco) were assessed at varying depth (0.1-6mm in 100μm steps for E and HV and 0.1, 2, 4 and 6mm for DC), irradiation time (10, 20 or 40s, Elipar Freelight2) and distances from the light tip (0 and 7mm). Curing unit's irradiance was monitored in 1mm steps at distances up to 10mm away from the light tip on a laboratory-grade spectrometer. Multivariate analysis (α=0.05), Student's t-test and Pearson correlation analysis were considered. The influence of material on the measured mechanical properties was significant (η(2)=0.080 for E and 0.256 for HV), while the parameters irradiation time, distance from the light tip and depth emphasise a stronger influence on Tetric EvoCeram(®) Bulk Fill. The polymerisation kinetics could be described by an exponential sum function, distinguishing between the gel and the glass phase. The above mentioned parameters strongly influenced the start of polymerisation (gel phase), and were of less importance for the glass phase. Both materials enable at least 4mm thick increments to be cured in one step under clinically relevant curing conditions. The susceptibility to variation in irradiance was material dependent, thus properties measured under clinically simulated curing conditions might vary to a different extent from those measured under ideal curing conditions. Copyright © 2013 Elsevier Ltd. All rights reserved.

Characteristic features of heterophase polymerisation of styrene with simultaneous formation of surfactants at the interface

International Nuclear Information System (INIS)

Prokopov, Nikolai I; Gritskova, Inessa A

2001-01-01

Data on the heterophase polymerisation of styrene under conditions of surfactant formation at the monomer-water interface are generalised. A new, in principle, approach is proposed the essence of which is to obtain a monomer emulsion simultaneously with the synthesis of an emulsifier at the monomer-water interface and with initiation of the polymerisation in the interfacial layer. The preparation of surfactants at the interface allows one to control efficiently the degree of dispersion and the stability of the emulsions formed. By varying the nature of the acid and the metal counter-ion used in the surfactant synthesis at the interface, it is possible to change the interfacial tension, to influence the microemulsification, disintegration of the monomer, and the formation of structure of interfacial adsorption layers. The mechanism of formation of polymer-monomeric particles as well as their diameter and size distribution depend substantially on the solubility of the resulting surfactants in water. The bibliography includes 47 references.

Characteristic features of heterophase polymerisation of styrene with simultaneous formation of surfactants at the interface

Energy Technology Data Exchange (ETDEWEB)

Prokopov, Nikolai I; Gritskova, Inessa A [M.V. Lomonosov Moscow State Academy of Fine Chemical Technology, Moscow (Russian Federation)

2001-09-30

Data on the heterophase polymerisation of styrene under conditions of surfactant formation at the monomer-water interface are generalised. A new, in principle, approach is proposed the essence of which is to obtain a monomer emulsion simultaneously with the synthesis of an emulsifier at the monomer-water interface and with initiation of the polymerisation in the interfacial layer. The preparation of surfactants at the interface allows one to control efficiently the degree of dispersion and the stability of the emulsions formed. By varying the nature of the acid and the metal counter-ion used in the surfactant synthesis at the interface, it is possible to change the interfacial tension, to influence the microemulsification, disintegration of the monomer, and the formation of structure of interfacial adsorption layers. The mechanism of formation of polymer-monomeric particles as well as their diameter and size distribution depend substantially on the solubility of the resulting surfactants in water. The bibliography includes 47 references.

Dc to ac field conversion due to leaky-wave excitation in a plasma slab behind an ionization front

International Nuclear Information System (INIS)

Kostin, V A; Vvedenskii, N V

2015-01-01

We present a way for generating coherent tunable electromagnetic radiation through dc to ac field conversion by an ionization front. The conversion is caused by the excitation of leaky waves behind the transversely limited ionization front propagating in a uniform electrostatic field. This differs significantly from the well-known dc-to-ac-radiation-converter models which consider Doppler-like frequency conversion by a transversely unlimited ionization front propagating in a spatially periodic electric field. We explore the dispersion properties and excitation of these leaky waves radiated through the transverse plasma boundary at the Cherenkov angle to the direction of propagation of a superluminal ionization front as dependent on the parameters of the plasma produced and on the speed of the ionization front. It is shown that not only the center frequency but also the duration and waveform of the generated pulse may significantly depend on the speed of the ionization front. The results indicate the possibility of using such converters based on planar photoconductive antennas to create sources of microwave and terahertz radiation with controllable waveforms that are transformed from video to radio pulse when the angle of incident ionizing radiation is tuned. (paper)

Macroradical initiated polymerisation of acrylic and methacrylic monomers.

Science.gov (United States)

Mijangos, Irene; Guerreiro, António; Piletska, Elena; Whitcombe, Michael J; Karim, Kal; Chianella, Iva; Piletsky, Sergey

2009-10-01

An approach has been developed for the grafting of monomers onto poly(trimethylolpropane trimethacrylate) (polyTRIM) particles using 2,2-diethyl dithiocarbamic acid benzyl ester (DDCABE) as an initiator. A set of polymers was prepared with this technique over different lengths of time and the kinetics of the reaction studied experimentally. It was found that the grafting of initiator to the polymeric support followed a second order reaction, while the subsequent addition of monomers from solution into the polyTRIM macroradicals followed a first order reaction. The living nature of the iniferter modified macroradicals permits easy consecutive grafting of multiple polymeric layers, allowing straightforward functionalisation of particles. However, the effectiveness of the grafted initiator decreased with each cycle of polymerisation. This technique can be used for a wide range of applications in analytical and biochemistry.

Pattern generation using axicon lens beam shaping in two-photon polymerisation

International Nuclear Information System (INIS)

Bhuian, B.; Winfield, R.J.; O'Brien, S.; Crean, G.M.

2007-01-01

The fabrication of three-dimensional microstructures by two-photon polymerisation has been widely reported as a viable route to the development of photonic crystals, rotors, bridges and other complex artefacts requiring nanoscale resolution. Conventionally, single point serial writing is used to write the structures but recently multipoint beam delivery using beam division optics has been reported as a method of introducing parallel processing. In this paper we present an alternative and novel approach using an axicon lens to give profiled beam delivery. This enables complete three-dimensional annular structure fabrication without the use of scanning stages. In addition, the concept of axicon delivery is developed further to investigate three-dimensional structure as a function of axicon geometry. A Ti:sapphire laser, with wavelength 795 nm, 80 MHz repetition rate, 100 fs pulse duration and an average power of 700 mW, was used to initiate two-photon polymerisation. The axicon was used, in combination with a 100x microscope objective, to form representative three-dimensional structures based on the annular cell with varying diameter. The structures were written in a Zr-loaded resin prepared on a glass substrate using dip coating deposition of a Zr/PMMA hybrid prepared by the sol-gel method. Annuli with diameters up to 50 μm were characterised in terms of topography and surface roughness using SEM and Zygo interferometer. The writing technique was also extended to fabrication of stacked structures

Investigation of the two-photon polymerisation of a Zr-based inorganic-organic hybrid material system

International Nuclear Information System (INIS)

Bhuian, B.; Winfield, R.J.; O'Brien, S.; Crean, G.M.

2006-01-01

Two-photon polymerisation of photo-sensitive materials allows the fabrication of three dimensional micro- and nano-structures for photonic, electronic and micro-system applications. However the usable process window and the applicability of this fabrication technique is significantly determined by the properties of the photo-sensitive material employed. In this study investigation of a custom inorganic-organic hybrid system, cross-linked by a two-photon induced process, is described. The material was produced by sol-gel synthesis using a silicon alkoxide species that also possessed methacrylate functionality. Stabilized zirconium alkoxide precursors were added to the precursor solution in order to reduce drying times and impart enhanced mechanical stability to deposited films. This enabled dry films to be used in the polymerisation process. A structural, optical and mechanical analysis of the optimised sol-gel material is presented. A Ti:sapphire laser with 80 MHz repetition rate, 100 fs pulse duration and 795 nm is used. The influence of both material system and laser processing parameters including: laser power, photo-initiator concentration and zirconium loading, on achievable micro-structure and size is presented

Bis(phenolate)amine-supported lanthanide borohydride complexes for styrene and trans-1,4-isoprene (co-)polymerisations

NARCIS (Netherlands)

Bonnet, Fanny; Dyer, Hellen E.; El Kinani, Yassine; Dietz, Carin; Roussel, Pascal; Bria, Marc; Visseaux, Marc; Zinck, Philippe; Mountford, Philip

2015-01-01

New bis(phenolate)amine-supported neodymium borohydride complexes and their previously reported samarium analogues were tested as catalysts for the polymerisation of styrene and isoprene. Reaction of Na2O2NL (L = py, OMe, NMe2) with Nd(BH4)3(THF)3 afforded the borohydride complexes

Highly selective etching of silicon nitride to physical-vapor-deposited a-C mask in dual-frequency capacitively coupled CH2F2/H2 plasmas

International Nuclear Information System (INIS)

Kim, J. S.; Kwon, B. S.; Heo, W.; Jung, C. R.; Park, J. S.; Shon, J. W.; Lee, N.-E.

2010-01-01

A multilevel resist (MLR) structure can be fabricated based on a very thin amorphous carbon (a-C) layer ( congruent with 80 nm) and Si 3 N 4 hard-mask layer ( congruent with 300 nm). The authors investigated the selective etching of the Si 3 N 4 layer using a physical-vapor-deposited (PVD) a-C mask in a dual-frequency superimposed capacitively coupled plasma etcher by varying the process parameters in the CH 2 F 2 /H 2 /Ar plasmas, viz., the etch gas flow ratio, high-frequency source power (P HF ), and low-frequency source power (P LF ). They found that under certain etch conditions they obtain infinitely high etch selectivities of the Si 3 N 4 layers to the PVD a-C on both the blanket and patterned wafers. The etch gas flow ratio played a critical role in determining the process window for infinitely high Si 3 N 4 /PVD a-C etch selectivity because of the change in the degree of polymerization. The etch results of a patterned ArF photoresisit/bottom antireflective coating/SiO x /PVD a-C/Si 3 N 4 MLR structure supported the idea of using a very thin PVD a-C layer as an etch-mask layer for the Si 3 N 4 hard-mask pattern with a pattern width of congruent with 80 nm and high aspect ratio of congruent with 5.

Enhancing tissue integration and angiogenesis of a novel nanocomposite polymer using plasma surface polymerisation, an in vitro and in vivo study.

Science.gov (United States)

Griffin, Michelle F; Palgrave, Robert G; Seifalian, Alexander M; Butler, Peter E; Kalaskar, Deepak M

2016-01-01

Current surgical reconstruction of facial defects including nose or ear involves harvesting patient's own autologous tissue, causing donor site morbidity and is limited by tissue availability. The use of alternative synthetic materials is also limited due to complications related to poor tissue integration and angiogenesis, which lead to extrusion of implants and infection. We intend to meet this clinical challenge by using a novel nanocomposite called polyhedral oligomeric silsesquioxane poly(carbonate-urea)urethane (POSS-PCU), which has already been successfully taken to the clinical bench-side as a replacement for trachea, tear duct and vascular by-pass graft. In this study, we aimed to enhance tissue integration and angiogenesis of POSS-PCU using an established surface treatment technique, plasma surface polymerisation (PSP), functionalising the surface using NH2 and COOH chemical groups. Physical characterisation of scaffolds was achieved by using a number of techniques, including water contact angle, SEM, AFM and XPS to study the effects of PSM modification on the POSS-PCU nanocomposite in detail, which has not been previously documented. Wettability evaluation confirmed that scaffolds become hydrophilic and AFM analysis confirmed that nano topographical alterations resulted as a consequence of PSP treatment. Chemical functionalisation was confirmed using XPS, which suggested the presence of NH2 and COOH functional groups on the scaffolds. The modified scaffolds were then tested both in vitro and in vivo to investigate the potential of PSP modified POSS-PCU scaffolds on tissue integration and angiogenesis. In vitro analysis confirmed that PSM modification resulted in higher cellular growth, proliferation and ECM production as assessed by biochemical assays and immunofluorescence. Subcutaneous implantation of modified POSS-PCU scaffolds was then carried out over 12-weeks, resulting in enhanced tissue integration and angiogenesis (p < 0.05). This study

Design study of an AC power supply system in JT-60SA

International Nuclear Information System (INIS)

Shimada, Katsuhiro; Baulaigue, Olivier; Cara, Philippe; Coletti, Alberto; Coletti, Roberto; Matsukawa, Makoto; Terakado, Tsunehisa; Yamauchi, Kunihito

2011-01-01

In the initial research phase of JT-60SA, which is the International Thermonuclear Experimental Reactor (ITER) satellite Tokamak with superconducting toroidal and poloidal magnetic field coils, the plasma heating operation of 30 MW-60 s or 20 MW-100 s is planned for 5.5 MA single null divertor plasmas. To achieve this operation, AC power source of the medium voltage of 18 kV and ∼7 GJ has to be provided in total to the poloidal field coil power supplies and additional heating devices such as neutral beam injection (NBI) and electron cyclotron radio frequency (ECRF). In this paper, the proposed AC power supply system in JT-60SA was estimated from the view point of available power, and harmonic currents based on the standard plasma operation scenario during the initial research phase. This AC power supply system consists of the reused JT-60 power supply facilities including motor generators with flywheel, AC breakers, harmonic filters, etc., to make it cost effective. In addition, the conceptual design of the upgraded AC power supply system for the ultimate heating power of 41 MW-100 s in the extended research phase is also described.

Partial-depth modulation study of anions and neutrals in low pressure silane plasmas

International Nuclear Information System (INIS)

Cozurteille, C.; Dorier, J.L.; Hollenstein, C.; Sansonnens; Howling, A.A.

1995-10-01

Partial-depth modulation of the rf power in a capacitive discharge is used to investigate the relative importance of negative ions and neutral radicals for particle formation in low power, low pressure silane plasmas. For less than 85% modulation depth, anions are trapped indefinitely in the plasma and particle formation ensues, whereas the polymerised neutral flux magnitudes and dynamics are independent of the modulation depth and the powder formation. These observations suggest that negative ions could be the particle precursors in plasma conditions where powder appears many seconds after plasma ignition. Microwave interferometry and mass spectrometry were combined to infer an anion density of ≅7.10 9 cm -3 which is approximately twice the free electron density in these modulated plasmas. (author) 6 figs., tabs., refs

Synthesis of novel glycopolymer brushes via a combination of RAFT-mediated polymerisation and ATRP

Directory of Open Access Journals (Sweden)

Eric T.A. van den Dungen

2011-03-01

Full Text Available Glycopolymers (synthetic sugar-containing polymers have become increasingly attractive to polymer chemists because of their role as biomimetic analogues and their potential for commercial applications. Glycopolymers of different structures confer high hydrophilicity and water solubility and can therefore be used for specialised applications, such as artificial materials for a number of biological, pharmaceutical and biomedical uses. The synthesis and characterisation of a series of novel glycopolymer brushes, namely poly(2-(2-bromoisobutyryloxy ethyl methacrylate-g-poly(methyl 6-O-methacryloyl-α-D-glucoside (P(BIEM-g-P(6-O-MMAGIc, poly(2-(2-bromoisobutyryloxy ethyl methacrylate-co-methyl methacrylate-g-poly(methyl 6-O-methacryloyl-α-D-glucoside P(BIEM-co-MMA-g-P(6-O-MMAGIc, poly(2-(2-bromoisobutyryloxy ethyl methacrylate-b-methyl methacrylate-g-poly(methyl 6-O-methacryloyl-α-D-glucoside P(BIEM-b-MMA-g-P(6-O-MMAGIc and poly(4-vinylbenzyl chloride-alt-maleic anhydride-g-poly(methyl 6-O-methacryloyl-α-D-glucoside (P(S_d-alt-MAnh-g-P(6-O-MMAGIc are described in this paper. Reversible addition-fragmentation chain transfer (RAFT-mediated polymerisation was used to synthesise four well-defined atom transfer radical polymerisation (ATRP macroinitiators (the backbone of the glycopolymer brushes. These ATRP macroinitiators were subsequently used in the ‘grafting from’ approach (in which side chains are grown from the backbone to prepare high molar mass and low polydispersity index glycopolymer brushes with different grafting densities along the backbone. The number average molar mass of the glycopolymer brushes was determined using size exclusion chromatography with a multi-angle laser light

Antioxidant capacity of plasma after red wine intake in Human

Directory of Open Access Journals (Sweden)

M. Gianmmanco

2009-01-01

Full Text Available Aim: Antioxidant effects after consumption of red wine have been investigated in several studies but results are contradictory and the difference in the plasma antioxidant capacity (AC after intake of red wine between women and men has never been studies. This work purpose is manifold: to ascertain whether red wine intake modifies the human plasma AC; to study the behaviour of plasma AC of women in comparison with men and finally to investigate on the plasma uric acid concentration and its relationships with the plasma AC after red wine intake.

Zwitterionic bis(phenolate)amine lanthanide complexes for the ring-opening polymerisation of cyclic esters

NARCIS (Netherlands)

Dyer, H.E.; Huijser, S.; Schwarz, A.D.; Wang, Chao; Duchateau, R.; Mountford, P.

2008-01-01

The reaction of Sm{N(SiMe3)2}3 with the bis(phenol)amines H2O2NR (H2O 2NR = RCH2CH2N(2-HO-3,5-C 6H2tBu2)2; R = OMe, NMe2 or Me) gave exclusively zwitterions Sm(O2N R)(HO2NR). For R = OMe or NMe2 these were efficient catalysts for the ring-opening polymerisation of e-caprolactone and d,l-lactide with

Controlling the Plasma-Polymerization Process of N-Vinyl-2-pyrrolidone

DEFF Research Database (Denmark)

Norrman, Kion; Winther-Jensen, Bjørn

2005-01-01

N-vinyl-2-pyrrolidone was plasma-polymerized on glass substrates using a pulsed AC plasma. Pulsed AC plasma produces a chemical surface structure different from that produced by conventional RF plasma; this is ascribed to the different power regimes used. A high degree of control over the structure...... of the chemical surface was obtained using pulsed AC plasma, as shown by ToF-SIMS. It is demonstrated how the experimental conditions to some extent control the chemical structure of the plasma-polymerized film, e.g., film thickness, density of post-plasma-polymerized oligomeric chains, and the density of intact...

Fabrication of molecularly imprinted polymer microarray on a chip by mid-infrared laser pulse initiated polymerisation.

Science.gov (United States)

Henry, Olivier Y F; Piletsky, Sergey A; Cullen, David C

2008-07-15

The possibility to assess several functional polymeric materials in parallel in a microchip format could find a wide range of applications in sensing, combinatorial and high-throughput screening. However several factors, inherent to the nature of material polymerisation have limited such development. We here report an innovative fabrication approach for the elaboration of polymer microarrays bearing polymer dots typically 300 microm in diameter fabricated in situ on a glass cover slip via CO(2) laser pulse initiated polymerisation, as well as initial results on the identification of a suitable monomer composition for the molecular imprinting of dansyl-L-phenylalanine as a proof-of-concept example. A combination of methacrylic acid and 2-vinylpyridine showed the largest affinity to dansyl-L-phenylalanine which agreed with the existing literature and the results were further confirmed by HPLC. Finally, a sensor chip bearing both non-imprinted as well as imprinted polymers was also prepared in order to prove the suitability of this fabrication approach for the elaboration of MIP based sensors. The assay consisted in a simple dip-and-read step and the sensing system was able to discriminate between the l and d enantiomers of dansylphenylalanine with an imprinting factor of 1.6.

Effects of tempering temperature on microstructural evolution and mechanical properties of high-strength low-alloy D6AC plasma arc welds

Energy Technology Data Exchange (ETDEWEB)

Lin, Chun-Ming, E-mail: chunming@ntut.edu.tw [Department of Mechanical Engineering, National Taipei University of Technology, Taipei 10608, Taiwan (China); Lu, Chi-Hao [Department of Mechanical Engineering, National Taiwan University of Science and Technology, Taipei 10673, Taiwan (China)

2016-10-31

This study prepared high-strength low-alloy (HSLA) D6AC weldments using a plasma arc welding (PAW) process. The PAW weldments were then tempered at temperatures of 300 °C, 450 °C, and 600 °C for 1000 min. Microstructural characteristics of the weld in as-welded HSLA-D6AC, tempered D6AC, and tensile-tested D6AC were observed via optical microscopy (OM). We also investigated the hardness, tensile strength, and V-notched tensile strength (NTS) of the tempered specimens using a Vickers hardness tester and a universal testing machine. The fracture surfaces of the specimens were observed using a scanning electron microscope (SEM). Our results show that the mechanical properties and microstructural features of the HSLA weldments are strongly dependent on tempering temperature. An increase in tempering temperature led to a decrease in the hardness and tensile strength of the weldments but led to an increase in ductility. These effects can be attributed to the transformation of the microstructure and its effect on fracture characteristics. The specimens tempered at 300 °C and 450 °C failed in a ductile-brittle manner due to the presence of inter-lath austenite in the microstructure. After tempering at a higher temperature of 600 °C, martensite embrittlement did not occur, such that specimens failure was predominantly in a ductile manner. In the NTS specimens, an increase in tempering temperature led to a reduction in tensile strength due to notch embrittlement and the effects of grain boundary thickening and sliding. Our findings provide a valuable reference for the application of HSLA-D6AC steel in engineering and other fields.

Retardative chain transfer in free radical free-radical polymerisations of vinyl neo-decanoate in low molecular weight polyisoprene and toluene

NARCIS (Netherlands)

Monteiro, M.J.; Subramaniam, N.; Taylor, J.R.; Pham, B.T.T.; Tonge, M.P.; Gilbert, R.G.

2001-01-01

The kinetics of free-radical polymerisation of vinyl neo-decanoate (VneoD) and the molecular weight distributions (MWDs) of the polymers formed in the presence and absence of low molecular weight polyisoprene at 50°C under a variety of conditions were investigated. The bulk reaction was successfully

An antibody that prevents serpin polymerisation acts by inducing a novel allosteric behaviour.

Science.gov (United States)

Motamedi-Shad, Neda; Jagger, Alistair M; Liedtke, Maximilian; Faull, Sarah V; Nanda, Arjun Scott; Salvadori, Enrico; Wort, Joshua L; Kay, Christopher W M; Heyer-Chauhan, Narinder; Miranda, Elena; Perez, Juan; Ordóñez, Adriana; Haq, Imran; Irving, James A; Lomas, David A

2016-10-01

Serpins are important regulators of proteolytic pathways with an antiprotease activity that involves a conformational transition from a metastable to a hyperstable state. Certain mutations permit the transition to occur in the absence of a protease; when associated with an intermolecular interaction, this yields linear polymers of hyperstable serpin molecules, which accumulate at the site of synthesis. This is the basis of many pathologies termed the serpinopathies. We have previously identified a monoclonal antibody (mAb4B12) that, in single-chain form, blocks α1-antitrypsin (α1-AT) polymerisation in cells. Here, we describe the structural basis for this activity. The mAb4B12 epitope was found to encompass residues Glu32, Glu39 and His43 on helix A and Leu306 on helix I. This is not a region typically associated with the serpin mechanism of conformational change, and correspondingly the epitope was present in all tested structural forms of the protein. Antibody binding rendered β-sheet A - on the opposite face of the molecule - more liable to adopt an 'open' state, mediated by changes distal to the breach region and proximal to helix F. The allosteric propagation of induced changes through the molecule was evidenced by an increased rate of peptide incorporation and destabilisation of a preformed serpin-enzyme complex following mAb4B12 binding. These data suggest that prematurely shifting the β-sheet A equilibrium towards the 'open' state out of sequence with other changes suppresses polymer formation. This work identifies a region potentially exploitable for a rational design of ligands that is able to dynamically influence α1-AT polymerisation. © 2016 The Author(s).

Negative hydrogen ion beam extraction from an AC heated cathode driven Bernas-type ion source

Energy Technology Data Exchange (ETDEWEB)

Okano, Y.; Miyamoto, N.; Kasuya, T.; Wada, M.

2015-04-08

A plasma grid structure was installed to a Bernas-type ion source used for ion implantation equipment. A negative hydrogen (H{sup −}) ion beam was extracted by an AC driven ion source by adjusting the bias to the plasma grid. The extracted electron current was reduced by positively biasing the plasma grid, while an optimum plasma grid bias voltage for negative ion beam extraction was found to be positive 3 V with respect to the arc chamber. Source operations with AC cathode heating show extraction characteristics almost identical to that with DC cathode heating, except a minute increase in H{sup −} current at higher frequency of cathode heating current.

Development of thermoresponsive poly(propylene-g-N-isopropylacrylamide) non-woven 3D scaffold for smart cell culture using oxyfluorination-assisted graft polymerisation

CSIR Research Space (South Africa)

Chetty, AS

2013-02-01

Full Text Available using oxyfluorination-assisted graft polymerisation (OAGP). New polar functional groups were detected on the oNWF, and PNIPAAm was confirmed in the gNWF by attentuated total-reflectance Fourier transform infrared (ATR-FTIR) and scanning X...

Solid-state polymerisation via [2+2] cycloaddition reaction involving coordination polymers.

Science.gov (United States)

Medishetty, Raghavender; Park, In-Hyeok; Lee, Shim Sung; Vittal, Jagadese J

2016-03-14

Highly crystalline metal ions containing organic polymers are potentially useful to manipulate the magnetic and optical properties to make advanced multifunctional materials. However, it is challenging to synthesise monocrystalline metal complexes of organic polymers and single-phase hybrid materials made up of both coordination and organic polymers by traditional solution crystallisation. This requires an entirely different approach in the solid-state by thermal or photo polymerisation of the ligands. Among the photochemical methods available, [2+2] cycloaddition reaction has been recently employed to generate cyclobutane based coordination polymers from the metal complexes. Cyclobutane polymers have also been integrated into coordination polymers in this way. Recent advancements in the construction of polymeric chains of cyclobutane rings through photo-dimerisation reaction in the monocrystalline solids containing metal complexes, coordination polymers and metal-organic framework structures are discussed here.

Development of Carbon-14 Waste Destruction and Recovery System Using AC Plasma Torch Technology Final Report CRADA No. TC02108.0

Energy Technology Data Exchange (ETDEWEB)

Althouse, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McKannay, R. H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-15

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and ISOFLEX USA (ISOFLEX), to 1) develop and test a prototype waste destruction system ("System") using AC plasma torch technology to break down and drastically reduce the volume of Carbon-14 (C-14) contaminated medical laboratory wastes while satisfying all environmental regulations, and 2) develop and demonstrate methods for recovering 99%+ of the carbon including the C-14 allowing for possible re-use as a tagging and labeling tool in the biomedical industry.

Pregnancy-associated plasma protein-A and the vulnerable plaque

DEFF Research Database (Denmark)

Jespersen, Camilla H B; Vestergaard, Kirstine R; Schou, Morten

2014-01-01

For more than a decade, pregnancy-associated plasma protein-A (PAPP-A) has been examined for its relation to acute coronary syndrome (ACS) and the vulnerable plaque. This review summarizes the current knowledge of plasma PAPP-A in relation to nonpregnant individuals focusing on patients with ACS...

Acetalised Galactarate Polyesters: Interplay between Chemical Structure and Polymerisation Kinetics

Directory of Open Access Journals (Sweden)

Ionela Gavrila

2018-02-01

Full Text Available In spite of the progress that has made so far in the recent years regarding the synthesis of bio-based polymers and in particular polyesters, only few references address the optimisation of these new reactions with respect to conversion and reaction time. Related to this aspect, we here describe the transesterification reaction of two different acetalised galactarate esters with a model aliphatic diol, 1,6-hexanediol. The kinetics of these two apparently similar reactions is compared, with a focus on the conversion while varying the concentration of a di-butyltin oxide catalyst (DBTO, respectively, the used N2 flow-rate. During the first stage of polymerisation, the molecular weight of the end-products is more than doubled when using a 250 mL/min flow as opposed to an almost static N2 pressure. Additionally, the resulted pre-polymers are subjected to further polycondensation and the comparison between the obtained polyesters is extended to their thermal, mechanical and dielectrical characterisation. The influence of the acetal groups on the stability of the polyesters in acidic conditions concludes the study.

Radiation-Induced Polymerization of Aldehydes and Ketones; Polymerisation radiochimique des aldehydes et des cetones; Radiatsionnaya polimerizatsiya al'degidov i ketonov; Polimerizacion radioinducida de aldehidos y cetonas

Energy Technology Data Exchange (ETDEWEB)

Hayashi, K.; Yamaoka, H.; Fujiwara, K.; Sakamoto, M.; Mori, S.; Natori, T.; Yoshida, H.; Okamura, S. [Japanese Association for Radiation Research on Polymers, Neyagawa Osaka (Japan); Kyoto University, Kyoto (Japan)

1963-11-15

Several kinds of aldehydes and ketones are polymerized by irradiation. Formaldehyde can be polymerized into high molecular weight polyoxymethylene by radiation-induced polymerization in the liquid phase at low temperatures. The polymerization mechanism is considered to be a cationic chain reaction both in the case of bulk and of solution in methylenechloride and toluene, but to be anionic in ethylether. Acetaldehyde and propionaldehyde are recognized as being hardly polymerized in the pure liquid phase, but easily polymerized in the presence of {gamma}-alumina. In the solid state polymerization, crystalline polymers are obtained as the stable- for- heat-treatment form under suitableconditions. Glyoxal can be polymerized into a three-dimensional network polymer. With formaldehyde it can be copolymerized into some cross-linked polyoxymethylene. Acetones such as chloroor bromoacetone and methylethylketone or diacetyl can be polymerized in the solid state into polymers which are unstable. Ketene can be polymerized into a polyester-type polymer with liquid phase polymerization; polyketone is obtained additionally when polymerization is carried out in the solid state. The copolymer with formaldehyde is slightly more stable. Dimethylketene can be easily polymerized both in the liquid and solid states into polyacetal. All these polymerizations are special examples of radiation-induced reactions and the reaction kinetics are interesting. Some details of this are discussed here. (author) [French] Plusieurs sortes d'aldehydes et de cetones se polymerisent sous l'effet des rayons gamma. L'aldehyde formique peut se transformer en polyoxymethylene de poids moleculaire eleve par polymerisation radiochimique en phase liquide a basses temperatures. On pense que la polymerisation est une reaction cationique en chaine lorsqu'il s'agit de masses ou de solutions dans du chlorure de methylene et du toluene, mais une reaction anionique en chaule dans une solution d'ether ethylique. L

Estudio por emisión acústica del comportamiento a flexión de recubrimientos WC-Co obtenidos por plasma atmosférico

Directory of Open Access Journals (Sweden)

Segovia, F.

2007-12-01

Full Text Available Plasma sprayed cermet coatings WC-Co are used in a wide range of industrial applications, mainly due to their wear resistance even in corrosive environments. The objective of this work is to analyze mechanical response of hard metal coatings by means of three- and four-points bend tests applying acoustic emission technique to determine failure critical strength. It has been observed the effect of supported charge level in structural damage by means of optical microscopy and scanning electron microscopy. Acoustic emission has allowed us to relate damage level to stresses level and then to understand coatings failure mechanism.

Los recubrimientos de cermet WC-Co proyectados por plasma se utilizan en un amplio rango de aplicaciones industriales, principalmente por su resistencia al desgaste, incluso en medio corrosivo. El objetivo de este trabajo es analizar la respuesta mecánica de los recubrimientos de metal duro mediante ensayos de flexión a 3 y 4 puntos aplicando el método de emisión acústica para determinar las tensiones críticas de fallo. Se ha observado el efecto del nivel de carga soportado en el dañado estructural mediante microscopia óptica y electrónica de barrido. La emisión acústica ha permitido relacionar el grado de dañado con el nivel de tensiones y, así, entender el mecanismo de fallo de los recubrimientos.

Dynamic voltage-current characteristics for a water jet plasma arc

International Nuclear Information System (INIS)

Yang Jiaxiang; Lan Sheng; Xu Zuoming

2008-01-01

A virtual instrument technology is used to measure arc current, arc voltage, dynamic V-I characteristics, and nonlinear conductance for a cone-shaped water jet plasma arc under ac voltage. Experimental results show that ac arc discharge mainly happens in water vapor evaporated from water when heated. However, due to water's cooling effect and its conductance, arc conductance, reignition voltage, extinguish voltage, and current zero time are very different from those for ac arc discharge in gas work fluid. These can be valuable to further studies on mechanism and characteristics of plasma ac discharge in water, and even in gas work fluid

AC/DC/pulsed-power modulator for corona-plasma generation

NARCIS (Netherlands)

Ariaans, T.H.P.; Pemen, A.J.M.; Winands, G.J.J.; Heesch, van E.J.M.; Liu, Z.

2009-01-01

Gas-cleaning techniques using nonthermal plasma are slowly introduced into industry nowadays. In this paper, we present a novel power modulator for the efficient generation of large-volume corona plasma. No expensive high-voltage components are required. Switching is done at an intermediate voltage

Plasma firocoxib concentrations after intra-articular injection of autologous conditioned serum prepared from firocoxib positive horses.

Science.gov (United States)

Ortved, K F; Goodale, M B; Ober, C; Maylin, G A; Fortier, L A

2017-12-01

Orthobiologics such as autologous conditioned serum (ACS) are often used to treat joint disease in horses. Because ACS is generated from the horse's own blood, any medication administered at the time of preparation would likely be present in stored ACS, which could lead to an inadvertent positive drug test following intra-articular (IA) injection. The main objective of this study was to determine if ACS prepared from firocoxib positive horses could result in detectable plasma concentrations of the drug following IA injection. Firocoxib was administered to six horses at 0.1mg/kg PO twice at a 24h interval. Blood was obtained at 4h following the second dose and transferred to a separate syringe (Arthrex IRAP II) for ACS preparation. Plasma and ACS concentrations of firocoxib were analysed by liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS). When horses were confirmed firocoxib negative, 7.5mL of ACS was injected into both tarsocrural joints. Blood samples were collected at 0, 4, 8, 12, 24, and 48h, and firocoxib concentration was measured. Mean (±standard error of the mean, SEM) plasma concentration of firocoxib 4h following the second dose was 33.3±4.72ng/mL. Mean (±SEM) firocoxib concentration in ACS was 35.4±4.47ng/mL. Fourteen days following the second and last dose of firocoxib, mean plasma concentration was below the lower limit of detection (LOD=1ng/mL) in all horses. Following IA injection of ACS, plasma concentrations of firocoxib remained below LOD at all times in all horses. ACS generated from horses with therapeutic plasma concentrations of firocoxib did not contain sufficient firocoxib to lead to a positive plasma drug test following IA administration. Copyright © 2017 Elsevier Ltd. All rights reserved.

Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

International Nuclear Information System (INIS)

Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

1997-01-01

The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

Synthesis of controlled polymeric cross-linked coatings via iniferter polymerisation in the presence of tetraethyl thiuram disulphide chain terminator.

Science.gov (United States)

Bossi, A; Whitcombe, M J; Uludag, Y; Fowler, S; Chianella, I; Subrahmanyam, S; Sanchez, I; Piletsky, S A

2010-05-15

A "grafting from" approach has been used for controlled deposition of cross-linked polymers by living radical polymerisation. Borosilicate glass was modified with N,N-diethylaminodithiocarbamoylpropyl(trimethoxy)silane, in order to confine the iniferter reactive groups solely at its surface, then placed in solution with monomers and cross-linker. The polymerisation was initiated by UV irradiation. Formation of the cross-linked polymers was studied in terms of time course of the reaction, type of monomers incorporated and influence of oxygen. Grafted surfaces were characterised by AFM, FT-IR, ellipsometry and contact angle measurements. The ability to control the grafted layer improved dramatically when the chain terminator agent, N,N-N',N'-tetraethyl thiuram disulphide (TED) was added. Upon irradiation TED increases the concentration of passive capping radicals and decreases the possibility of recombination of active macro-radicals, thus prolonging their lifetime. In the absence of TED the thickness of produced coatings was below 10 nm. TED added at different concentrations assisted in the formation of grafted layers of 10-130 nm thickness. Iniferter chemistry in the presence of TED can be used for growing nanometre-scale polymer layers on solid supports. It constitutes a robust general platform for controlled grafting and offer a general solution to address the needs of surface derivatisation in sensors technology. 2010 Elsevier B.V. All rights reserved.

Review of some research work on surface modification and polymerizations by non-equilibrium plasma in Turkey

International Nuclear Information System (INIS)

Akovali, Guneri

2004-01-01

Non equilibrium plasma studies in Turkey can be considered as organized on two different lines: surface modification studies and plasma polymerization studies. Plasma surface modification studies: In different laboratories in Turkey the modification of materials' surfaces by plasma covers a wide spectra, for example: fibers (Carbon (CF) and polyacrylonitrile (PAN)), fabrics (PET/Cotton and PET/PA), biomaterials-food oriented (PU), denture Acrylic matrix, plasmochemical modification of a (PE and PP) film surface by several selected silicon and tin containing monomers, polymer blends and composites, recycled rubber and epoxy systems, etc. Plasma polymerization studies: This topic is accomplished by a great number of projects, for instance: plasma initiation polymerization and copolymerization of Styrene and MMA, Plasma-initiated polymerizations of Acrylamide (AA), kinetics of polymer deposition of several selected saturated hydrocarbons, silanization treatments by hexamethyldisilazane (HDMS), Plasma initiated polymerization (PIP) of allyl alcohol and 1-propano, (PSP) and (PIP) studies related to activated charcoal are done to explore their applications in haemoperfusion, an amperometric alcohol single-layer electrode is prepared by (EDA) plasma polymerization, preparation of mass sensitive immuno sensors and single layer multi enzyme electrodes by plasma polymerisation technique, etc

The polymerisation of oligo(ethylene glycol methyl ether) methacrylate from a multifunctional poly(ethylene imine) derived amide : a stabiliser for the synthesis and dispersion of magnetite nanoparticles

NARCIS (Netherlands)

Kleine, A.; Altan, C.L.; Yarar, U.E.; Sommerdijk, N.A.J.M.; Bucak, S.; Holder, S.J.

2014-01-01

A facile synthetic route to poly(ethylene imine)-graft-poly(oligo(ethylene glycol methyl ether)) (PEI-graft-POEGMA) functionalised superparamagnetic magnetite nanoparticles is described. The polymerisation of OEGMA from a model molecular amide demonstrated the feasibility of POEGMA synthesis under

AC Initiation System.

Science.gov (United States)

An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

Plasma carnitine concentrations after chronic alcohol intoxication 

Directory of Open Access Journals (Sweden)

Alina Kępka

2013-05-01

Full Text Available Background: Carnitine transports fatty acids from the cytoplasm to the mitochondrial matrix, where the fatty acids are oxidized. Chronic alcohol consumption reduces the concentration of carnitine and interferes with oxidative processes occurring in the cell.Aim: The assessment of carnitine concentrations in plasma of chronically intoxicated alcohol dependent persons in a 49-day abstinence period.Material/Methods: The study included 31 patients (5 women and 27 men aged from 26 to 60 years (44.6± 8.9 and 32 healthy subjects (15 women and 17 men aged 22-60 years (39.8± 9.4. The patients’ alcohol dependence ranged from 2 to 30 years (13.6± 7.5. Examined subjects consumed 75-700 g of ethanol/day (226.9± 151.5. Plasma concentrations of free and total carnitine were measured three times: at the first (T0, 30th (T30 and 49th (T49 day of hospital detoxification. Free (FC and total (TC carnitine were determined by the spectrophotometric method. Plasma acylcarnitine (AC concentration was calculated from the difference between TC and FC; then the AC/FC ratio was calculated. To determine statistically significant differences for related variables, Student’s t-test was used.Results: At T0, alcoholics had significantly lower concentration of FC and TC (p < 0.05 in plasma, as compared to the control group. In comparison to controls, at T30, plasma TC and FC (p < 0.01 as well as AC (p < 0.001 were reduced. The lowest concentration of TC, FC and AC (p < 0.001was found at T49. The ratio of AC/FC at T0 had a tendency to be higher in alcoholics than in the control group (p = 0.05, whereas at T49 it was significantly lower in alcoholics as compared to the control subjects (p < 0.05.Conclusions: Chronic alcohol intoxication causes a plasma deficiency of carnitine. Forty-nine days of abstinence showed a significant decrease in the concentration of TC, FC and AC. Further research is necessary to clarify whether a low level of plasma carnitine

Study on ac losses of HTS coil carrying ac transport current

International Nuclear Information System (INIS)

Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

2005-01-01

Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

Multi-phase AC/AC step-down converter for distribution systems

Science.gov (United States)

Aeloiza, Eddy C.; Burgos, Rolando P.

2017-10-25

A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

Translation, modification and cellular distribution of two AC4 variants of African cassava mosaic virus in yeast and their pathogenic potential in plants

International Nuclear Information System (INIS)

Hipp, Katharina; Rau, Peter; Schäfer, Benjamin; Pfannstiel, Jens; Jeske, Holger

2016-01-01

Plant infecting geminiviruses encode a small (A)C4 protein within the open reading frame of the replication-initiator protein. In African cassava mosaic virus, two in-frame start codons may be used for the translation of a longer and a shorter AC4 variant. Both were fused to green fluorescent protein or glutathione-S-transferase genes and expressed in fission yeast. The longer variant accumulated in discrete spots in the cytoplasm, whereas the shorter variant localized to the plasma membrane. A similar expression pattern was found in plants. A myristoylation motif may promote a targeting of the shorter variant to the plasma membrane. Mass spectrometry analysis of the yeast-expressed shorter variant detected the corresponding myristoylation. The biological relevance of the second start codon was confirmed using mutated infectious clones. Whereas mutating the first start codon had no effect on the infectivity in Nicotiana benthamiana plants, the second start codon proved to be essential. -- Highlights: •The ACMV AC4 may be translated from one or the other in-frame start codon. •Both AC4 variants are translated in fission yeast. •The long AC4 protein localizes to the cytoplasm, the short to the plasma membrane. •The short variant is myristoylated in yeast and may promote membrane localization. •Only the shorter AC4 variant has an impact on viral infections in plants.

Translation, modification and cellular distribution of two AC4 variants of African cassava mosaic virus in yeast and their pathogenic potential in plants

Energy Technology Data Exchange (ETDEWEB)

Hipp, Katharina, E-mail: katharina.hipp@bio.uni-stuttgart.de [University of Stuttgart, Institute of Biomaterials and biomolecular Systems, Department of Molecular Biology and Plant Virology, Pfaffenwaldring 57, 70550 Stuttgart (Germany); Rau, Peter; Schäfer, Benjamin [University of Stuttgart, Institute of Biomaterials and biomolecular Systems, Department of Molecular Biology and Plant Virology, Pfaffenwaldring 57, 70550 Stuttgart (Germany); Pfannstiel, Jens [University of Hohenheim, Mass Spectrometry Core Facility, August-von-Hartmann-Straße 3, 70599 Stuttgart (Germany); Jeske, Holger [University of Stuttgart, Institute of Biomaterials and biomolecular Systems, Department of Molecular Biology and Plant Virology, Pfaffenwaldring 57, 70550 Stuttgart (Germany)

2016-11-15

Plant infecting geminiviruses encode a small (A)C4 protein within the open reading frame of the replication-initiator protein. In African cassava mosaic virus, two in-frame start codons may be used for the translation of a longer and a shorter AC4 variant. Both were fused to green fluorescent protein or glutathione-S-transferase genes and expressed in fission yeast. The longer variant accumulated in discrete spots in the cytoplasm, whereas the shorter variant localized to the plasma membrane. A similar expression pattern was found in plants. A myristoylation motif may promote a targeting of the shorter variant to the plasma membrane. Mass spectrometry analysis of the yeast-expressed shorter variant detected the corresponding myristoylation. The biological relevance of the second start codon was confirmed using mutated infectious clones. Whereas mutating the first start codon had no effect on the infectivity in Nicotiana benthamiana plants, the second start codon proved to be essential. -- Highlights: •The ACMV AC4 may be translated from one or the other in-frame start codon. •Both AC4 variants are translated in fission yeast. •The long AC4 protein localizes to the cytoplasm, the short to the plasma membrane. •The short variant is myristoylated in yeast and may promote membrane localization. •Only the shorter AC4 variant has an impact on viral infections in plants.

Evaluation of a centrifuge with rapid turnaround time for the preparation of plasma samples for measurement of common STAT markers on the ACS: 180 system.

Science.gov (United States)

Foster, K; Datta, P; Orswell, M; Tasaico, K; Alpert, A; Bluestein, B

2000-01-01

Reported is the evaluation of a new centrifugation method, Statspin, that addresses both time and sample separation integrity. The method can successfully separate the plasma fraction from the cellular material in 2 minutes as compared to 20 minutes for the conventional centrifuge method. The Statspin, combined with the ACS:180 system, can generate test results in less than 30 minutes, exclusive of transport to the laboratory. This study demonstrated that the combined technologies offer timing-saving improvements for clinical laboratories offering STAT immunoassays for cardiac markers, endocrine molecules, and therapeutic drugs.

Simulation of the AC corona phenomenon with experimental validation

International Nuclear Information System (INIS)

Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R

2017-01-01

The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)

Plasma Treated Active Carbon for Capacitive Deionization of Saline Water

Directory of Open Access Journals (Sweden)

Aiping Zeng

2017-01-01

Full Text Available The plasma treatment on commercial active carbon (AC was carried out in a capacitively coupled plasma system using Ar + 10% O2 at pressure of 4.0 Torr. The RF plasma power ranged from 50 W to 100 W and the processing time was 10 min. The carbon film electrode was fabricated by electrophoretic deposition. Micro-Raman spectroscopy revealed the highly increased disorder of sp2 C lattice for the AC treated at 75 W. An electrosorption capacity of 6.15 mg/g was recorded for the carbon treated at 75 W in a 0.1 mM NaCl solution when 1.5 V was applied for 5 hours, while the capacity of the untreated AC was 1.01 mg/g. The plasma treatment led to 5.09 times increase in the absorption capacity. The jump of electrosorption capacity by plasma treatment was consistent with the Raman spectra and electrochemical double layer capacitance. This work demonstrated that plasma treatment was a potentially efficient approach to activating biochar to serve as electrode material for capacitive deionization (CDI.

Charge dependence of the plasma travel length in atmospheric-pressure plasma

Energy Technology Data Exchange (ETDEWEB)

Yambe, Kiyoyuki; Konda, Kohmei; Masuda, Seiya [Graduate School of Science and Technology, Niigata University, Niigata 950-2181 (Japan)

2016-06-15

Plasma plume is generated using a quartz tube, helium gas, and foil electrode by applying AC high voltage under the atmosphere. The plasma plume is released into the atmosphere from inside of the quartz tube and is seen as the continuous movement of the plasma bullet. The travel length of plasma bullet is defined from plasma energy and force due to electric field. The drift velocity of plasma bullet has the upper limit under atmospheric-pressure because the drift velocity is determined from the balance between electric field and resistive force due to collisions between plasma and air. The plasma plume charge depends on the drift velocity. Consequently, in the laminar flow of helium gas flow state, the travel length of the plasma plume logarithmically depends on the plasma plume charge which changes with both the electric field and the resistive force.

Charge dependence of the plasma travel length in atmospheric-pressure plasma

International Nuclear Information System (INIS)

Yambe, Kiyoyuki; Konda, Kohmei; Masuda, Seiya

2016-01-01

Plasma plume is generated using a quartz tube, helium gas, and foil electrode by applying AC high voltage under the atmosphere. The plasma plume is released into the atmosphere from inside of the quartz tube and is seen as the continuous movement of the plasma bullet. The travel length of plasma bullet is defined from plasma energy and force due to electric field. The drift velocity of plasma bullet has the upper limit under atmospheric-pressure because the drift velocity is determined from the balance between electric field and resistive force due to collisions between plasma and air. The plasma plume charge depends on the drift velocity. Consequently, in the laminar flow of helium gas flow state, the travel length of the plasma plume logarithmically depends on the plasma plume charge which changes with both the electric field and the resistive force.

AC – AC Converters for UPS

Directory of Open Access Journals (Sweden)

Rusalin Lucian R. Păun

2008-05-01

Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

Performance of AC/graphite capacitors at high weight ratios of AC/graphite

Energy Technology Data Exchange (ETDEWEB)

Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

2008-03-01

The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

Depigmented and polymerised house dust mite allergoid: allergen content, induction of IgG4 and clinical response.

Science.gov (United States)

Gallego, M T; Iraola, V; Himly, M; Robinson, D S; Badiola, C; García-Robaina, J C; Briza, P; Carnés, J

2010-01-01

Polymerised allergenic extracts (allergoids) are commonly used in allergen immunotherapy. Clinical efficacy and safety of these extracts have been demonstrated. Recently, allergen sequences have been identified by mass spectrometry in depigmented and polymerised (Dpg-Pol) extracts. The objectives of this study were to investigate the presence of allergens in Dpg-Pol extracts of house dust mite and to analyze the immunological changes induced by these extracts in asthmatic patients enrolled in a double-blind, placebo-controlled study. Dpg-Pol extracts were manufactured and vaccines with a composition of 50% Dermatophagoides pteronyssinus and 50% D. farinae (100 HEPL/ml) were prepared. Allergen composition was analyzed by mass spectrometry. Patients with asthma and rhinoconjunctivitis were treated in a 1-year, double-blind, placebo-controlled, parallel-group study with 6 up-dosing and monthly maintenance injections. Specific IgE and IgG4 titres to D. pteronyssinus, Der p 1 and Der p 2 were measured in patients' sera using the CAP system and direct ELISA experiments. Sequences from the major allergens Der p 1 and Der p 2 and from other allergens were identified in native and Dpg-Pol extracts. There was a statistically significant increase in specific IgG4, a decrease in the ratio of IgE/IgG4 to D. pteronyssinus and a significant increase in specific IgG4 to Der p 1 and Der p 2 in the patients allotted to active treatment. The detection of allergen sequences suggests preservation of major and minor allergens in Dpg-Pol allergoids from house dust mites. Efficacy in asthma treatment and the increase in specific IgG4 seem to be associated with the presence of major allergens in Dpg-Pol allergen extracts. Copyright (c) 2010 S. Karger AG, Basel.

Therapeutic plasma exchange: a paired comparison of Fresenius AS104 vs. COBE Spectra.

Science.gov (United States)

Burgstaler, E A; Pineda, A A

2001-01-01

For therapeutic plasma exchange (TPE), continuous flow separators are known to be efficient as exemplified by Fresenius AS104 and COBE Spectra. The AS104 uses an interface monitoring system in the centrifuge during TPE, whereas Spectra uses computer algorithms to establish the plasma-cell interface. To determine the plasma collection efficiency (PLCE), anticoagulant (AC) volumes used, and platelets (PLT) lost of the AS104 and the Spectra, we performed a prospective paired comparison of 20 TPE (each machine). The study included 17 patients, 1.3 plasma volume exchanges (without AC), equal inlet rates, and AC ratio of 13:1. Processing times did not include reinfuse mode. Platelet loss was determined by sampling the collection bags. Inlet rates were between 60-110 ml/min. Diagnosis included peripheral neuropathies, TTP and cryoglobulinemia. The AS104 had significantly (P<0.0001) lower average whole blood processed (F:6,601 vs. S:8,584 ml), AC volume (F:532 vs. S:719 ml), and processing time (F:80 vs. S:102 minutes) than Spectra. The AS104 had significantly (P<0.0001) higher average plasma flow rates (F:53 vs. S:44 ml/minute), plasma collection efficiency (F:90 vs. S:69%), and platelet loss (F:2.0 vs. S:0.14 x 10(11) plt) than Spectra. Platelet loss correlated with inlet flow rate with the AS104 but not with the Spectra. The AS104 has a significantly higher collection efficiency than Spectra allowing it to remove the same amount of plasma in significantly less time, by processing significantly less blood, using significantly less AC, but removing significantly more platelets than Spectra. Copyright 2001 Wiley-Liss, Inc.

In-flight particle measurement of glass raw materials in hybrid heating of twelve-phase AC arc with oxygen burner

International Nuclear Information System (INIS)

Liu, Y; Tanaka, M; Ikeba, T; Choi, S; Watanabe, T

2012-01-01

The high temperature provided by a 12-phase AC arc plasma is beneficial to finish vitrification reaction in milliseconds. Another heating method called “hybrid plasma” combines multi-phase AC arc and oxygen burner are expected to improve glass quality and increase productivity with minimum energy consumption. In this study, recent works on the development of in-flight particle measurement in hybrid plasma system are presented. Two-colour pyrometry offers considerable advantages for measuring particle temperatures in flight. A high-speed camera equipped with a band-pass filter system was applied to measure the in-flight temperatures of glass particles. The intensity recorded by the camera was calibrated using a tungsten halogen lamp. This technique also allows evaluating the fluctuation of the average particle temperature within millisecond in plasma region.

Radiation Polymerization in the Solid Phase; Polymerisation radiochimique en phase solide; Radiatsionnaya polimerizatsiya v tverdoj faze; Radiopolimerizacion en fase solida

Energy Technology Data Exchange (ETDEWEB)

Barkalov, I. M.; Gol' danskij, V. I.; Enikolopov, N. S.; Terekhova, S. F.; Trofimova, G. M.

1963-11-15

lifetime of the irradiationproduced ions. The results of these experiments indicate the potentially considerable role of short-lived excited states in the radiation solid-phase polymerization of a number of monomers. Such ''under-beam'' polymerization occurs in practice without activation energy, unlike slow post-polymerization, which occurs with the same activation energy as does the liquid phase process. (author) [French] La polymerisation radiochimique des monomeres a l'etat solide et congele fait l'objet depuis quelque temps d'une attention soutenue. Cette question presente un grand interet tant du point de vue pratique qu'en ce qui concerne les theories modernes de la cinetique chimique et de la radiochimie. On sait qu'une configuration speciale strictement ordonnee des unites monomeriques dans le polymere provoque une amelioration sensible des proprietes physico-mecaniques sans que la composition chimique s'en trouve alteree. Pour realiser la synthese de polymeres a structure spatiale reguliere, on fait appel au principe de la matrice; en d'autres termes, l'unite monomerique est nettement orientee dans l'espace par la formation d'un complexe a l'aide d'un catalyseur ou de toute autre substance appropriee. Ainsi, lors de la polymerisation radiochimique de plusieurs monomeres orientes dans des clathrates de l'uree ou de la thio-uree, on a obtenu des polymeres cristallins a structure spatiale reguliere. Cependant, l e procede le plus simple consiste a orienter le monomere dans son propre reseau cristallin. Bien que de nombreuses questions theoriques soient encore a elucider dans ce domaine, l'application de la methode mentionee est fort seduisante. Ainsi, la polymerisation radiochimique du trioxyethylene cristallise a deja permis d'obtenir un polyoxymethylene fortement cristallise. Cependant, cette methode necessite une etude theorique plus approfondie. Pour chaque monomere, il est indispensable de determiner dans quelle mesure les divers types de reactions qui s

A comparative study of the physical properties of Sb2S3 thin films treated with N2 AC plasma and thermal annealing in N2

International Nuclear Information System (INIS)

Calixto-Rodriguez, M.; Martinez, H.; Pena, Y.; Flores, O.; Esparza-Ponce, H.E.; Sanchez-Juarez, A.; Campos-Alvarez, J.; Reyes, P.

2010-01-01

As-deposited antimony sulfide thin films prepared by chemical bath deposition were treated with nitrogen AC plasma and thermal annealing in nitrogen atmosphere. The as-deposited, plasma treated, and thermally annealed antimony sulfide thin films have been characterized by X-ray diffraction (XRD), energy dispersive X-ray spectroscopy, scanning electron microscopy, atomic force microscopy, UV-vis spectroscopy, and electrical measurements. The results have shown that post-deposition treatments modify the crystalline structure, the morphology, and the optoelectronic properties of Sb 2 S 3 thin films. X-ray diffraction studies showed that the crystallinity of the films was improved in both cases. Atomic force microscopy studies showed that the change in the film morphology depends on the post-deposition treatment used. Optical emission spectroscopy (OES) analysis revealed the plasma etching on the surface of the film, this fact was corroborated by the energy dispersive X-ray spectroscopy analysis. The optical band gap of the films (E g ) decreased after post-deposition treatments (from 2.36 to 1.75 eV) due to the improvement in the grain sizes. The electrical resistivity of the Sb 2 S 3 thin films decreased from 10 8 to 10 6 Ω-cm after plasma treatments.

Assessment of the imprinting efficiency of an imide with a "stoichiometric" pyridine-based functional monomer in precipitation polymerisation.

Science.gov (United States)

Lim, K Fremielle; Hall, Andrew J; Lettieri, Stefania; Holdsworth, Clovia I

2018-03-01

The efficiency of the stoichiometric non-covalent imprinting of the imide 2,3,5-tri-O-acetyluridine (TAU) with 2,6-bis(acrylamido)pyridine (BAAPy) as functional monomer due to their strong donor-acceptor-donor/acceptor-donor-acceptor (DAD/ADA) hydrogen bond array interaction has been evaluated by bulk imprinting. This study is the first to investigate the imprinting and template rebinding efficiencies of the TAU/BAAPy molecularly imprinted polymeric (MIP) system prepared by precipitation polymerisation. We found that the stoichiometric 1:1 T:FM ratio has not been maintained in precipitation polymerisation and an optimal TAU:BAAPy ratio of 1:2.5 was obtained in acetonitrile without agitation affording an affinity constant (1.7 × 10 4 M -1 ) and a binding capacity (3.69 μmol/g) higher than its bulk counterpart. Molecular modelling, NMR studies, and selectivity assays against analogues uridine and 2,3,5-tri-O-acetyl cytidine (TAC) indicate that, aside from the DAD/ADA hydrogen bond interaction, BAAPy also interacts with the acetyl groups of TAU. Template incorporation and rebinding in precipitation MIPs are favoured by a moderate initiator concentration, ie, initiator:total monomer (I:TM) ratio of 1:131, while low I:TM ratio (ie, 1:200) drastically reduced template incorporation and binding capacity. Vigorous agitation by stirring showed higher template incorporation but significantly lower template rebinding compared to that prepared without agitation. While the imprinting efficiencies for the best performing bulk and precipitation TAU MIPs generated in this study were moderate, 41% and 60%, respectively, their rebinding capacities were only between 3 and 4% of the incorporated template. We also present quantitative nuclear magnetic resonance spectroscopy as an efficient method for MIP characterisation. Copyright © 2017 John Wiley & Sons, Ltd.

Peltier ac calorimeter

OpenAIRE

Jung, D. H.; Moon, I. K.; Jeong, Y. H.

2001-01-01

A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

Digital model for harmonic interactions in AC/DC/AC systems

Energy Technology Data Exchange (ETDEWEB)

Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

1994-12-31

The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

Toward Plasma-Assisted Ignition in Scramjets

National Research Council Canada - National Science Library

Jacobsen, Lance S; Carter, Campbell D; Baurie, Robert A; Jackson, Thomas A

2003-01-01

.... The two plasma torches currently under investigation consist of a DC constricted-arc design from the Virginia Polytechnic Institute and State University and an AC unconstricted-arc design based...

ACS Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2005-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

Ion irradiation as a tool for modifying the surface and optical properties of plasma polymerised thin films

Energy Technology Data Exchange (ETDEWEB)

Grant, Daniel S. [College of Science, Technology and Engineering, James Cook University, Townsville, Queensland 4811 (Australia); Bazaka, Kateryna [College of Science, Technology and Engineering, James Cook University, Townsville, Queensland 4811 (Australia); School of Chemistry, Physics, and Mechanical Engineering, Queensland University of Technology, Brisbane, Queensland 4000 (Australia); Siegele, Rainer [Institute for Environmental Research, Australian Nuclear Science and Technology Organisation, Lucas Heights, New South Wales 2234 (Australia); Holt, Stephen A. [Bragg Institute, Australian Nuclear Science and Technology Organisation, Lucas Heights, New South Wales 2234 (Australia); Jacob, Mohan V., E-mail: Mohan.Jacob@jcu.edu.au [College of Science, Technology and Engineering, James Cook University, Townsville, Queensland 4811 (Australia)

2015-10-01

Radio frequency (R.F.) glow discharge polyterpenol thin films were prepared on silicon wafers and irradiated with I{sup 10+} ions to fluences of 1 × 10{sup 10} and 1 × 10{sup 12} ions/cm{sup 2}. Post-irradiation characterisation of these films indicated the development of well-defined nano-scale ion entry tracks, highlighting prospective applications for ion irradiated polyterpenol thin films in a variety of membrane and nanotube-fabrication functions. Optical characterisation showed the films to be optically transparent within the visible spectrum and revealed an ability to selectively control the thin film refractive index as a function of fluence. This indicates that ion irradiation processing may be employed to produce plasma-polymer waveguides to accommodate a variety of wavelengths. XRR probing of the substrate-thin film interface revealed interfacial roughness values comparable to those obtained for the uncoated substrate’s surface (i.e., both on the order of 5 Å), indicating minimal substrate etching during the plasma deposition process.

Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge

Science.gov (United States)

Williamson, James M.; Trump, Darryl D.; Bletzinger, Peter; Ganguly, Biswa N.

2006-10-01

A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s-1. The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of ~3 × 1015 cm-3 at 25 W. The maximum ozone production achieved by short-pulse excitation was ~8.5 × 1015 cm-3 at 20 W, which was four times greater than that achieved by ac excitation at the same power level.

Generation of radiation by intense plasma and electromagnetic undulators

Energy Technology Data Exchange (ETDEWEB)

Joshi, C.

1991-10-01

We examine the characteristics of the classical radiation emission resulting from the interaction of a relativistic electron beam that propagates perpendicularly through a large amplitude relativistic plasma wave. Such a study is useful for evaluating the feasibility of using relativistic plasma waves as extremely short wavelength undulators for generating short wavelength radiation. The electron trajectories in a plasma wave undulator and in an ac FEL undulator are obtained using perturbation techniques. The spontaneous radiation frequency spectrum and angular distribution emitted by a single electron oscillating in these two undulators are then calculated. The radiation gain of a copropagating electromagnetic wave is calculated. The approximate analytic results for the trajectories, spontaneous radiation and gain are compared with 3-D simulation results. The characteristics of the plasma wave undulator are compared with the ac FEL undulator and linearly polarized magnetic undulator. 50 refs., 26 figs., 3 tabs.

Generation of radiation by intense plasma and electromagnetic undulators

International Nuclear Information System (INIS)

Joshi, C.

1991-10-01

We examine the characteristics of the classical radiation emission resulting from the interaction of a relativistic electron beam that propagates perpendicularly through a large amplitude relativistic plasma wave. Such a study is useful for evaluating the feasibility of using relativistic plasma waves as extremely short wavelength undulators for generating short wavelength radiation. The electron trajectories in a plasma wave undulator and in an ac FEL undulator are obtained using perturbation techniques. The spontaneous radiation frequency spectrum and angular distribution emitted by a single electron oscillating in these two undulators are then calculated. The radiation gain of a copropagating electromagnetic wave is calculated. The approximate analytic results for the trajectories, spontaneous radiation and gain are compared with 3-D simulation results. The characteristics of the plasma wave undulator are compared with the ac FEL undulator and linearly polarized magnetic undulator. 50 refs., 26 figs., 3 tabs

Immobilization/hybridization of amino-modified DNA on plasma-polymerized allyl chloride

International Nuclear Information System (INIS)

Zhang Zhihong; Feng Chuanliang

2007-01-01

The present work describes the fabrication and characterization of chloride-derivatized polymer coatings prepared by continuous wave (cw) plasma polymerization as adhesion layers in DNA immobilization/hybridization. The stability of plasma-polymerized allyl chloride (ppAC) in H 2 O was characterized by variation of the thickness of polymer films and its wettability was examined by water contact angle technique. Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS) were used to study polymer matrix properties and oligonucleotide/DNA binding interaction. With the same carrier gas rate and process pressure, plasma polymers deposited at different input powers show various comparable immobilization properties; nevertheless, low input power plasma-polymerized films gives a lower sensitivity toward DNA binding than that from high input power plasma-deposited films. The following DNA immobilization on chloride-functionalized surfaces was found dependence on the macromolecular architecture of the plasma films. The hybridization between probe DNA and total mismatch target DNA shows no non-specific adsorption between target and ppAC

Application of Fourier transform infrared spectroscopy and orthogonal projections to latent structures/partial least squares regression for estimation of procyanidins average degree of polymerisation.

Science.gov (United States)

Passos, Cláudia P; Cardoso, Susana M; Barros, António S; Silva, Carlos M; Coimbra, Manuel A

2010-02-28

Fourier transform infrared (FTIR) spectroscopy has being emphasised as a widespread technique in the quick assess of food components. In this work, procyanidins were extracted with methanol and acetone/water from the seeds of white and red grape varieties. A fractionation by graded methanol/chloroform precipitations allowed to obtain 26 samples that were characterised using thiolysis as pre-treatment followed by HPLC-UV and MS detection. The average degree of polymerisation (DPn) of the procyanidins in the samples ranged from 2 to 11 flavan-3-ol residues. FTIR spectroscopy within the wavenumbers region of 1800-700 cm(-1) allowed to build a partial least squares (PLS1) regression model with 8 latent variables (LVs) for the estimation of the DPn, giving a RMSECV of 11.7%, with a R(2) of 0.91 and a RMSEP of 2.58. The application of orthogonal projection to latent structures (O-PLS1) clarifies the interpretation of the regression model vectors. Moreover, the O-PLS procedure has removed 88% of non-correlated variations with the DPn, allowing to relate the increase of the absorbance peaks at 1203 and 1099 cm(-1) with the increase of the DPn due to the higher proportion of substitutions in the aromatic ring of the polymerised procyanidin molecules. Copyright 2009 Elsevier B.V. All rights reserved.

Low Offset AC Correlator.

Science.gov (United States)

This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

AC power supply systems

International Nuclear Information System (INIS)

Law, H.

1987-01-01

An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

Microencapsulation of Eugenia uniflora L. juice by spray drying using fructans with different degrees of polymerisation.

Science.gov (United States)

Ortiz-Basurto, R I; Rubio-Ibarra, M E; Ragazzo-Sanchez, J A; Beristain, C I; Jiménez-Fernández, M

2017-11-01

The objective of this work was to microencapsulate pitanga (Eugenia uniflora L.) juice by spray drying, using High Performance Agave Fructans (HPAF) and High Degree of Polymerisation Agave Fructans (HDPAF) and maltodextrin (MD), respectively, as the wall materials. The physicochemical and antioxidant properties of the capsules during storage at various temperatures were evaluated. The microparticles developed using fructans HPAF and HDPAF, exhibited similar physicochemical and flow properties to those presented by the microparticles prepared with MD. The highest yield and concentration of anthocyanins after drying and during storage were found for a 1:6 core:wall material ratio. The total color change was a good indicator of the microcapsule stability. This study showed that both fructans fraction possess similar encapsulating properties to MD and that the HDPAF were more efficacious than MD at protecting the antioxidants during drying and storage. Copyright © 2017 Elsevier Ltd. All rights reserved.

ISTTOK plasma control with the tomography diagnostic

Energy Technology Data Exchange (ETDEWEB)

Fernandes, H.; Caralho, P.J.; Duarte, P.; Pereira, T.; Coelho, R.; Silva, C. [Association Euratom/IST, Institute of Plasmas and Nuclear Fusion, Technology Graduate Institute, P-1049-001 Lisbon (Portugal)

2011-07-01

A real-time plasma position control system is mandatory to achieve long duration (up to 250 ms), Alternating Current (AC) discharges on the ISTTOK tokamak. Such a system has been used for some time supported only on magnetic field diagnostic data. However, this system does not function accurately when the plasma current is low, rendering it inoperative during the plasma current reversal. A tomography diagnostic with 3 pinhole cameras and 8 silicone photodiode channels per camera was installed and customized to supply alternative plasma position to be used for plasma position control. As no filtering is applied, most of the radiation detected is in the visible/near-UV range. This system (i) executes a tomographic reconstruction, (ii) determines the average emissivity position from it, (iii) calculates the shift from the required position and (iv) supplies the vertical field power supply unit with the desired current value, all in less than 100 {mu}s. The horizontal magnetic field power supply unit is expected to be included in the system and will have no impact in the process time. This paper presents the tomography diagnostic architecture together with results of its scientific exploitation in ISTTOK AC discharges, where it has proven to be capable of supplying an accurate plasma position during the current reversal. The use of the tomography diagnostic for plasma position overcomes some limitations of the magnetic diagnostics, but poses challenges of its own such as blindness to plasma current direction. (authors)

ACS Photometric Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2003-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

The density and velocity of plasma bullets propagating along one dielectric tube

Directory of Open Access Journals (Sweden)

Longfei Ji

2015-08-01

Full Text Available This study shows that the propagation of plasma bullets along one dielectric tube is strongly affected by many discharge parameters, such as the waveform of applied voltage (AC or pulsed DC, peak voltage, He flow rate, and the frequency of AC voltage. Analysis indicates that the density and velocity of plasma bullets are mainly determined by the electric field at the front of plasma bullets. These discharge parameters may significantly influence the distribution of plasma potential along the tube, thus control the electric field at the front of plasma bullets and their propagation. An increase in the pulsed DC voltage with its rise time of <40-50 ns can lead to an obvious improvement in the electric field at the front of plasma bullets, resulting in generation of a plasma in the high density gas and a fast propagation of plasma bullets. He flowing through the tube can contribute to the surface diffusion of charged species, and greatly increase the electric field at the front of plasma bullets. During the propagation of plasma bullets, their density is decreased due to the surface recombination of charged species, such as electrons and ions.

Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge

Energy Technology Data Exchange (ETDEWEB)

Williamson, James M [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Trump, Darryl D [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Bletzinger, Peter [Innovative Scientific Solutions, Inc., 2766 Indian Ripple Road, Dayton, Ohio 45440-3638 (United States); Ganguly, Biswa N [Air Force Research Laboratory, Wright-Patterson Air Force Base, Ohio 45433-7919 (United States)

2006-10-21

A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s{sup -1}. The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of {approx}3 x 10{sup 15} cm{sup -3} at 25 W. The maximum ozone production achieved by short-pulse excitation was {approx}8.5 x 10{sup 15} cm{sup -3} at 20 W, which was four times greater than that achieved by ac excitation at the same power level.

Comparison of high-voltage ac and pulsed operation of a surface dielectric barrier discharge

International Nuclear Information System (INIS)

Williamson, James M; Trump, Darryl D; Bletzinger, Peter; Ganguly, Biswa N

2006-01-01

A surface dielectric barrier discharge (DBD) in atmospheric pressure air was excited either by low frequency (0.3-2 kHz) high-voltage ac or by short, high-voltage pulses at repetition rates from 50 to 600 pulses s -1 . The short-pulse excited discharge was more diffuse and did not have the pronounced bright multiple cathode spots observed in the ac excited discharge. The discharge voltage, current and average power deposited into the discharge were calculated for both types of excitation. As a measure of plasma-chemical efficiency, the ozone number density was measured by UV absorption as a function of average deposited power. The density of ozone produced by ac excitation did not increase so rapidly as that produced by short-pulse excitation as a function of average power, with a maximum measured density of ∼3 x 10 15 cm -3 at 25 W. The maximum ozone production achieved by short-pulse excitation was ∼8.5 x 10 15 cm -3 at 20 W, which was four times greater than that achieved by ac excitation at the same power level

FLUIDIC AC AMPLIFIERS.

Science.gov (United States)

Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

Investigation on discharge characteristics of a coaxial dielectric barrier discharge reactor driven by AC and ns power sources

Science.gov (United States)

Qian, WANG; Feng, LIU; Chuanrun, MIAO; Bing, YAN; Zhi, FANG

2018-03-01

A coaxial dielectric barrier discharge (DBD) reactor with double layer dielectric barriers has been developed for exhaust gas treatment and excited either by AC power or nanosecond (ns) pulse to generate atmospheric pressure plasma. The comparative study on the discharge characteristics of the discharge uniformity, power deposition, energy efficiency, and operation temperature between AC and ns pulsed coaxial DBD is carried out in terms of optical and electrical characteristics and operation temperature for optimizing the coaxial DBD reactor performance. The voltages across the air gap and dielectric layer and the conduction and displacement currents are extracted from the applied voltages and measured currents of AC and ns pulsed coaxial DBDs for the calculation of the power depositions and energy efficiencies through an equivalent electrical model. The discharge uniformity and operating temperature of the coaxial DBD reactor are monitored and analyzed by optical images and infrared camera. A heat conduction model is used to calculate the temperature of the internal quartz tube. It is found that the ns pulsed coaxial DBD has a much higher instantaneous power deposition in plasma, a lower total power consumption, and a higher energy efficiency compared with that excited by AC power and is more homogeneous and stable. The temperature of the outside wall of the AC and ns pulse excited coaxial DBD reaches 158 °C and 64.3 °C after 900 s operation, respectively. The experimental results on the comparison of the discharge characteristics of coaxial DBDs excited by different powers are significant for understanding of the mechanism of DBDs, reducing energy loss, and optimizing the performance of coaxial DBD in industrial applications.

78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

Science.gov (United States)

2013-08-13

...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

International Nuclear Information System (INIS)

Fang Minggang; Nie, Yingchao; Theilmann, David A.

2009-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

Development of a hardware-based AC microgrid for AC stability assessment

Science.gov (United States)

Swanson, Robert R.

As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

A comparative study of the physical properties of Sb{sub 2}S{sub 3} thin films treated with N{sub 2} AC plasma and thermal annealing in N{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Calixto-Rodriguez, M., E-mail: manuela@fis.unam.mx [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Martinez, H. [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Pena, Y. [Facultad de Ciencias Quimicas, Universidad Autonoma de Nuevo Leon, Pedro de Alba s/n, Cd. Universitaria, 66451, San Nicolas de los Garza, Nuevo Leon (Mexico); Flores, O. [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Esparza-Ponce, H.E. [Centro de Investigacion en Materiales Avanzados S.C., Laboratorio Nacional de Nanotecnologia, Miguel de Cervantes 120, Complejo Industrial Chihuahua, Chihuahua, Chihuahua 31109 (Mexico); Sanchez-Juarez, A.; Campos-Alvarez, J. [Centro de Investigacion en Energia, Universidad Nacional Autonoma de Mexico, Privada Xochicalco s/n, Col. Centro, 62580, Temixco, Morelos (Mexico); Reyes, P. [Facultad de Ciencias, Departamento de Fisica, Universidad Autonoma del Estado de Mexico, Instituto Literario 100, Col. Centro, 50000, Toluca, Estado de Mexico (Mexico)

2010-02-01

As-deposited antimony sulfide thin films prepared by chemical bath deposition were treated with nitrogen AC plasma and thermal annealing in nitrogen atmosphere. The as-deposited, plasma treated, and thermally annealed antimony sulfide thin films have been characterized by X-ray diffraction (XRD), energy dispersive X-ray spectroscopy, scanning electron microscopy, atomic force microscopy, UV-vis spectroscopy, and electrical measurements. The results have shown that post-deposition treatments modify the crystalline structure, the morphology, and the optoelectronic properties of Sb{sub 2}S{sub 3} thin films. X-ray diffraction studies showed that the crystallinity of the films was improved in both cases. Atomic force microscopy studies showed that the change in the film morphology depends on the post-deposition treatment used. Optical emission spectroscopy (OES) analysis revealed the plasma etching on the surface of the film, this fact was corroborated by the energy dispersive X-ray spectroscopy analysis. The optical band gap of the films (E{sub g}) decreased after post-deposition treatments (from 2.36 to 1.75 eV) due to the improvement in the grain sizes. The electrical resistivity of the Sb{sub 2}S{sub 3} thin films decreased from 10{sup 8} to 10{sup 6} {Omega}-cm after plasma treatments.

AC plasma induced modifications in Sb{sub 2}S{sub 3} thin films

Energy Technology Data Exchange (ETDEWEB)

Calixto-Rodriguez, M; Martinez, H [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Castillo, F [Instituto de Ciencias Nucleares, Universidad Nacional Autonoma de Mexico, Apartado Postal 70-543, 04510, Mexico D. F. (Mexico); Pena, Y [Universidad Autonoma de Nuevo Leon, Facultad de Ciencias Quimicas, Pedro de Alba s/n, Cd. Universitaria, San Nicolas de los Garza, N.L (Mexico); Sanchez-Juarez, A, E-mail: ciro@nucleares.unam.m [Centro de Investigacion en EnergIa, Universidad Nacional Autonoma de Mexico, Privada Xochicalco s/n Col. Centro, Temixco, Morelos, C.P. 62580 (Mexico)

2010-01-01

Sb{sub 2}S{sub 3} thin films, deposited by the chemical bath deposition method, were treated with N{sub 2} plasma at 3.0 Torr during several minutes. The as-prepared Sb{sub 2}S{sub 3} thin films and films treated with N{sub 2} plasma have been characterized using several techniques. X-ray diffraction studies have shown that plasma treatment induced recrystallization on the as-prepared Sb{sub 2}S{sub 3}thin films. The band gap values decreased from 2.37 to 1.82 eV after plasma treatment, and the electrical conductivity increased from 10{sup 9} to 10{sup 7} ({Omega}cm){sup -1} due to the annealing effect.

An experimental study of icing control using DBD plasma actuator

Science.gov (United States)

Cai, Jinsheng; Tian, Yongqiang; Meng, Xuanshi; Han, Xuzhao; Zhang, Duo; Hu, Haiyang

2017-08-01

Ice accretion on aircraft or wind turbine has been widely recognized as a big safety threat in the past decades. This study aims to develop a new approach for icing control using an AC-DBD plasma actuator. The experiments of icing control (i.e., anti-/de-icing) on a cylinder model were conducted in an icing wind tunnel with controlled wind speed (i.e., 15 m/s) and temperature (i.e., -10°C). A digital camera was used to record the dynamic processes of plasma anti-icing and de-icing whilst an infrared imaging system was utilized to map the surface temperature variations during the anti-/de-icing processes. It was found that the AC-DBD plasma actuator is very effective in both anti-icing and de-icing operations. While no ice formation was observed when the plasma actuator served as an anti-icing device, a complete removal of the ice layer with a thickness of 5 mm was achieved by activating the plasma actuator for ˜150 s. Such information demonstrated the feasibility of plasma anti-/de-icing, which could potentially provide more effective and safer icing mitigation strategies.

Integration issues of a plasma contactor Power Electronics Unit

Science.gov (United States)

Pinero, Luis R.; York, Kenneth W.; Bowers, Glen E.

1995-01-01

A hollow cathode-based plasma contactor is baselined on International Space Station Alpha (ISSA) for spacecraft charge control. The plasma contactor system consists of a hollow cathode assembly (HCA), a power electronics unit (PEU), and an expellant management unit (EMU). The plasma contactor has recently been required to operate in a cyclic mode to conserve xenon expellant and extend system life. Originally, a DC cathode heater converter was baselined for a continuous operation mode because only a few ignitions of the hollow cathode were expected. However, for cyclic operation, a DC heater supply can potentially result in hollow cathode heater component failure due to the DC electrostatic field. This can prevent the heater from attaining the proper cathode tip temperature for reliable ignition of the hollow cathode. To mitigate this problem, an AC cathode heater supply was therefore designed, fabricated, and installed into a modified PEU. The PEU was tested using resistive loads and then integrated with an engineering model hollow cathode to demonstrate stable steady-state operation. Integration issues such as the effect of line and load impedance on the output of the AC cathode heater supply and the characterization of the temperature profile of the heater under AC excitation were investigated.

Pilot Experience with an External Quality Assurance Scheme for Acylcarnitines in Plasma/Serum

NARCIS (Netherlands)

Sala, P Ruiz; Ruijter, G; Acquaviva, C; Chabli, A; de Sain-van der Velden, M G M; Garcia-Villoria, J; Heiner-Fokkema, M R; Jeannesson-Thivisol, E; Leckstrom, K; Franzson, L; Lynes, G; Olesen, J; Onkenhout, W; Petrou, P; Drousiotou, A; Ribes, A; Vianey-Saban, C; Merinero, B

2016-01-01

The analysis of acylcarnitines (AC) in plasma/serum is established as a useful test for the biochemical diagnosis and the monitoring of treatment of organic acidurias and fatty acid oxidation defects. External quality assurance (EQA) for qualitative and quantitative AC is offered by ERNDIM and CDC

The Plasma Discharge System For Effective Sterilization Of Water And Solid Surfaces

International Nuclear Information System (INIS)

Senturk, K.

2010-01-01

The different areas such as medicine, surgery, food production need efficient sterilization system since they are directly related to human health. In this work a new plasma system is described in order to present its effectiveness in sterilization. This is a different method from conventional methods such as: chemicals and heat addition, UV irradiation etc. The developed plasma system produces cold plasma working under atmospheric pressure. To generate the plasma both AC and DC high voltage power supplies were used. The developed system is cheap and very effective for sterilization. The light emission for both AC and DC coronas for the plasmas were investigated to understand the nature of generated plasma ionization. Different parameters like temperature, voltage, application time were changed during the plasma application and the optimization for killing the micro-organisms were investigated. To understand the biological effect of plasma on the organisms comparisons were done by using the scanning electron microscope and absorption spectrometer. The plasma was applied on the bacteria like Escherichia coli, Bacillus subtilis, Streptococcus mutans , the yeasts such as Candida albicans, and green algae. The efficiency, the non toxic nature, the affordable price make this plasma discharge method a very efficient one for sterilization.

Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

Science.gov (United States)

Luczak, Susan E; Rosen, I Gary

2014-08-01

Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

Electric field measurements on plasma bullets in N2 using four-wave mixing

NARCIS (Netherlands)

van der Schans, M.; Böhm, P.; Nijdam, S.; IJzerman, W.L.; Czarnetzki, U.

2015-01-01

Atmospheric pressure plasma jets driven by pulsed DC or kHz AC voltages typically consist of discrete guided ionisation waves called plasma bullets. In this work, the electric field of plasma bullets generated in a pulsed DC jet with N2 as feed gas is investigated. Electric field measurements in N2

RHIC spin flipper AC dipole controller

Energy Technology Data Exchange (ETDEWEB)

Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

2011-03-28

The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

Hazardous and Medical Waste Destruction Using the AC Plasmatron Final Report CRADA No. TC-1560-98

Energy Technology Data Exchange (ETDEWEB)

Caplan, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bucher, K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Tulupov, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

The goal of this project was to develop a prototype medical waste destruction facility based on the AC plasma torch capable of processing 150 kg of waste per hour while satisfying US EPA emission standards. The project was to provide the first opportunity for a joint U.S.-Russian project using an AC Plasma Torch in a hazardous waste destruction system to be assembled and operated in the U.S. thus promoting the commercialization in the U.S. of this joint U.S.-Russian developed technology. This project was a collaboration between the Russian Institute Soliton- NTT, the U.S industrial partner Scientific Utilization Inc. (SUI) and Lawrence Livermore National Laboratory ( LLNL). The project was funded by DOE for a total of $1.2 million with $600K for allocated for Phase I and $600K for Phase II. The Russian team received about $800K over the two (2) year period while LLNL received $400K. SUI was to provide in kind matching funds totaling $1.2 million.

A Control Method of Current Type Matrix Converter for Plasma Control Coil Power Supply

International Nuclear Information System (INIS)

Shimada, K.; Matsukawa, M.; Kurihara, K.; Jun-ichi Itoh

2006-01-01

In exploration to a tokamak fusion reactor, the control of plasma instabilities of high β plasma such as neoclassical tearing mode (NTM), resistive wall mode (RWM) etc., is the key issue for steady-state sustainment. One of the proposed methods to avoid suppressing RWM is that AC current having a phase to work for reduction the RWM growth is generated in a coil (sector coil) equipped spirally on the plasma vacuum vessel. To stabilize RWM, precise and fast real-time feedback control of magnetic field with proper amplitude and frequency is necessary. This implies that an appropriate power supply dedicated for such an application is expected to be developed. A matrix converter as one of power supply candidates for this purpose could provide a solution The matrix converter, categorized in an AC/AC direct converter composed of nine bi-directional current switches, has a great feature that a large energy storage element is unnecessary in comparison with a standard existing AC/AC indirect converter, which is composed of an AC/DC converter and a DC/AC inverter. It is also advantageous in cost and size of its applications. Fortunately, a voltage type matrix converter has come to be available at the market recently, while a current type matrix converter, which is advantageous for fast control of the large-inductance coil current, has been unavailable. On the background above mentioned, we proposed a new current type matrix converter and its control method applicable to a power supply with fast response for suppressing plasma instabilities. Since this converter is required with high accuracy control, the gate control method is adopted to three-phase switching method using middle phase to reduce voltage and current waveforms distortion. The control system is composed of VME-bus board with DSP (Digital Signal Processor) and FPGA (Field Programmable Gate Array) for high speed calculation and control. This paper describes the control method of a current type matrix converter

Postprandial changes in plasma acylcarnitine concentrations as markers of fatty acid flux in overweight and obesity.

Science.gov (United States)

Ramos-Roman, Maria A; Sweetman, Lawrence; Valdez, Maressa J; Parks, Elizabeth J

2012-02-01

This study determined whether reductions in postprandial plasma nonesterified fatty acid (FFA) flux would lead to reductions in plasma acylcarnitine (AC) concentrations. Plasma AC was measured by liquid chromatography with tandem mass spectrometry in the fasting state and over 6 hours after a high-fat (50% energy) meal was fed to 16 overweight and obese subjects with a wide range of insulin sensitivities. Body composition was measured by dual-energy x-ray absorptiometry; insulin sensitivity by insulin-modified, frequently sampled intravenous glucose tolerance test; substrate oxidation by indirect calorimetry; blood metabolite and hormone concentrations biochemically; and fatty acid flux by using stable isotope tracers. Lean body mass and fasting fat oxidation correlated positively (r > 0.522, P 0.515, P Conditions that impact fatty acid flux contribute to the control of postprandial plasma AC concentrations. These data underscore the need for a better understanding of postprandial fatty acid oxidation and dietary fat delivery in the setting of adipose insulin resistance to determine how postprandial lipemia contributes to chronic disease risk. Copyright © 2012 Elsevier Inc. All rights reserved.

The Acid/Base Surface Characterization of Sandstone, Limestone and Marble and its Effect upon the Polymerisation of Tetraethoxysilane

Directory of Open Access Journals (Sweden)

Elizabeth S. Goins

1994-11-01

Full Text Available The conservation of historically important stone buildings and monuments is a complicated field that crosses the boundaries of several different disciplines; in particular chemistry, geology, biology and materials science. It is a fact of nature that materials decay, and the role of the conservator is to delay this process for as long as possible. One way of approaching the problem is to place the object in a controlled environment. This is, however, clearly impossible in the case of large objects, and is expensive for smaller objects. The problem has become of increasing concern as decay mechanisms seem to have accelerated along with urban activity - primarily industrialisation and the burning of fossil fuels. This study focuses on a preliminary investigation of the acid/base nature of some building stones in order to determine their effect upon the polymerisation processes of an alkoxysilane system.

The AC photovoltaic module is here!

Science.gov (United States)

Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

1997-02-01

This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

Cd(II) and Zn(II) Complexes Containing N,N'-Bidentate N-(Pyridin-2-ylmethylene)cyclopentanamine: Synthesis, Characterisation and Methyl Methacrylate Polymerisation

Energy Technology Data Exchange (ETDEWEB)

Song, Yu Jin; Lee, Ha Jun; Lee, Hyo Sun [Kyungpook National University, Daeju (Korea, Republic of)

2014-09-15

The reaction between [CdBr{sub 2}·4H{sub 2}O] and anhydrous [ZnCl{sub 2}] with N,N'-bidentate N-(pyridin-2-ylmethylene)- cyclopentanamine (impy) in ethanol yields dimeric [(impy)Cd(μ-Br)Br]2 and monomeric [(impy)ZnCl{sub 2}] complexes, respectively. The X-ray crystal structure of Cd(II) and Zn(II) complexes revealed that the cadmium atom in [(impy)Cd(μ-Br)Br]2 and zinc in [(impy)ZnCl{sub 2}] formed a distorted trigonal–bipyramidal and tetrahedral geometry, respectively. Both complexes showed moderate catalytic activity for the polymerisation of methyl methacrylate (MMA) in the presence of modified methylaluminoxane (MMAO), with polymethylmethacrylate (PMMA) syndiotacticity of about 0.70.

Reduction of nitrogen oxides from simulated exhaust gas by using plasma-catalytic process

International Nuclear Information System (INIS)

Mok, Young Sun; Koh, Dong Jun; Shin, Dong Nam; Kim, Kyong Tae

2004-01-01

Removal of nitrogen oxides (NO x ) using a nonthermal plasma reactor (dielectric-packed bed reactor) combined with monolith V 2 O 5 /TiO 2 catalyst was investigated. The effect of initial NO x concentration, feed gas flow rate (space velocity), humidity, and reaction temperature on the removal of NO x was examined. The plasma reactor used can be energized by either ac or pulse voltage. An attempt was made to utilize the electrical ignition system of an internal combustion engine as a high-voltage pulse generator for the plasma reactor. When the plasma reactor was energized by the electrical ignition system, NO was readily oxidized to NO 2 . Performance was as good as with ac energization. Increasing the fraction of NO 2 in NO x , which is the main role of the plasma reactor, largely enhanced the NO x removal efficiency. In the plasma-catalytic reactor, the increases in initial NO x concentration, space velocity (feed gas flow rate) and humidity lowered the NO x removal efficiency. However, the reaction temperature in the range up to 473 K did not significantly affect the NO x removal efficiency in the presence of plasma discharge

Levitação acústica

OpenAIRE

Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

2015-01-01

A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

Pulsed nanocrystalline plasma electrolytic boriding as a novel ...

Indian Academy of Sciences (India)

WINTEC

borided CP-Ti, treated by a relatively new method called pulsed plasma electrolytic boriding. The results ... ratio, high stiffness and strength (Donachie 2000; Lutjer- ing and Albrecht ..... both direct current and a.c. techniques. Although the main ...

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

DEFF Research Database (Denmark)

Ljusev, Petar; Andersen, Michael Andreas E.

2004-01-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

Introduction to AC machine design

CERN Document Server

Lipo, Thomas A

2018-01-01

AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

A new method for measuring the wall charge waveforms of AC PDP

International Nuclear Information System (INIS)

Liang Zhihu; Liu Zujun; Liu Chunliang

2004-01-01

A new method is developed to measure the wall charge waveforms in coplanar alternating current plasma display panel (AC PDP). In the method, two groups of display electrodes are selected from a coplanar AC PDP and two capacitors are respectively connected with these two groups of display electrodes in series, and a measuring circuit and a reference circuit are thus constructed. With the help of special processing, discharge takes place in the cells included in the measuring circuit under a normal drive voltage but no discharge takes place in the cells included in the reference circuit under a normal drive voltage. The wall charge waveforms are obtained from the voltage difference between the two capacitors. Using the method, the wall charge waveforms are measured during resetting period, addressing period and sustaining period for the 304.8 mm (12-inch) test PDP panel. The result shows that the wall voltage is about 96 V during the sustaining period. (authors)

The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

International Nuclear Information System (INIS)

Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

2001-11-01

Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

International Nuclear Information System (INIS)

McCarthy, Christina B.; Theilmann, David A.

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

Energy Technology Data Exchange (ETDEWEB)

Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

2008-07-01

Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

Science.gov (United States)

Abbas, Qamar; Béguin, François

2016-06-01

We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

Effects of Linear Falling Ramp Reset Pulse on Addressing Operation in AC PDP

International Nuclear Information System (INIS)

Liu Zujun; Liang Zhihu; Liu Chunliang; Meng Lingguo

2006-01-01

The effects of linear falling ramp reset pulse related to addressing operation in an alternating current plasma display panel (AC PDP) were studied. The wall charge waveforms were measured by the electrode balance method in a 12-inch coplanar AC PDP. The wall charge waveforms show the relationship between the slope ratio of the falling ramp reset pulse and the wall charges at the end of the falling ramp reset pulse which influences the addressing stability. Then the effects of the slope ratio of the linear falling ramp reset pulse on the addressing voltage and addressing time were investigated. The experimental results show that the minimum addressing voltage increases with the increase of the slope ratio of the falling ramp reset pulse, and so does the minimum addressing time. Based on the experimental results, the optimization of the addressing time and the slope ratio of the falling ramp pulse is discussed

AcEST: DK954361 [AcEST

Lifescience Database Archive (English)

Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

21 CFR 886.4440 - AC-powered magnet.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

Comparison of Omadacycline and Tigecycline Pharmacokinetics in the Plasma, Epithelial Lining Fluid, and Alveolar Cells of Healthy Adult Subjects.

Science.gov (United States)

Gotfried, Mark H; Horn, Karolyn; Garrity-Ryan, Lynne; Villano, Stephen; Tzanis, Evan; Chitra, Surya; Manley, Amy; Tanaka, S Ken; Rodvold, Keith A

2017-09-01

The steady-state concentrations of omadacycline and tigecycline in the plasma, epithelial lining fluid (ELF), and alveolar cells (AC) of 58 healthy adult subjects were obtained. Subjects were administered either omadacycline at 100 mg intravenously (i.v.) every 12 h for two doses followed by 100 mg i.v. every 24 h for three doses or tigecycline at an initial dose of 100 mg i.v. followed by 50 mg i.v. every 12 h for six doses. A bronchoscopy and bronchoalveolar lavage were performed once in each subject following the start of the fifth dose of omadacycline at 0.5, 1, 2, 4, 8, 12, or 24 h and after the start of the seventh dose of tigecycline at 2, 4, 6, or 12 h. The value of the area under the concentration-time curve (AUC) from time zero to 24 h postdosing (AUC 0-24 ) (based on mean concentrations) in ELF and the ratio of the ELF to total plasma omadacycline concentration based on AUC 0-24 values were 17.23 mg · h/liter and 1.47, respectively. The AUC 0-24 value in AC was 302.46 mg · h/liter, and the ratio of the AC to total plasma omadacycline concentration was 25.8. In comparison, the values of the AUC from time zero to 12 h postdosing (AUC 0-12 ) based on the mean concentrations of tigecycline in ELF and AC were 3.16 and 38.50 mg · h/liter, respectively. The ratio of the ELF and AC to total plasma concentrations of tigecycline based on AUC 0-12 values were 1.71 and 20.8, respectively. The pharmacokinetic advantages of higher and sustained concentrations of omadacycline compared to those of tigecycline in plasma, ELF, and AC suggest that omadacycline is a promising antibacterial agent for the treatment of lower respiratory tract bacterial infections caused by susceptible pathogens. Copyright © 2017 Gotfried et al.

The KAC family of kinesin-like proteins is essential for the association of chloroplasts with the plasma membrane in land plants.

Science.gov (United States)

Suetsugu, Noriyuki; Sato, Yoshikatsu; Tsuboi, Hidenori; Kasahara, Masahiro; Imaizumi, Takato; Kagawa, Takatoshi; Hiwatashi, Yuji; Hasebe, Mitsuyasu; Wada, Masamitsu

2012-11-01

Chloroplasts require association with the plasma membrane for movement in response to light and for appropriate positioning within the cell to capture photosynthetic light efficiently. In Arabidopsis, CHLOROPLAST UNUSUAL POSITIONING 1 (CHUP1), KINESIN-LIKE PROTEIN FOR ACTIN-BASED CHLOROPLAST MOVEMENT 1 (KAC1) and KAC2 are required for both the proper movement of chloroplasts and the association of chloroplasts with the plasma membrane, through the reorganization of short actin filaments located on the periphery of the chloroplasts. Here, we show that KAC and CHUP1 orthologs (AcKAC1, AcCHUP1A and AcCHUP1B, and PpKAC1 and PpKAC2) play important roles in chloroplast positioning in the fern Adiantum capillus-veneris and the moss Physcomitrella patens. The knockdown of AcKAC1 and two AcCHUP1 genes induced the aggregation of chloroplasts around the nucleus. Analyses of A. capillus-veneris mutants containing perinuclear-aggregated chloroplasts confirmed that AcKAC1 is required for chloroplast-plasma membrane association. In addition, P. patens lines in which two KAC genes had been knocked out showed an aggregated chloroplast phenotype similar to that of the fern kac1 mutants. These results indicate that chloroplast positioning and movement are mediated through the activities of KAC and CHUP1 proteins, which are conserved in land plants.

Influence of Arm-cranking on Changes in Plasma CK Activity after High Force Eccentric Exercise of the Elbow Flexors

OpenAIRE

Kazunori, NOSAKA; Kei, SAKAMOTO; Mike, NEWTON; Exercise and Sports Science, Graduate School of Integrated Science, Yokohama City University:School of Biomedical and Sports Science, Edith Cowan University; Exercise and Sports Science, Graduate School of Integrated Science, Yokohama City University; School of Biomedical and Sports Science, Edith Cowan University

2002-01-01

It was hypothesized that the time course of changes in plasma creatine kinase (CK) activity following eccentric exercise was influenced by rhythmical muscle contractions performed after eccentric exercise. This study examined whether arm-cranking (AC) alters the time course of changes in plasma creatine kinase (CK) activity after eccentric exercise of the elbow flexors (ECC). Six male students performed two bouts of ECC separated by 3 weeks, and AC (25watts, 2-hours) was performed immediately...

The PLAC1-homology region of the ZP domain is sufficient for protein polymerisation

Directory of Open Access Journals (Sweden)

Litscher Eveline S

2006-04-01

Full Text Available Abstract Background Hundreds of extracellular proteins polymerise into filaments and matrices by using zona pellucida (ZP domains. ZP domain proteins perform highly diverse functions, ranging from structural to receptorial, and mutations in their genes are responsible for a number of severe human diseases. Recently, PLAC1, Oosp1-3, Papillote and CG16798 proteins were identified that share sequence homology with the N-terminal half of the ZP domain (ZP-N, but not with its C-terminal half (ZP-C. The functional significance of this partial conservation is unknown. Results By exploiting a highly engineered bacterial strain, we expressed in soluble form the PLAC1-homology region of mammalian sperm receptor ZP3 as a fusion to maltose binding protein. Mass spectrometry showed that the 4 conserved Cys residues within the ZP-N moiety of the fusion protein adopt the same disulfide bond connectivity as in full-length native ZP3, indicating that it is correctly folded, and electron microscopy and biochemical analyses revealed that it assembles into filaments. Conclusion These findings provide a function for PLAC1-like proteins and, by showing that ZP-N is a biologically active folding unit, prompt a re-evaluation of the architecture of the ZP domain and its polymers. Furthermore, they suggest that ZP-C might play a regulatory role in the assembly of ZP domain protein complexes.

Simultaneous distribution of AC and DC power

Science.gov (United States)

Polese, Luigi Gentile

2015-09-15

A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

Directory of Open Access Journals (Sweden)

LISTYA UTAMI KARMAWAN

2009-03-01

Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

Universality of ac conduction in disordered solids

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2000-01-01

The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

Oblique propagating electromagnetic ion - Cyclotron instability with A.C. field in outer magnetosphere

Science.gov (United States)

Pandey, R. S.; Singh, Vikrant; Rani, Anju; Varughese, George; Singh, K. M.

2018-05-01

In the present paper Oblique propagating electromagnetic ion-cyclotron wave has been analyzed for anisotropic multi ion plasma (H+, He+, O+ ions) in earth magnetosphere for the Dione shell of L=7 i.e., the outer radiation belt of the magnetosphere for Loss-cone distribution function with a spectral index j in the presence of A.C. electric field. Detail for particle trajectories and dispersion relation has been derived by using the method of characteristic solution on the basis of wave particle interaction and transformation of energy. Results for the growth rate have been calculated numerically for various parameters and have been compared for different ions present in magnetosphere. It has been found that for studying the wave over wider spectrum, anisotropy for different values of j should be taken. The effect of frequency of A.C. electric field and angle which propagation vector make with magnetic field, on growth rate has been explained.

Radiation Polymerization of Acetylene Hydrocarbons. Special Features; Particularites de la polymerisation radiochimique des hydrocarbures acetyleniques; Radiatsionnaya polimerizatsiya atsetilenovykh proizvodnykh; Particularidades de la radiopolimerizacion de los hidrocarburos acetilenicos

Energy Technology Data Exchange (ETDEWEB)

Barkalov, I. M.; Gol' danskij, V. I.; Go, Min' -Gao

1963-11-15

benzene radical. The pronounced deviations from the additivity rule in the case of radiation polymerization in different solvents indicate a large energy transfer to acetylene hydrocarbons and their polymers. (author) [French] La synthese des polymeres a systeme reticule et l'etude de leurs proprietes constituent une branche nouvelle et tres riche en promesses de la chimie des composes a poids moleculaire eleve. Les polymeres de ce type sont caracterises par un haut degre de deplacement des electrons p dans la macromolecule. La reduction de l'energie d'excitation jusqu'a formation de la triple liaison et la diminution du potentiel d'ionisation en presence de longues chafhes de reticulation sont a l'origine des proprietes semi-conductrices et des particularites magnetiques specifiques de ces composes. En outre, ces systemes reticules se sont reveles tres efficaces comme stabilisateurs contre la destruction des polymeres par thermo-oxydation et photo-oxydation. Une methode pratique pour obtenir des polymeres de ce genre est fournie par la polymerisation radiochimique des derives de l'acetylene. Elle seule permet d'obtenir, a basse temperature, des polymeres libres de toute impurete due aux initiateurs. La cinetique de la polymerisation radiochimique du phenylacetylene et d'autres derives de l'acetylene presente une serie de traits qui sont caracteristiques de la polymerisation ionique mais tout a fait inhabituels pour la polymerisation par radicaux (vitesse de polymerisation preportionnelle a la vitesse d'amorcage; energie d'activation tres faible; absence d'inhibition par l'oxygene). Neanmoins, cette polymerisation semble etre due a l'action des radicaux. Les auteurs sont parvenus a cene conclusion, en etudiant l'amorcage de la polymerisation des hydrocarbures acetyleniques par des initiateurs ayant le caractere typique d'un radical, tel que le peroxyde de benzoide et le dinitryle de l'acide azo-i-butyrique. A ce propos, ils ont examine les particularites de la cinetique

Fabrication of All Glass Bifurcation Microfluidic Chip for Blood Plasma Separation

Directory of Open Access Journals (Sweden)

Hyungjun Jang

2017-02-01

Full Text Available An all-glass bifurcation microfluidic chip for blood plasma separation was fabricated by a cost-effective glass molding process using an amorphous carbon (AC mold, which in turn was fabricated by the carbonization of a replicated furan precursor. To compensate for the shrinkage during AC mold fabrication, an enlarged photoresist pattern master was designed, and an AC mold with a dimensional error of 2.9% was achieved; the dimensional error of the master pattern was 1.6%. In the glass molding process, a glass microchannel plate with negligible shape errors (~1.5% compared to AC mold was replicated. Finally, an all-glass bifurcation microfluidic chip was realized by micro drilling and thermal fusion bonding processes. A separation efficiency of 74% was obtained using the fabricated all-glass bifurcation microfluidic chip.

Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

Science.gov (United States)

Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

2012-01-01

The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

Dielectric Strontium Zirconate Sprayed by a Plasma Torch.

Czech Academy of Sciences Publication Activity Database

Ctibor, Pavel; Sedláček, J.; Janata, Marek

2017-01-01

Roč. 10, č. 4 (2017), s. 225-230 ISSN 2008-2134 Institutional support: RVO:61389021 Keywords : Plasma spraying * Electrical properties * Strontium Zirconate * Insulators Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics www.pccc.icrc.ac.ir/Articles/18/1/18/1010/

AcMNPV

African Journals Online (AJOL)

USER

2010-08-16

Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

Activity of adenylate cyclase in plasma membranes of pulmonary tissue remote times following nonlethal gamma-irradiation of rats

International Nuclear Information System (INIS)

Slozhenkina, L.V.; Ruda, V.P.; Ushakova, T.E.; Kuzin, A.M.

1990-01-01

Basal and stimulated activity of adenylate cyclase (cyclizing ATP-pyrophosphate lyase, E.C. 4.6.1.1., AC) in plasma membranes of pumonary tissye was being studied during a year after fractionated irradiation of rats (2 Gyx3). Basal and hormone-stimulated activity of AC was shown to vary significantly from normal 6 and 12 months after irradiation. The exposed membranes responded differently to AC activation by isoproterenol and F -

Modeling and reliability analysis of three phase z-source AC-AC converter

Directory of Open Access Journals (Sweden)

Prasad Hanuman

2017-12-01

Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

Surface DBD for deposition of the PEO-like plasma polymers

Czech Academy of Sciences Publication Activity Database

Gordeev, Ivan; Šimek, Milan; Prukner, Václav; Choukourov, A.; Biederman, H.

2012-01-01

Roč. 9, č. 1 (2012), s. 83-89 ISSN 1612-8850 R&D Projects: GA ČR(CZ) GD104/09/H080 Institutional research plan: CEZ:AV0Z20430508 Keywords : AC barrier discharges * surface discharges * plasma polymers * poly(ethylene oxide) (PEO) * UV-vis spectroscopy Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.730, year: 2012 http://onlinelibrary.wiley.com/doi/10.1002/ppap.201100051/pdf

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

Proportional-Integral-Resonant AC Current Controller

Directory of Open Access Journals (Sweden)

STOJIC, D.

2017-02-01

Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

A Heavy Metal-Associated Protein (AcHMA1 from the Halophyte, Atriplex canescens (Pursh Nutt., Confers Tolerance to Iron and Other Abiotic Stresses When Expressed in Saccharomyces cerevisiae

Directory of Open Access Journals (Sweden)

Xin-Hua Sun

2014-08-01

Full Text Available Many heavy metals are essential for metabolic processes, but are toxic at elevated levels. Metal tolerance proteins provide resistance to this toxicity. In this study, we identified and characterized a heavy metal-associated protein, AcHMA1, from the halophyte, Atriplex canescens. Sequence analysis has revealed that AcHMA1 contains two heavy metal binding domains. Treatments with metals (Fe, Cu, Ni, Cd or Pb, PEG6000 and NaHCO3 highly induced AcHMA1 expression in A. canescens, whereas NaCl and low temperature decreased its expression. The role of AcHMA1 in metal stress tolerance was examined using a yeast expression system. Expression of the AcHMA1 gene significantly increased the ability of yeast cells to adapt to and recover from exposure to excess iron. AcHMA1 expression also provided salt, alkaline, osmotic and oxidant stress tolerance in yeast cells. Finally, subcellular localization of an AcHMA1/GFP fusion protein expressed in tobacco cells showed that AcHMA1 was localized in the plasma membrane. Thus, our results suggest that AcHMA1 encodes a membrane-localized metal tolerance protein that mediates the detoxification of iron in eukaryotes. Furthermore, AcHMA1 also participates in the response to abiotic stress.

Experimental investigations on characteristics of boundary layer and control of transition on an airfoil by AC-DBD

Science.gov (United States)

Geng, Xi; Shi, Zhiwei; Cheng, Keming; Dong, Hao; Zhao, Qun; Chen, Sinuo

2018-03-01

Plasma-based flow control is one of the most promising techniques for aerodynamic problems, such as delaying the boundary layer transition. The boundary layer’s characteristics induced by AC-DBD plasma actuators and applied by the actuators to delay the boundary layer transition on airfoil at Ma = 0.3 were experimentally investigated. The PIV measurement was used to study the boundary layer’s characteristics induced by the plasma actuators. The measurement plane, which was parallel to the surface of the actuators and 1 mm above the surface, was involved in the test, including the perpendicular plane. The instantaneous results showed that the induced flow field consisted of many small size unsteady vortices which were eliminated by the time average. The subsequent oil-film interferometry skin friction measurement was conducted on a NASA SC(2)-0712 airfoil at Ma = 0.3. The coefficient of skin friction demonstrates that the plasma actuators successfully delay the boundary layer transition and the efficiency is better at higher driven voltage.

High-performance modeling of plasma-based acceleration and laser-plasma interactions

Science.gov (United States)

Vay, Jean-Luc; Blaclard, Guillaume; Godfrey, Brendan; Kirchen, Manuel; Lee, Patrick; Lehe, Remi; Lobet, Mathieu; Vincenti, Henri

2016-10-01

Large-scale numerical simulations are essential to the design of plasma-based accelerators and laser-plasma interations for ultra-high intensity (UHI) physics. The electromagnetic Particle-In-Cell (PIC) approach is the method of choice for self-consistent simulations, as it is based on first principles, and captures all kinetic effects, and also scale favorably to many cores on supercomputers. The standard PIC algorithm relies on second-order finite-difference discretization of the Maxwell and Newton-Lorentz equations. We present here novel formulations, based on very high-order pseudo-spectral Maxwell solvers, which enable near-total elimination of the numerical Cherenkov instability and increased accuracy over the standard PIC method for standard laboratory frame and Lorentz boosted frame simulations. We also present the latest implementations in the PIC modules Warp-PICSAR and FBPIC on the Intel Xeon Phi and GPU architectures. Examples of applications will be given on the simulation of laser-plasma accelerators and high-harmonic generation with plasma mirrors. Work supported by US-DOE Contracts DE-AC02-05CH11231 and by the European Commission through the Marie Slowdoska-Curie fellowship PICSSAR Grant Number 624543. Used resources of NERSC.

Low ac loss geometries in YBCO coated conductors

International Nuclear Information System (INIS)

Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

Low ac loss geometries in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

2007-10-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.

2012-06-01

AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

Science.gov (United States)

Han, Xiaomin; Li, Guojing; Zhang, Shuqun

2017-01-01

Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

Novel polymer coatings based on plasma polymerized 2-methoxyethyl acrylate

DEFF Research Database (Denmark)

Wu, Zhenning; Jiang, Juan; Benter, Maike

2008-01-01

plasma system[4]. The system named SoftPlasma™ is equipped with unique three-phase pulsed AC voltage. Low energy plasma polymerization has almost no thermal load for sensitive polymer materials[5]. Plasma polymerized coatings are highly cross-linked, pin-hole free and provide hydrophilic or hydrophobic...... properties[4-6]. We have exploited these possibilities and prepared plasma polymerized 2-methoxyethyl acrylate (PPMEA) coatings on various polymer substrates. The PPMEA coatings were optimized using various plasma polymerization conditions and characterized by X-ray photoelectron spectroscopy......, Fouriertransform infrared spectroscopy, Atomic force spectroscopy and Water contact-angle measurements. The microstructures ofPPMEA coatings with different thicknesses were also studied. For practical applications in mind, the coating stability was tested in different media (air, water, acetone, phosphate...

Water Treatment Using Plasma Discharge with Variation of Electrode Materials

Science.gov (United States)

Chanan, N.; Kusumandari; Saraswati, T. E.

2018-03-01

This research studied water treatment using plasma discharge. Plasma generated in this study produced active species that played a role in organic compound decomposition. The plasma reactor consisted of two needle electrodes made from stainless steel, tungsten, aluminium and grafit. It placed approximately 2 mm above the solution and connected with high-AC voltage. A solution of methylene blue used as an organic solution model. Plasma treatment times were 2, 4, 6, 8 and 10 min. The absorbance, temperature and pH of the solution were measured before and after treatment using various electrodes. The best electrode used in plasma discharging for methylene blue absorbance reduction was the graphite electrode, which provided the highest degradation efficiency of 98% at 6 min of treatment time.

Instabilities, turbulence and transport in a magnetized plasma; Instabilites, turbulence et transport dans un plasma magnetise

Energy Technology Data Exchange (ETDEWEB)

Garbet, X

2001-06-01

The purpose of this work is to introduce the main processes that occur in a magnetized plasma. During the last 2 decades, the understanding of turbulence has made great progress but analytical formulas and simulations are far to produce reliable predictions. The values of transport coefficients in a tokamak plasma exceed by far those predicted by the theory of collisional transport. This phenomenon is called abnormal transport and might be due to plasma fluctuations. An estimation of turbulent fluxes derived from the levels of fluctuations, is proposed. A flow description of plasma allows the understanding of most micro-instabilities. The ballooning representation deals with instabilities in a toric geometry. 3 factors play an important role to stabilize plasmas: density pinch, magnetic shear and speed shear. The flow model of plasma gives an erroneous value for the stability threshold, this is due to a bad description of the resonant interaction between wave and particle. As for dynamics, flow models can be improved by adding dissipative terms so that the linear response nears the kinetic response. The kinetic approach is more accurate but is complex because of the great number of dimensions involved. (A.C.)

RNA interference suppression of mucin 5AC (MUC5AC reduces the adhesive and invasive capacity of human pancreatic cancer cells

Directory of Open Access Journals (Sweden)

Yamada Nobuya

2010-05-01

Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.

Release patterns of pregnancy-associated plasma protein A in patients with acute coronary syndromes assessed by an optimized monoclonal antibody assay

DEFF Research Database (Denmark)

Schoos, Mikkel; Iversen, Kasper; Teisner, Ane

2008-01-01

Objective. Pregnancy-associated plasma protein A (PAPP-A) is expressed in eroded and ruptured atheromatous plaques, and circulating levels are elevated in acute coronary syndromes (ACS). Our objective was to investigate release patterns of PAPP-A in ACS and whether they differ among different typ...

Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.

Science.gov (United States)

Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo

2016-09-01

Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged

Hopping models and ac universality

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2002-01-01

Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

Multi-physics modeling of plasma-material interactions

Science.gov (United States)

Lasa, Ane; Green, David; Canik, John; Younkin, Timothy; Blondel, Sophie; Wirth, Brian; Drobny, Jon; Curreli, Davide

2017-10-01

Plasma-material interactions (PMI) can degrade both plasma and material properties. Often, PMI modeling focuses on either the plasma or surface. Here, we present an integrated model with high-fidelity codes coupled within the IPS framework that self-consistently addresses PMI. The model includes, calculation of spatially resolved influx of plasma and impurities to the surface and their implantation; surface erosion and roughening; evolution of implanted species and sub-surface composition; and transport of eroded particles across the plasma and their re-deposition. The model is applied and successfully compared to dedicated PISCES linear device experiments, where a tungsten (W) target was exposed to helium (He) plasma. The present contribution will focus on the analysis of W erosion, He retention and sub-surface gas bubble and surface composition evolution, under the different He plasma conditions across the surface that are calculated by impurity transport modeling. Impact of code coupling, reflected as interplay between surface erosion, fuel / impurity implantation and retention, and evolution of target composition, as well as sensitivity of these processes to plasma exposure conditions is also analyzed in detail. This work is supported by the US DOE under contract DE-AC05-00OR22725.

Conversion of methane to methanol in an ac dielectric barrier discharge

International Nuclear Information System (INIS)

Aghamir, F M; Matin, N S; Jalili, A H; Esfarayeni, M H; Khodagholi, M A; Ahmadi, R

2004-01-01

A dielectric barrier discharge (DBD) has been used to investigate the conversion of methane to methanol and higher hydrocarbons in ac non-equilibrium plasmas. Experiments were carried out at atmospheric pressure and ambient temperature. A non-equilibrium plasma was generated in a DBD reactor by applying a high voltage to the reactor electrodes. Activation of methane molecules led to the production of C 2 hydrocarbons and methanol. The effect of the applied voltage, residence time and feed mixture such as helium and oxygen on the methane conversion and product selectivity was studied. Helium appears to have no effect on the conversion and selectivity at our applied voltages. The methane conversion increases significantly on introduction of oxygen in the feed stream. Inclusion of oxygen leads to the formation of methanol. Our results show that production of methanol is initiated around an applied voltage of 12 kV and the conversion of methane increases with increasing voltage and residence time, while the product selectivity is independent of the applied voltage

Transport AC losses in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

2007-09-15

Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

Molecularly imprinted microspheres and nanoparticles prepared using precipitation polymerisation method for selective extraction of gallic acid from Emblica officinalis.

Science.gov (United States)

Pardeshi, Sushma; Dhodapkar, Rita; Kumar, Anupama

2014-03-01

This paper reports the preparation of gallic acid (GA) molecularly imprinted polymers (MIPs) by the precipitation polymerisation and highlights the effect of porogen on particle size and specific molecular recognition properties. MIP, M-100 prepared in the porogen acetonitrile and MIP, M-75 prepared in a mixture of acetonitrile-toluene (75:25 v/v), resulted in the formation of microspheres with approximately 4μm particle size and surface area of 96.73m(2)g(-1) and nanoparticles (0.8-1000nm) and a surface area of 345.9m(2)g(-1), respectively. The Langmuir-Freundlich isotherm study revealed that M-75 has comparatively higher number of binding sites which are homogenous and has higher affinity for GA. The MIPs selectively recognised GA in presence of its structural analogues. Pure GA with percent recovery of 75 (±1.6) and 83.4 (±2.2) was obtained from the aqueous extract of Emblica officinalis by M-100 and M-75, respectively and hot water at 60°C served as the eluting solvent. Copyright © 2013 Elsevier Ltd. All rights reserved.

Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

Directory of Open Access Journals (Sweden)

Pijar Riza Anugerah

2015-10-01

Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

Plasma theory and simulation. Quarterly progress report I, II, January 1-June 30, 1984

International Nuclear Information System (INIS)

Birdsall, C.K.

1984-01-01

Our group uses theory and simulation as tools in order to increase the understanding of instabilities, heating, transport, and other phenomena in plasmas. We also work on the improvement of simulation both theoretically and practically. Research in plasma theory and simulation has centered on the following: (1) electron Bernstein wave investigations; (2) simulation of plasma-sheath region, including ion reflection; (3) single ended plasma device, general behavior dc or ac; (4) single ended plasma device, unstable states; (5) corrections to time-independent Q-machine equilibria; (6) multifluid derivation of the Alfven ion-cyclotron linear dispersion relation; and (7) potential barrier between hot and cool plasmas

The effect of an alternating electric field on a totally ionised plasma; Action d'un champ electrique alternatif sur un plasma totalement ionise

Energy Technology Data Exchange (ETDEWEB)

Baglin, H; Brin, A; Ozias, Y; Salmon, J [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires; Delcroix, J L [Ecole Normale Superieure, 75 - Paris (France)

1960-07-01

The equation giving the distribution function of the electrons in a steady-state, for a fully ionized plasma in an a.c. field, are provided from the Fokker-Planck equation. The electric conductivity is complex and depends on the frequency. (author) [French] L'equation qui donne la fonction de distribution des electrons dans un etat stationnaire pour un plasma totalement ionise dans un champ electrique alternatif est fournie par l'equation de Fokker-Planck. La conductibilite electrique est complexe et depend de la frequence. (auteur)

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

THERMIONIC AC GENERATION

Science.gov (United States)

is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

21 CFR 880.6320 - AC-powered medical examination light.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

Ac-dc converter firing error detection

International Nuclear Information System (INIS)

Gould, O.L.

1996-01-01

Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

Engineering Design of the ITER AC/DC Power Supplies

International Nuclear Information System (INIS)

Oh, B. H.; Lee, K. W.; Hwang, C. K.; Jin, J. T.; Chang, D. S.; Kim, T. S.

2009-02-01

To design high power pulse power supplies, especially in huge power supplies have not designed till now, it is necessary to analyze a system's characteristics and relations with another systems as well as to know high voltage, high current control technologies. Contents of this project are; - Study for the engineering designs changed recently by ITER Organization(IO) and writing specifications for the power supplies to reduce project risk. - Detailed analysis of the AC/DC Converters and writing subtask reports on the Task Agreement. - Study for thyristor numbers, DCR's specifications for Korea-China sharing meetings. - Study for the grounding systems of the ITER power supply system. The results may used as one of reference for practical designs of the high power coil power supplies and also may used in various field such as electroplating, plasma arc furnaces, electric furnaces

Assessment of sperm quality, oxidative stress injury as well as ACP, AC and PDE expression in patients with oligoasthenozoospermia before and after qilin pill treatment

Directory of Open Access Journals (Sweden)

Shi-Jun Zhang

2016-09-01

Full Text Available Objective: To analyze the sperm quality, oxidative stress injury as well as ACP, AC and PDE expression in patients with oligoasthenozoospermia before and after qilin pill treatment. Methods: A total of 60 patients with oligoasthenozoospermia were randomly divided into observation group and control group, control group received routine western medicine treatment, observation group received qilin pill + conventional western medicine treatment, and then differences in sperm quality, oxidative stress injury, ACP, AC and PDE expression, etc. were compared between two groups after treatment. Results: Semen volume and sperm density in semen samples of observation group after qilin pill treatment were higher than those of control group; serum FSH and LH levels were lower than those of control group, and the T level was higher than that of control group; ROS and MDA levels in seminal plasma were lower than those of control group, and SOD level was higher than that of control group; ACP, AC, α-Glu and Fru levels in seminal plasma were higher than those of control group, and PDE level was lower than that of control group. Conclusion: Qilin pill can improve sperm quality and optimize testicular internal environment in patients with oligoasthenozoospermia, and it has positive clinical significance.

Optimisation of Surface-Initiated Photoiniferter-Mediated Polymerisation under Confinement, and the Formation of Block Copolymers in Mesoporous Films

Directory of Open Access Journals (Sweden)

Jessica C. Tom

2017-10-01

Full Text Available Nature as the ultimate inspiration can direct, gate, and selectively transport species across channels to fulfil a specific targeted function. Harnessing such precision over local structure and functionality at the nanoscale is expected to lead to indispensable developments in synthetic channels for application in catalysis, filtration and sensing, and in drug delivery. By combining mesoporous materials with localised charge-switchable poly(2-(dimethylaminoethyl methacrylate (PDMAEMA brushes, precisely controlling pore filling and exploring the possibility of incorporating two different responsive polymers, we hope to approach the precision control of natural systems in the absence of an external force. Here, we report a simple one-step approach to prepare a mesoporous silica thin film with ~8 nm pores functionalised with a photoiniferter by combining sol–gel chemistry and evaporation-induced self-assembly (EISA. We show that surface-initiated photoiniferter-mediated polymerisation (SI-PIMP allows the incorporation of a high polymer content up to geometrical pore blocking by the simple application of UV light in the presence of a monomer and solvent, proceeding in a controlled manner in pore sizes below 10 nm, with the potential to tune the material properties through the formation of surface-grafted block copolymers.

The Material Plasma Exposure eXperiment (MPEX)

Science.gov (United States)

Rapp, J.; Biewer, T. M.; Bigelow, T. S.; Canik, J.; Caughman, J. B. O.; Duckworth, R. C.; Goulding, R. H.; Hillis, D. L.; Lore, J. D.; Lumsdaine, A.; McGinnis, W. D.; Meitner, S. J.; Owen, L. W.; Shaw, G. C.; Luo, G.-N.

2014-10-01

Next generation plasma generators have to be able to access the plasma conditions expected on the divertor targets in ITER and future devices. The Material Plasma Exposure eXperiment (MPEX) will address this regime with electron temperatures of 1--10 eV and electron densities of 1021--1020 m-3. The resulting heat fluxes are about 10 MW/m2. MPEX is designed to deliver those plasma conditions with a novel Radio Frequency plasma source able to produce high density plasmas and heat electron and ions separately with Electron Bernstein Wave (EBW) heating and Ion Cyclotron Resonance Heating (ICRH). Preliminary modeling has been used for pre-design studies of MPEX. MPEX will be capable to expose neutron irradiated samples. In this concept targets will be irradiated in ORNL's High Flux Isotope Reactor (HFIR) or possibly at the Spallation Neutron Source (SNS) and then subsequently (after a sufficient long cool-down period) exposed to fusion reactor relevant plasmas in MPEX. The current state of the pre-design of MPEX including the concept of handling irradiated samples will be presented. ORNL is managed by UT-Battelle, LLC, for the U.S. DOE under Contract DE-AC-05-00OR22725.

Durable anti-fogging effect and adhesion improvement on polymer surfaces

Science.gov (United States)

Moser, E. M.; Gilliéron, D.; Henrion, G.

2010-01-01

The hydrophobic properties of polymeric surfaces may cause fogging in transparent packaging and poor adhesion to printing colours and coatings. Novel plasma processes for durable functionalization of polypropylene and polyethylene terephthalate substrates were developed and analysed using optical emission spectroscopy. A worm-like nano pattern was created on the polypropylene surface prior to the deposition of thin polar plasma polymerised layers. For both substrates, highly polar surfaces exhibiting a surface tension of up to 69 mN/m and a water contact angle of about 10° were produced - providing the anti-fogging effect. The deposition of thin plasma polymerised layers protects the increased surface areas and enables to tailoring the surface energy of the substrate in a wide range. Wetting characteristics were determined by dynamic contact angle measurements. Investigations of the chemical composition of several layers using X-ray photoelectron spectroscopy and FT-infrared spectroscopy were correlated with functional testing. The surface topography was investigated using atomic force microscopy. The weldability and peeling-off characteristics of the plasma treated polymer films could be adjusted by varying the process parameters. Global and specific migration analyses were undertaken in order to ensure the manufacturing of plasma treated polymer surfaces for direct food contact purposes.

Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

Directory of Open Access Journals (Sweden)

Amir V. Tavakoli

2017-09-01

Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

Dielectric properties of plasma sprayed silicates subjected to additional annealing

Czech Academy of Sciences Publication Activity Database

Ctibor, Pavel; Sedláček, J.; Nevrlá, Barbara; Neufuss, Karel

2017-01-01

Roč. 10, č. 2 (2017), s. 105-114 ISSN 2008-2134 Institutional support: RVO:61389021 Keywords : Annealing * Dielectric properties * Plasma spraying * Silicates * Electrical properties * Insulators Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Coating and films http://pccc.icrc.ac.ir/Articles/1/18/990/

Effect of accelerated ageing and surface sealing on the permanent deformation of auto-polymerising soft linings.

Science.gov (United States)

da Silva, Joaquim; Takahashi, Jessica; Nuňez, Juliana; Consani, Rafael; Mesquita, Marcelo

2012-09-01

To compare the effects of different ageing methods on the permanent deformation of two permanent soft liners. The materials selected were auto-polymerising acrylic resin and silicone-based reliners. Sealer coating was also evaluated. Sixty specimens of each reliner were manufactured (12.7 mm diameter and 19 mm length). Specimens were randomly distributed into 12 groups (n = 10) and submitted to one of the accelerated ageing processes. Permanent deformation tests were conducted with a mechanical device described within the American Dental Association specification number 18 with a compressive load of 750 gf applied for 30 s. All data were submitted for statistical analysis. Mann-Whitney test compared the effect of the surface sealer on each material and the permanent deformation of the materials in the same ageing group (p = 0.05). Kruskal-Wallis and Dunn tests compared all ageing groups of each material (p = 0.05). The silicone-based reliner presented a lower permanent deformation than the acrylic resin-based reliner, regardless of the ageing procedure. The surface sealer coating was effective only for the thermocycled silicone group and the accelerated ageing processes affected only the permanent deformation of the acrylic resin-based material. The silicone-based reliner presented superior elastic properties and the thermocycling was more effective in ageing the materials. © 2010 The Gerodontology Society and John Wiley & Sons A/S.

Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

DEFF Research Database (Denmark)

Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

2009-01-01

This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

The methylenetetrahydrofolate reductase c.c.677 C>T and c.c.1298 A>C polymorphisms in reproductive failures: Experience from an RSA and RIF study on a Polish population.

Science.gov (United States)

Nowak, Izabela; Bylińska, Aleksandra; Wilczyńska, Karolina; Wiśniewski, Andrzej; Malinowski, Andrzej; Wilczyński, Jacek R; Radwan, Paweł; Radwan, Michał; Barcz, Ewa; Płoski, Rafał; Motak-Pochrzęst, Hanna; Banasik, Małgorzata; Sobczyński, Maciej; Kuśnierczyk, Piotr

2017-01-01

Almost 1600 individuals from the Polish population were recruited to this study. Among them 319 were fertile couples, 289 were recurrent spontaneous abortion (RSA) couples, and 131 were in the group of recurrent implantation failure (RIF) following in vitro fertilization. The aim of this study was to evaluate the MTHFR c.c.677 C>T and c.c.1298 A>C polymorphisms' association with RSA and RIF. We used PCR-RFLP with HinfI (677 C>T) and MboII (1298 A>C) digestion. We observed a protective effect of the female AC genotype (OR = 0.64, p = 0.01) and the C allele (AC+CC genotypes; OR = 0.65, p = 0.009) against RSA. Moreover, 1298 AA/677 CT women were more frequent in RSA (31.14%) and RIF (25.20%) groups in comparison to fertile women (22.88%), although this difference was significant only in the case of RSA (p = 0.022, OR = 1.52). Male combined genotype analysis revealed no association with reproductive failure of their partners. Nevertheless, the female/male combination AA/AC of the 1298 polymorphism was more frequent in RSA couples (p = 0.049, OR = 1.49). However, the significant results became insignificant after Bonferroni correction. In addition, analysis of haplotypes showed significantly higher frequency of the C/C haplotype (1298 C/677 C) in the female control group than in the female RSA group (p = 0.03, OR = 0.77). Moreover, the association between elevated homocysteine (Hcy) level in plasma of RSA and RIF women and MTHFR polymorphisms was investigated but did not reveal significant differences. In conclusion, for clinical practice, it is better to check the homocysteine level in plasma and, if the Hcy level is increased, to recommend patients to take folic acid supplements rather than undergo screening of MTHFR for 1298 A>C and 677 C>T polymorphisms.

Characterisation of AC1: a naturally decaffeinated coffee

Directory of Open Access Journals (Sweden)

Luciana Benjamim Benatti

2012-01-01

Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

A multi-channel AC power supply controller

International Nuclear Information System (INIS)

Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

2003-01-01

A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

Bioinformatics and Astrophysics Cluster (BinAc)

Science.gov (United States)

Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

2017-09-01

BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

Energy Technology Data Exchange (ETDEWEB)

Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

2014-10-01

Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

Biocompatible Silver-containing a-C:H and a-C coatings: AComparative Study

Energy Technology Data Exchange (ETDEWEB)

Endrino, Jose Luis; Allen, Matthew; Escobar Galindo, Ramon; Zhang, Hanshen; Anders, Andre; Albella, Jose Maria

2007-04-01

Hydrogenated diamond-like-carbon (a-C:H) and hydrogen-free amorphous carbon (a-C) coatings are known to be biocompatible and have good chemical inertness. For this reason, both of these materials are strong candidates to be used as a matrix that embeds metallic elements with antimicrobial effect. In this comparative study, we have incorporated silver into diamond-like carbon (DLC) coatings by plasma based ion implantation and deposition (PBII&D) using methane (CH4) plasma and simultaneously depositing Ag from a pulsed cathodic arc source. In addition, we have grown amorphous carbon - silver composite coatings using a dual-cathode pulsed filtered cathodic-arc (FCA) source. The silver atomic content of the deposited samples was analyzed using glow discharge optical spectroscopy (GDOES). In both cases, the arc pulse frequency of the silver cathode was adjusted in order to obtain samples with approximately 5 at.% of Ag. Surface hardness of the deposited films was analyzed using the nanoindentation technique. Cell viability for both a-C:H/Ag and a-C:/Ag samples deposited on 24-well tissue culture plates has been evaluated.

The effect of an alternating electric field on a totally ionised plasma

International Nuclear Information System (INIS)

Baglin, H.; Brin, A.; Ozias, Y.; Salmon, J.

1960-01-01

The equation giving the distribution function of the electrons in a steady-state, for a fully ionized plasma in an a.c. field, are provided from the Fokker-Planck equation. The electric conductivity is complex and depends on the frequency. (author) [fr

Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

Directory of Open Access Journals (Sweden)

Evi Ploumpidou

2017-12-01

Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

Nonlinear plasma wave models in 3D fluid simulations of laser-plasma interaction

Science.gov (United States)

Chapman, Thomas; Berger, Richard; Arrighi, Bill; Langer, Steve; Banks, Jeffrey; Brunner, Stephan

2017-10-01

Simulations of laser-plasma interaction (LPI) in inertial confinement fusion (ICF) conditions require multi-mm spatial scales due to the typical laser beam size and durations of order 100 ps in order for numerical laser reflectivities to converge. To be computationally achievable, these scales necessitate a fluid-like treatment of light and plasma waves with a spatial grid size on the order of the light wave length. Plasma waves experience many nonlinear phenomena not naturally described by a fluid treatment, such as frequency shifts induced by trapping, a nonlinear (typically suppressed) Landau damping, and mode couplings leading to instabilities that can cause the plasma wave to decay rapidly. These processes affect the onset and saturation of stimulated Raman and Brillouin scattering, and are of direct interest to the modeling and prediction of deleterious LPI in ICF. It is not currently computationally feasible to simulate these Debye length-scale phenomena in 3D across experimental scales. Analytically-derived and/or numerically benchmarked models of processes occurring at scales finer than the fluid simulation grid offer a path forward. We demonstrate the impact of a range of kinetic processes on plasma reflectivity via models included in the LPI simulation code pF3D. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.

ACS and STEMI treatment: gender-related issues.

Science.gov (United States)

Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude

2012-08-01

Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.

Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

Science.gov (United States)

Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

Should fee-for-service be for all guideline-advocated acute coronary syndrome (ACS) care? Observations from the Snapshot ACS study.

Science.gov (United States)

Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P

2015-09-01

The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, G [Jefferson Lab (United States)

2014-07-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, Gianluigi [JLAB

2015-02-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

Ac irreversibility line of bismuth-based high temperature superconductors

International Nuclear Information System (INIS)

Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.

1997-01-01

We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society

Aspartic acid incorporated monolithic columns for affinity glycoprotein purification.

Science.gov (United States)

Armutcu, Canan; Bereli, Nilay; Bayram, Engin; Uzun, Lokman; Say, Rıdvan; Denizli, Adil

2014-02-01

Novel aspartic acid incorporated monolithic columns were prepared to efficiently affinity purify immunoglobulin G (IgG) from human plasma. The monolithic columns were synthesised in a stainless steel HPLC column (20 cm × 5 mm id) by in situ bulk polymerisation of N-methacryloyl-L-aspartic acid (MAAsp), a polymerisable derivative of L-aspartic acid, and 2-hydroxyethyl methacrylate (HEMA). Monolithic columns [poly(2-hydroxyethyl methacrylate-N-methacryloyl-L-aspartic acid) (PHEMAsp)] were characterised by swelling studies, Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM). The monolithic columns were used for IgG adsorption/desorption from aqueous solutions and human plasma. The IgG adsorption depended on the buffer type, and the maximum IgG adsorption from aqueous solution in phosphate buffer was 0.085 mg/g at pH 6.0. The monolithic columns allowed for one-step IgG purification with a negligible capacity decrease after ten adsorption-desorption cycles. Copyright © 2013 Elsevier B.V. All rights reserved.

Micro patterning of cell and protein non-adhesive plasma polymerized coatings for biochip applications

DEFF Research Database (Denmark)

Bouaidat, Salim; Berendsen, C.; Thomsen, P.

2004-01-01

Micro scale patterning of bioactive surfaces is desirable for numerous biochip applications. Polyethyleneoxide-like (PEO-like) coating with non-fouling functionality has been deposited using low frequency AC plasma polymerization. The non-fouling properties of the coating were tested with human c...... and versatility of the plasma-polymerized coatings, make this technology highly suitable for bio-MEMS and biochip applications, where patterned high contrast non-fouling surfaces are needed....

Determination of some enzymes and macro- and microelements in stallion seminal plasma and their correlations to semen quality.

Science.gov (United States)

Pesch, Sandra; Bergmann, Martin; Bostedt, Hartwig

2006-07-15

Seminal plasma is very important for sperm metabolism as well as sperm function and survival and transport in the female genital tract. Analysis of enzyme activities and concentrations of elements can estimate integrity and function of sperm cell membranes. In man much data are available about biochemical analyses of seminal plasma. However, not many studies have been conducted in horses yet. We collected ejaculates from 72 stallions, measured the volume, obtained seminal plasma by centrifugation and examined spermatozoa with light microscopy for motility, concentration, for dead sperm and morphology. Of seminal plasma fluid, we measured activities of aspartate-amino-transferase (AST), gamma-glutamyl-transferase (GGT), alkaline phosphatase (AlP), acid phosphatase (AcP) and lactate-dehydrogenase (LDH) as well as concentrations of sodium (Na(+)), potassium (K(+)), total and ionised calcium (Ca(TOTAL)/Ca(2+)), magnesium (Mg(2+)), phosphate (P), chloride (Cl), copper (Cu), iron (Fe) and zinc (Zn). In addition, correlations among different parameters in light microscopy and seminal plasma were statistically examined by using the Spearman rank correlation coefficient. Median enzyme activities for AST, GGT, AlP, AcP and LDH were 80.0, 7,500, 30,200, 20.0, 81.0 IU/L, respectively. Concentrations of Na(+), K(+), Ca(TOTAL), Ca(2+), Mg(2+), P, Cl were 110.5, 22.1, 2.9, 1.7, 3.1, 1.1 and 114.5 mmol/L, and of microelements Cu, Fe and Zn were 17.8, 1.9 and 13.2 micromol/L, respectively. Furthermore, we found significant correlations between semen volume as well as sperm concentration and AST, GGT, AlP, AcP and LDH as well as Fe and Zn. This made us propose a primary testicular and epididymal origin of these parameters. Significant correlation between GGT and motility may be a sign for its function for cell protection against free radicals. LDH activity significantly correlates with motility and progressive motility, live:dead-ratio and pathomorphology. In our study, LDH seems to

ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching

Science.gov (United States)

Taylor, Terri

2009-05-01

In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.

Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

Directory of Open Access Journals (Sweden)

Eriko Kage-Nakadai

Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

Magnetic irreversibility in granular superconductors: ac susceptibility study

International Nuclear Information System (INIS)

Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.

1991-01-01

Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)

Plasma polymerization at different positions in an asymmetric ethylene discharge

International Nuclear Information System (INIS)

Trieschmann, Jan; Hegemann, Dirk

2011-01-01

The characteristics of plasma polymerization are investigated in an asymmetric, capacitively coupled plasma discharge. Here, the deposition in different plasma zones, i.e. on the driven electrode, within the plasma bulk and the plasma sheath as well as approximately at the plasma-sheath edge, is investigated. Principal expectations are perfectly met, though new interesting dependences of the obtained a-C : H coatings with respect to film properties and deposition rates are also found. That is, the deposition rates as measured on thin, small glass slides placed directly on the electrode are considerably higher than everywhere else in the plasma, yet only single-sided. In contrast, the deposition rates on the samples within the plasma are lowered depending on the exact placement, while a double-sided coating is obtained. Furthermore, film properties, such as the film density, are highly dependent on the sample placement in the plasma, which can even be higher under floating conditions. With simple physical arguments we are able to show the relations between the deposition rate and the energy input into the plasma as well as between the energy density during film growth and the film density itself.

Control of hybrid AC/DC microgrid under islanding operational conditions

DEFF Research Database (Denmark)

Ding, G.; Gao, F.; Zhang, S.

2014-01-01

This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....

Ac irreversibility line of bismuth-based high temperature superconductors

Energy Technology Data Exchange (ETDEWEB)

Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)

1997-09-01

We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}

16. Hot dense plasma atomic processes

International Nuclear Information System (INIS)

Werner, Dappen; Totsuji, H.; Nishii, Y.

2002-01-01

This document gathers 13 articles whose common feature is to deal with atomic processes in hot plasmas. Density functional molecular dynamics method is applied to the hydrogen plasma in the domain of liquid metallic hydrogen. The effects of the density gradient are taken into account in both the electronic kinetic energy and the exchange energy and it is shown that they almost cancel with each other, extending the applicability of the Thomas-Fermi-Dirac approximation to the cases where the density gradient is not negligible. Another article reports about space and time resolved M-shell X-ray measurements of a laser-produced gas jet xenon plasma. Plasma parameters have been measured by ion acoustic and electron plasma waves Thomson scattering. Photo-ionization becomes a dominant atomic process when the density and the temperature of plasmas are relatively low and when the plasma is submitted to intense external radiation. It is shown that 2 plasmas which have a very different density but have the same ionization parameters, are found in a similar ionization state. Most radiation hydrodynamics codes use radiative opacity data from available libraries of atomic data. Several articles are focused on the determination of one group Rosseland and Planck mean analytical formulas for several single elements used in inertial fusion targets. In another paper the plasma density effect on population densities, effective ionization, recombination rate coefficients and on emission lines from carbon and Al ions in hot dense plasma, is studied. The last article is devoted to a new atomic model in plasmas that considers the occupation probability of the bound state and free state density in the presence of the plasma micro-field. (A.C.)

Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

Science.gov (United States)

Reitan, D. K.

1973-01-01

Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

Science.gov (United States)

Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

2017-05-01

Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique

DEFF Research Database (Denmark)

Blaabjerg, Frede; Aquila, A. Dell’; Liserre, Marco

2004-01-01

of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....

Atmospheric Pressure Plasma Induced Sterilization and Chemical Neutralization

Science.gov (United States)

Garate, Eusebio; Evans, Kirk; Gornostaeva, Olga; Alexeff, Igor; Lock Kang, Weng; Wood, Thomas K.

1998-11-01

We are studying chemical neutralization and surface decontamination using atmospheric pressure plasma discharges. The plasma is produced by corona discharge from an array of pins and a ground plane. The array is constructed so that various gases, like argon or helium, can be flowed past the pins where the discharge is initiated. The pin array can be biased using either DC, AC or pulsed discharges. Results indicate that the atmospheric plasma is effective in sterilizing surfaces with biological contaminants like E-coli and bacillus subtilus cells. Exposure times of less than four minutes in an air plasma result in a decrease in live colony counts by six orders of magnitude. Greater exposure times result in a decrease of live colony counts of up to ten orders of magnitude. The atmospheric pressure discharge is also effective in decomposing organic phosphate compounds that are simulants for chemical warfare agents. Details of the decomposition chemistry, by-product formation, and electrical energy consumption of the system will be discussed.

21 CFR 880.5100 - AC-powered adjustable hospital bed.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...

Nonlinear AC susceptibility, surface and bulk shielding

Science.gov (United States)

van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.

1996-02-01

We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.

AC BREAKDOWN IN GASES

Science.gov (United States)

electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.

Influence of unharmonic changes of plasma potential on the Langmuir probe characteristics for a grounded probe

International Nuclear Information System (INIS)

Surda, V.

1990-01-01

A theory is presented of the deformation of Langmuir probe characteristics by the presence of a.c. plasma potential oscillations at the space charge layer around the probe, making allowance for the fundamental frequency and the second harmonic. It is applicable particularly to the determination of the electron temperature in actual high-frequency discharges with a Maxwellian electron energy distribution. The effect of an a.c. signal on the ion current is also treated. (author). 8 figs., 14 refs

Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

Science.gov (United States)

Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

2016-01-01

Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

AC electric motors control advanced design techniques and applications

CERN Document Server

Giri, Fouad

2013-01-01

The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

Directory of Open Access Journals (Sweden)

Rudy Ariyanto

2017-11-01

Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

Plasma Spraying and Characterization of Chromium Carbide-Nickel Chromium Coatings

Czech Academy of Sciences Publication Activity Database

Ctibor, Pavel; Prantnerová, M.

2016-01-01

Roč. 9, č. 4 (2016), s. 281-290, č. článku PCCC-2016-09-16-339. ISSN 2008-2134 Institutional support: RVO:61389021 Keywords : Plasma spraying * Chromium carbide * Slurry abrasion * Dry rubber wheel test * Friction * Microhardness Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass http://www.pccc.icrc.ac.ir/?xid=0113010121000001804&id=976

Acylcarnitine Profiles in Plasma and Tissues of Hyperglycemic NZO Mice Correlate with Metabolite Changes of Human Diabetes

Directory of Open Access Journals (Sweden)

Anna Weiser

2018-01-01

Full Text Available The New Zealand obese (NZO mouse is a polygenic model for obesity and diabetes with obese females and obese, diabetes-prone males, used to study traits of the metabolic syndrome like type 2 diabetes mellitus (T2DM, obesity, and dyslipidaemia. By using LC-MS/MS, we here examine the suitability of this model to mirror tissue-specific changes in acylcarnitine (AC and amino acid (AA species preceding T2DM which may reflect patterns investigated in human metabolism. We observed high concentrations of fatty acid-derived ACs in 11 female mice, high abundance of branched-chain amino acid- (BCAA- derived ACs in 6 male mice, and slight increases in BCAA-derived ACs in the remaining 6 males. Principal component analysis (PCA including all ACs and AAs confirmed our hypothesis especially in plasma samples by clustering females, males with high BCAA-derived ACs, and males with slight increases in BCAA-derived ACs. Concentrations of insulin, blood glucose, NEFAs, and triacylglycerols (TAGs further supported the hypothesis of high BCAA-derived ACs being able to mirror the onset of diabetic traits in male individuals. In conclusion, alterations in AC and AA profiles overlap with observations from human studies indicating the suitability of NZO mice to study metabolic changes preceding human T2DM.

Successful enrichment of the ubiquitous freshwater acI Actinobacteria.

Science.gov (United States)

Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk

2014-02-01

Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

Instabilities, turbulence and transport in a magnetized plasma

International Nuclear Information System (INIS)

Garbet, X.

2001-06-01

The purpose of this work is to introduce the main processes that occur in a magnetized plasma. During the last 2 decades, the understanding of turbulence has made great progress but analytical formulas and simulations are far to produce reliable predictions. The values of transport coefficients in a tokamak plasma exceed by far those predicted by the theory of collisional transport. This phenomenon is called abnormal transport and might be due to plasma fluctuations. An estimation of turbulent fluxes derived from the levels of fluctuations, is proposed. A flow description of plasma allows the understanding of most micro-instabilities. The ballooning representation deals with instabilities in a toric geometry. 3 factors play an important role to stabilize plasmas: density pinch, magnetic shear and speed shear. The flow model of plasma gives an erroneous value for the stability threshold, this is due to a bad description of the resonant interaction between wave and particle. As for dynamics, flow models can be improved by adding dissipative terms so that the linear response nears the kinetic response. The kinetic approach is more accurate but is complex because of the great number of dimensions involved. (A.C.)

AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

Design and synthesis of 225Ac radioimmunopharmaceuticals

International Nuclear Information System (INIS)

McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.

2002-01-01

The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans

Nuclear structure of 231Ac

International Nuclear Information System (INIS)

Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

2008-01-01

The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

Research on the Primary Processes of Radiation-Initiated Polymerization; Recherches sur les processus primaires de polymerisation amorcee par rayonnements; Issledovaniya osnovnykh protsessov polimerizatsii pod vozdejstviem oblucheniya; Estudios sobre los procesos primarios en la polimerizacion radioinducida

Energy Technology Data Exchange (ETDEWEB)

Okamura, S; Manabe, T; Higashimura, T; Oishi, Y; Futami, S

1960-07-15

Excitation energy transfer in benzene solutions of monomers, polymers and copolymers has been studied by observations on the quenching of terphenyl fluorescence produced by gamma radiation. The ease of energy transfer from benzene to various monomers is conjugated monomers > unconjugated > monomers > corresponding saturated compounds. Quenching experiments were also carried out using polymer solutions in benzene. The order of efficiencies was crepe rubber > polystyrene > polyvinyl acetate > acrylic polymers. The results obtained for quenching by a styrene-methyl methacrylate copolymer indicated that the specific quenching efficiency of the styrene units in the copolymer was less than in the homopolymer. The gamma ray initiated polymerisation of styrene in methylene dichloride solutions at low temperature was studied. The results obtained for the dependence of polymerisation rate on intensity are consistent with an ionic mechanism. The composition of the copolymer obtained with methyl methacrylate also supports this view. (author) [French] Les auteurs ont etudie la transmission de l'energie d'excitation dans les solutions de benzene du fait de la presence de monomeres, polymeres et copolymeres, en etudiant l'extinction de la fluorescence du terphenyle induite par rayons gamma. On peut classer les divers monomeres en trois categories selon l'ordre de facilite avec laquelle l'energie du benzene leur est transmise : monomeres conjugues, monomeres non conjugues, composes satures correspondants. Les auteurs ont egalement fait des experiences sur des polymeres dans une solution de benzene. L'efficacite va en decroissant dans l'ordre suivant: caoutchouc naturel, polystyrolene, acetate de polyvinyle, polymere acrylique. Les resultats obtenus pour le copolymere styrolene-methacrylate de methyle montrent que l'efficacite d'extinction du styrolene est plus faible dans le cas des copolymeres que dans le cas des homopolymeres. Les auteurs ont etudie la polymerisation du

Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly

International Nuclear Information System (INIS)

Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production

Load Designs For MJ Dense Plasma Foci

Science.gov (United States)

Link, A.; Povlius, A.; Anaya, R.; Anderson, M. G.; Angus, J. R.; Cooper, C. M.; Falabella, S.; Goerz, D.; Higginson, D.; Holod, I.; McMahon, M.; Mitrani, J.; Koh, E. S.; Pearson, A.; Podpaly, Y. A.; Prasad, R.; van Lue, D.; Watson, J.; Schmidt, A. E.

2017-10-01

Dense plasma focus (DPF) Z-pinches are compact pulse power driven devices with coaxial electrodes. The discharge of DPF consists of three distinct phases: first generation of a plasma sheath, plasma rail gun phase where the sheath is accelerated down the electrodes and finally an implosion phase where the plasma stagnates into a z-pinch geometry. During the z-pinch phase, DPFs can produce MeV ion beams, x-rays and neutrons. Megaampere class DPFs with deuterium fills have demonstrated neutron yields in the 1012 neutrons/shot range with pulse durations of 10-100 ns. Kinetic simulations using the code Chicago are being used to evaluate various load configurations from initial sheath formation to the final z-pinch phase for DPFs with up to 5 MA and 1 MJ coupled to the load. Results will be presented from the preliminary design simulations. LLNL-ABS-734785 This work performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory (LLNL) under Contract DE-AC52-07NA27344 and with support from the Computing Grand Challenge program at LLNL.

Marketingová komunikace AC Sparta Praha

OpenAIRE

Fanta, Jan

2016-01-01

Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...

c-axis ac susceptibility in high-Tc superconductors

International Nuclear Information System (INIS)

Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.

1996-01-01

We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

Fast electric dipole transitions in Ra-Ac nuclei

International Nuclear Information System (INIS)

Ahmad, I.

1985-01-01

Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs

Preionization Techniques in a kJ-Scale Dense Plasma Focus

Science.gov (United States)

Povilus, Alexander; Shaw, Brian; Chapman, Steve; Podpaly, Yuri; Cooper, Christopher; Falabella, Steve; Prasad, Rahul; Schmidt, Andrea

2016-10-01

A dense plasma focus (DPF) is a type of z-pinch device that uses a high current, coaxial plasma gun with an implosion phase to generate dense plasmas. These devices can accelerate a beam of ions to MeV-scale energies through strong electric fields generated by instabilities during the implosion of the plasma sheath. The formation of these instabilities, however, relies strongly on the history of the plasma sheath in the device, including the evolution of the gas breakdown in the device. In an effort to reduce variability in the performance of the device, we attempt to control the initial gas breakdown in the device by seeding the system with free charges before the main power pulse arrives. We report on the effectiveness of two techniques developed for a kJ-scale DPF at LLNL, a miniature primer spark gap and pulsed, 255nm LED illumination. Prepared by LLNL under Contract DE-AC52-07NA27344.

Plasma phospholipid fatty acid profiles in Korean adults with and without acute coronary syndrome

Science.gov (United States)

Background and Objectives: Acute coronary syndrome (ACS), a clinical manifestation of coronary artery disease presenting as unstable angina and/or myocardial infarction, is the third-leading cause of death in South Korea. Plasma phospholipid (PL) fatty acid profiles are considered objective biomarke...

Advanced DC/AC inverters applications in renewable energy

CERN Document Server

Luo, Fang Lin

2013-01-01

DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

Ozone and dinitrogen monoxide production in atmospheric pressure air dielectric barrier discharge plasma effluent generated by nanosecond pulse superimposed alternating current voltage

Science.gov (United States)

Takashima, Keisuke; Kaneko, Toshiro

2017-06-01

The effects of nanosecond pulse superposition to alternating current voltage (NS + AC) on the generation of an air dielectric barrier discharge (DBD) plasma and reactive species are experimentally studied, along with measurements of ozone (O3) and dinitrogen monoxide (N2O) in the exhausted gas through the air DBD plasma (air plasma effluent). The charge-voltage cycle measurement indicates that the role of nanosecond pulse superposition is to induce electrical charge transport and excess charge accumulation on the dielectric surface following the nanosecond pulses. The densities of O3 and N2O in NS + AC DBD are found to be significantly increased in the plasma effluent, compared to the sum of those densities generated in NS DBD and AC DBD operated individually. The production of O3 and N2O is modulated significantly by the phase in which the nanosecond pulse is superimposed. The density increase and modulation effects by the nanosecond pulse are found to correspond with the electrical charge transport and the excess electrical charge accumulation induced by the nanosecond pulse. It is suggested that the electrical charge transport by the nanosecond pulse might result in the enhancement of the nanosecond pulse current, which may lead to more efficient molecular dissociation, and the excess electrical charge accumulation induced by the nanosecond pulse increases the discharge coupling power which would enhance molecular dissociation.

A single-phase embedded Z-source DC-AC inverter.

Science.gov (United States)

Kim, Se-Jin; Lim, Young-Cheol

2014-01-01

In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.

dc Arc Fault Effect on Hybrid ac/dc Microgrid

Science.gov (United States)

Fatima, Zahra

The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

A method and an electrode for excitation of a plasma

International Nuclear Information System (INIS)

Glejboel, K.

1998-01-01

The method for excitation of a plasma comprises the step of subjecting a gas to an electric field generated by an electrode system. Each of 3 to 30 electrodes are connected to one of three specified AC voltages. The frequency is preferably between 50 and 60 Hz. The invention also concerns an electrode system for carrying out the method. 3 figs

Ethylene Polymerization by Gamma Irradiation; Polymerisation de l'ethylene par irradiation; Polimerizatsiya ehtilen a pod vliyaniem gamma-izlucheniya; Polimerizacion del etileno por irradiacion gamma

Energy Technology Data Exchange (ETDEWEB)

Medvedev, S S; Abkin, A D; Khomikovsky, P M [Fiziko-khimicheskij institut im. Karpova, SSSR, Moscow, Union of Soviet Socialist Republics (Russian Federation)

1960-07-15

Radiation polymerization of ethylene was investigated. To increase the rate initiation polymerization was carried out in solutions of organic substances (alcohols, acethone, aliphatic hydrocarbons). It was shown that at a constant pressure of 50 atm. and room temperature the rate of the process in solution is 10 to 15 times higher than in the gaseous medium. A detailed study was made of ethylene polymerization when irradiated with a cobalt-60 source in gas, pressure (50 to 300 atm.), dose rate (20 to 160 roentgen per second) and temperature (0 to 50{sup o} C), being the variables. The rate of the process, the radiation-chemical yield and mean molecular weight of the polymers exhibit a sharp increase with pressure (from 50 to 200 atm. the rate of polymerization is proportional to the fourth power of ethylene concentration). The polymerization rate depends only slightly on the dose rate (it being proportional to the 0.3 power of the dose rate), while the radiation-chemical yield and mean molecular weight of the polymers increase as the dose rate drops. The rate of the process and the molecular weight show some increase as the temperature rises. The possible explanation of the kinetic regularities observed are discussed in the report. Radiation polyethylene is distinguished from the high pressure one by increased density and crystallization. The polymer with a characteristic viscosity of over I (obtained at a pressure of 100-200 atm.) is similar in its chemical properties to high-pressure polyethylene. (author) [French] Les auteurs ont etudie la polymerisation de l'ethylene par irradiation. Pour accelerer la polymerisation, l'amorcage a ete effectue dans des solutions de substances organiques (alcools, acetones, hydrocarbones aliphatiques). Les auteurs ont montre qu'a une pression constante de 50 atmospheres et a la temperature ambiante la vitesse du processus est dix a quinze fois plus grande dans les solutions qu'en milieu gazeux. Les auteurs ont etudie en detail la

Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.

Science.gov (United States)

Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong

2018-05-01

Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.

Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.

Science.gov (United States)

Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide

2015-10-01

Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte

International Nuclear Information System (INIS)

García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.

2016-01-01

The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.

Superconducting three element synchronous ac machine

International Nuclear Information System (INIS)

Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

1975-01-01

There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

Platelet-rich plasma (PRP for acute muscle injury: a systematic review.

Directory of Open Access Journals (Sweden)

Mohamad Shariff A Hamid

Full Text Available INTRODUCTION: Acute muscle injury is one of the commonest injuries that often result in loss of training and competition time. The best management for muscle injury has not been identified. Sports medicine practitioners used several approaches in attempt to accelerate time to recovery from muscle injury. More recently growing interest focussed on autologous blood product injection. METHODS: A literature search was conducted systematically using OvidMEDLINE, PubMed, EMBASE, SPORTDiscus and CINAHL databases to retrieve articles published until December 2012. Controlled trials and controlled laboratory studies comparing different strategies to promote early recovery of muscle injury were included. The methodological quality of studies was assessed. RESULTS: There are limited studies on the effects of PRP therapy for muscle injury. Three in vivo laboratory studies and one pilot human study were reviewed. The laboratory studies reported histological evidence on significant acceleration of muscle healing in animals treated with autologous conditioned serum (ACS, platelet-rich plasma (PRP and platelet rich fibrin matrix (PRFM. A pilot human study found athletes treated with repeated ACS injection recovers significantly faster than retrospective controls. CONCLUSION: Several in vivo laboratory studies suggest beneficial effects of ACS, PRP and PRFM in accelerating muscle recovery. Evidence to suggest similar effects on humans is however limited, as valuable information from robust human controlled trials is still not available at this moment. Hence, more studies of satisfactory methodological quality with platelet-rich plasma interventions on muscle injury are justified.

Nontrivial ac spin response in the effective Luttinger model

International Nuclear Information System (INIS)

Hu Liangbin; Zhong Jiansong; Hu Kaige

2006-01-01

Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before

Deposition of hybrid organic-inorganic composite coatings using an atmospheric plasma jet system.

Science.gov (United States)

Dembele, Amidou; Rahman, Mahfujur; Reid, Ian; Twomey, Barry; MacElroy, J M Don; Dowling, Denis P

2011-10-01

The objective of this study is to investigate the influence of alcohol addition on the incorporation of metal oxide nanoparticles into nm thick siloxane coatings. Titanium oxide (TiO2) nanoparticles with diameters of 30-80 nm were incorporated into an atmospheric plasma deposited tetramethylorthosilicate (TMOS) siloxane coating. The TMOS/TiO2 coating was deposited using the atmospheric plasma jet system known as PlasmaStream. In this system the liquid precursor/nanoparticle mixture is nebulised into the plasma. It was observed that prior to being nebulised the TiO2 particles agglomerated and settled over time in the TMOS/TiO2 mixture. In order to obtain a more stable nanoparticle/TMOS suspension the addition of the alcohols methanol, octanol and pentanol to this mixture was investigated. The addition of each of these alcohols was found to stabilise the nanoparticle suspension. The effect of the alcohol was therefore assessed with respect to the properties of the deposited coatings. It was observed that coatings deposited from TMOS/TiO2, with and without the addition of methanol were broadly similar. In contrast the coatings deposited with octanol and pentanol addition to the TMOS/TiO2 mixture were significantly thicker, for a given set of deposition parameters and were also more homogeneous. This would indicate that the alcohol precursor was incorporated into the plasma polymerised siloxane. The incorporation of the organic functionality from the alcohols was confirmed from FTIR spectra of the coatings. The difference in behaviour with alcohol type is likely to be due to the lower boiling point of methanol (65 degrees C), which is lower than the maximum plasma temperature measured at the jet orifice (77 degrees C). This temperature is significantly lower than the 196 degrees C and 136 degrees C boiling points of octanol and pentanol respectively. The friction of the coatings was determined using the Pin-on-disc technique. The more organic coatings deposited with

Nonlocal Ohms Law, Plasma Resistivity, and Reconnection During Collisions of Magnetic Flux Ropes

Science.gov (United States)

Gekelman, W.; DeHaas, T.; Pribyl, P.; Vincena, S.; Van Compernolle, B.; Sydora, R.; Tripathi, S. K. P.

2018-01-01

The plasma resistivity was evaluated in an experiment on the collision of two magnetic flux ropes. Whenever the ropes collide, some magnetic energy is lost as a result of reconnection. Volumetric data, in which all the relevant time-varying quantities were recorded in detail, are presented. Ohm’s law is shown to be nonlocal and cannot be used to evaluate the plasma resistivity. The resistivity was instead calculated using the AC Kubo resistivity and shown to be anomalously high in certain regions of space.

7 CFR 1737.31 - Area Coverage Survey (ACS).

Science.gov (United States)

2010-01-01

... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...

Manipulation of the polarization of intense laser beams via optical wave mixing in plasmas

Science.gov (United States)

Michel, Pierre; Divol, Laurent; Turnbull, David; Moody, John

2014-10-01

When intense laser beams overlap in plasmas, the refractive index modulation created by the beat wave via the ponderomotive force can lead to optical wave mixing phenomena reminiscent of those used in crystals and photorefractive materials. Using a vector analysis, we present a full analytical description of the modification of the polarization state of laser beams crossing at arbitrary angles in a plasma. We show that plasmas can be used to provide full control of the polarization state of a laser beam, and give simple analytical estimates and practical considerations for the design of novel photonics devices such as plasma polarizers and plasma waveplates. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract No. DE-AC52-07NA27344.

Tools for spectral data analysis of arbitrary emitters in edge plasma

International Nuclear Information System (INIS)

Marandet, Y.; Genesio, P.; Godbert-Mouret, L.; Koubiti, M.; Stamm, R.; Felts, B.; Capes, H.; Guirlet, R.; Lotte, P.; Lowry, C.

2003-01-01

A line shape code including Stark, Zeeman and Doppler effects has been upgraded to include atomic fine structure effects and the motional Stark effect (MST). Genetic algorithms provide an efficient and robust tool for automated analysis of edge plasma line shapes. Such an algorithm has been used to fit Doppler-broadened Zeeman D α /H α spectra observed in Tore-Supra. Spectra were analyzed from 2 different machine configurations, corresponding to: 1) recycling from the ergodic divertor (ED), with lines of sight tangential to the magnetic field; 2) recycling at the toroidal pump limiter (TPL) with vertical lines of sight perpendicular to the magnetic field. Preliminary results indicate that the plasma above the TPL contains a larger fraction of warm particles than the ED plasma. (A.C.)

Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers

Directory of Open Access Journals (Sweden)

Abdul Sattar Larik

2011-01-01

Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.

Sequencing analysis of ghrelin gene 5' flanking region: relations between the sequence variants, fasting plasma total ghrelin concentrations, and body mass index.

Science.gov (United States)

Vartiainen, Johanna; Kesäniemi, Y Antero; Ukkola, Olavi

2006-10-01

Ghrelin is a 28-amino-acid peptide with several functions linked to energy metabolism. Low ghrelin plasma concentrations are associated with obesity, hypertension, and type 2 diabetes mellitus, whereas high concentrations reflect states of negative energy balance. Several studies addressing the hormonal and neural regulation of ghrelin gene expression have been carried out, but the role of genetic factors in the regulation of ghrelin plasma levels remains unclear. To elucidate the role of genetic factors in the regulation of ghrelin expression, we screened 1657 nucleotides of the ghrelin gene 5' flanking region (promoter and possible regulatory sites) for new sequential variations from patient samples with low (n = 50) and high (n = 50) fasting plasma total ghrelin concentrations (low- and high-ghrelin groups). Eleven single nucleotide polymorphisms (SNPs), 3 of which were rare variants (allelic frequency less than 1%) were found in our population. The genotype distribution patterns of the SNPs did not differ between the study groups, except for SNP-501A>C (P = .039). In addition, the SNP-01A>C was associated with body mass index (BMI) (P = .018). This variant was studied further in our large and well-defined Oulu Project Elucidating Risk for Atherosclerosis (OPERA) cohort (n = 1045) by the restriction fragment length polymorphism (RFLP) technique. No significant association of SNP-501A>C genotypes with fasting ghrelin plasma concentrations was found in the whole OPERA population. However, the association of this SNP with BMI and with waist circumference reached statistical significance in OPERA (P = .047 and .049, respectively), remaining of borderline significance for BMI after adjustments (P = .055). The results indicate that factors other than the 11 SNPs found in this study in the 5' flanking region of ghrelin gene are the main determinants of ghrelin plasma levels. However, SNP-501 A>C genotype distribution seems to be different in subjects having the highest

Ignition phase and steady-state structures of a non-thermal air plasma

CERN Document Server

Lu Xin Pei

2003-01-01

An AC-driven, non-thermal, atmospheric pressure air plasma is generated within the gap separating a disc-shaped metal electrode and a water electrode. The ignition phase and the steady-state are studied by a high-speed CCD camera. It is found that the plasma always initiates at the surface of the water electrode. The plasma exhibits different structures depending on the polarity of the water electrode: when the water electrode plays the role of cathode, a relatively wide but visibly dim plasma column is generated. At the maximum driving voltage, the gas temperature is between 800 and 900 K, and the peak current is 67 mA; when the water electrode is anode, the plasma column narrows but increases its light emission. The gas temperature in this case is measured to be in the 1400-1500 K range, and the peak current is 81 mA.

Importance of Attenuation Correction (AC) for Small Animal PET Imaging

DEFF Research Database (Denmark)

El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

2012-01-01

was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

THE ACS NEARBY GALAXY SURVEY TREASURY

International Nuclear Information System (INIS)

Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.

2009-01-01

The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

Predicting AC loss in practical superconductors

International Nuclear Information System (INIS)

Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P

2006-01-01

Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time

Scaling and universality of ac conduction in disordered solids

DEFF Research Database (Denmark)

Schrøder, Thomas; Dyre, Jeppe

2000-01-01

Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

Tomato leaf curl Kerala virus (ToLCKeV AC3 protein forms a higher order oligomer and enhances ATPase activity of replication initiator protein (Rep/AC1

Directory of Open Access Journals (Sweden)

Mukherjee Sunil K

2010-06-01

Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.

Preliminary study on AC superconducting machines

International Nuclear Information System (INIS)

Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

1988-01-01

This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

The antisickling effects of dried fish (tilapia) And dried prawn ...

African Journals Online (AJOL)

The antisickling effect of dried fish (Tilapia) and dried prawn (Astacus red) were investigated to ascertain the ability of the extracts of these samples to inhibit polymerisation of sickle cell haemoglobin (HbS), improve the Fe 2+/Fe 3+ ratio and lower the activity of lactate dehydrogenase (LDH) in blood plasma. The samples ...

21 CFR 880.5500 - AC-powered patient lift.

Science.gov (United States)

2010-04-01

...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

Examining the temperature behavior of stainless steel surfaces exposed to hydrogen plasmas in the Lithium Tokamak eXperiment (LTX)

Science.gov (United States)

Bedoya, Felipe; Allain, Jean Paul; Kaita, Robert; Lucia, Matthew; St-Onge, Denis; Ellis, Robert; Majeski, Richard

2014-10-01

The Materials Analysis Particle Probe (MAPP) is an in-situ diagnostic designed to characterize plasma-facing components (PFCs) in tokamak devices. MAPP is installed in LTX at Princeton Plasma Physics Laboratory. MAPP's capabilities include remotely operated XPS acquisition and temperature control of four samples. The recent addition of a focused ion beam allows XPS depth profiling analysis. Recent published results show an apparent correlation between hydrogen retention and temperature of Li coated stainless steel (SS) PFCs exposed to plasmas like those of LTX. According to XPS data, the retention of hydrogen by the coated surfaces decreases at above 180 °C. In the present study MAPP will be used to study the oxidation of Li coatings as a function of time and temperature of the walls when Li coatings are applied. Experiments in the ion-surface interaction experiment (IIAX) varying the hydrogen fluence on the SS samples will be also performed. Conclusions resulting from this study will be key to explain the PFC temperature-dependent variation of plasma performance observed in LTX. This work was supported by U.S. DOE Contracts DE-AC02-09CH11466, DE-AC52-07NA27344 and DE-SC0010717.

Cooperative Frequency Control for Autonomous AC Microgrids

DEFF Research Database (Denmark)

Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

2015-01-01

Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

Diagnostics of the Fermilab Tevatron using an AC dipole

Energy Technology Data Exchange (ETDEWEB)

Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

2008-08-01

The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

Diagnostics of an AC driven atmospheric pressure non-thermal plasma jet and its use for radially directed jet array

Science.gov (United States)

Zhu, W.; Wang, R.

2017-08-01

An alternating current atmospheric pressure plasma jet is generated with noble gas or noble gas/oxygen admixture as working gas. A "core plasma filament" is observed at the center of the dielectric tube and extends to the plasma jet at higher peak-to-peak voltages. This type of plasma jet is believed to be of the same nature with the reported plasma bullet driven by pulsed DC power sources. Double current probes are used to assess the speed of the plasma bullet and show that the speed is around 104-105 m/s. The time dependence of the downstream bullet speed is attributed to the gas heating and in turn the increase of the reduced electric field E/N. Optical emission spectra show the dependence of helium and oxygen emission intensities on the concentration of oxygen additive in the carrier gas, with peak values found at 0.5% O2. Multiple radial jets are realized on dielectric tubes of different sizes. As a case study, one of these multi-jet devices is used to treat B. aureus on the inner surface of a plastic beaker and is shown to be more effective than a single jet.

Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

DEFF Research Database (Denmark)

Qin, Zian

. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...

AC power flow importance measures considering multi-element failures

International Nuclear Information System (INIS)

Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

2017-01-01

Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

Systémový pohled na klub AC Sparta

OpenAIRE

Čečák, František

2015-01-01

Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...

Ac system interruption analysis of an orthogonal-core type dc-ac converter. Koryu keito shadanji no chokko jishinkei dc-ac renkeiyo henkanki no dosa kaiseki

Energy Technology Data Exchange (ETDEWEB)

Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College

1991-04-30

This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.

Aragonite coating solutions (ACS) based on artificial seawater

Science.gov (United States)

Tas, A. Cuneyt

2015-03-01

Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

Energy Technology Data Exchange (ETDEWEB)

McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

2002-12-01

The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

Direct-current cathodic vacuum arc system with magnetic-field mechanism for plasma stabilization.

Science.gov (United States)

Zhang, H-S; Komvopoulos, K

2008-07-01

Filtered cathodic vacuum arc (FCVA) deposition is characterized by plasma beam directionality, plasma energy adjustment via substrate biasing, macroparticle filtering, and independent substrate temperature control. Between the two modes of FCVA deposition, namely, direct current (dc) and pulsed arc, the dc mode yields higher deposition rates than the pulsed mode. However, maintaining the dc arc discharge is challenging because of its inherent plasma instabilities. A system generating a special configuration of magnetic field that stabilizes the dc arc discharge during film deposition is presented. This magnetic field is also part of the out-of-plane magnetic filter used to focus the plasma beam and prevent macroparticle film contamination. The efficiency of the plasma-stabilizing magnetic-field mechanism is demonstrated by the deposition of amorphous carbon (a-C) films exhibiting significantly high hardness and tetrahedral carbon hybridization (sp3) contents higher than 70%. Such high-quality films cannot be produced by dc arc deposition without the plasma-stabilizing mechanism presented in this study.

Direct-current cathodic vacuum arc system with magnetic-field mechanism for plasma stabilization

International Nuclear Information System (INIS)

Zhang, H.-S.; Komvopoulos, K.

2008-01-01

Filtered cathodic vacuum arc (FCVA) deposition is characterized by plasma beam directionality, plasma energy adjustment via substrate biasing, macroparticle filtering, and independent substrate temperature control. Between the two modes of FCVA deposition, namely, direct current (dc) and pulsed arc, the dc mode yields higher deposition rates than the pulsed mode. However, maintaining the dc arc discharge is challenging because of its inherent plasma instabilities. A system generating a special configuration of magnetic field that stabilizes the dc arc discharge during film deposition is presented. This magnetic field is also part of the out-of-plane magnetic filter used to focus the plasma beam and prevent macroparticle film contamination. The efficiency of the plasma-stabilizing magnetic-field mechanism is demonstrated by the deposition of amorphous carbon (a-C) films exhibiting significantly high hardness and tetrahedral carbon hybridization (sp 3 ) contents higher than 70%. Such high-quality films cannot be produced by dc arc deposition without the plasma-stabilizing mechanism presented in this study

Coffee Consumption Increases the Antioxidant Capacity of Plasma and Has No Effect on the Lipid Profile or Vascular Function in Healthy Adults in a Randomized Controlled Trial.

Science.gov (United States)

Agudelo-Ochoa, Gloria M; Pulgarín-Zapata, Isabel C; Velásquez-Rodriguez, Claudia M; Duque-Ramírez, Mauricio; Naranjo-Cano, Mauricio; Quintero-Ortiz, Mónica M; Lara-Guzmán, Oscar J; Muñoz-Durango, Katalina

2016-03-01

Coffee, a source of antioxidants, has controversial effects on cardiovascular health. We evaluated the bioavailability of chlorogenic acids (CGAs) in 2 coffees and the effects of their consumption on the plasma antioxidant capacity (AC), the serum lipid profile, and the vascular function in healthy adults. Thirty-eight men and 37 women with a mean ± SD age of 38.5 ± 9 y and body mass index of 24.1 ± 2.6 kg/m(2) were randomly assigned to 3 groups: a control group that did not consume coffee or a placebo and 2 groups that consumed 400 mL coffee/d for 8 wk containing a medium (MCCGA; 420 mg) or high (HCCGA; 780 mg) CGA content. Both were low in diterpenes (0.83 mg/d) and caffeine (193 mg/d). Plasma caffeic and ferulic acid concentrations were measured by GC, and the plasma AC was evaluated with use of the ferric-reducing antioxidant power method. The serum lipid profile, nitric oxide (NO) plasma metabolites, vascular endothelial function (flow-mediated dilation; FMD), and blood pressure (BP) were evaluated. After coffee consumption (1 h and 8 wk), caffeic and ferulic acid concentrations increased in the coffee-drinking groups, although the values of the 2 groups were significantly different (P consumption, the plasma AC in the control group was significantly lower than the baseline value (-2%) and significantly increased in the MCCGA (6%) and HCCGA (5%) groups (P profile, FMD, BP, or NO plasma metabolites. This trial was registered at registroclinico.sld.cu as RPCEC00000168. © 2016 American Society for Nutrition.

ac propulsion system for an electric vehicle

Science.gov (United States)

Geppert, S.

1980-01-01

It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

Systémový pohled na klub AC Sparta

OpenAIRE

Čečák, František

2014-01-01

Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...

Endogenous glycosphingolipid acceptor specificity of sialosyltransferase systems in intact golgi membranes, synaptosomes, and synaptic plasma membranes from rat brain

International Nuclear Information System (INIS)

Durrie, R.; Saito, M.; Rosenberg, A.

1988-01-01

Preparations highly enriched in Golgi complex membranes, synaptosomes, and synaptic plasma membranes (SPM) by marker enzyme analysis and electron microscopic morphology were made from the brains of 28-day-old rats. These were incubated with cytidine 5'-monophosphate-N-acetyl[ 14 C]neuraminic acid (CMP-NeuAc) in a physiologic buffer, without detergents. Glycolipid sialosyltransferase activities (SATs) were measured by analyzing incorporation of radiolabeled NeuAc into endogenous membrane gangliosides. Golgi SAT was diversified in producing all the various molecular species of labeled gangliosides. Synaptosomal SAT exhibited a lower activity, but it was highly specific in its labeling pattern, with a marked preference for labeling NeuAcα2 → 8NeuAcα2 → 3Galβ1 → 4Glcβ1 → 1Cer (GD3 ganglioside). SPM prepared from the synaptosomes retained the GD3-related SAT (or SAT-2), and the total specific activity increased, which suggests that the location of the synaptosomal activity is in the SPM. These results indicate that SAT activity in Golgi membranes differs from that in synaptosomes with regard to endogenous acceptor substrate specificity and SAT activity of synaptosomes should be located in the synaptosomal plasma membrane. This SAT could function as an ectoenzyme in concert with ecto-sialidase to modulate the GD3 and other ganglioside population in situ at the SPM of the central nervous system

Synthesis and Properties of Star HPMA Copolymer Nanocarriers Synthesised by RAFT Polymerisation Designed for Selective Anticancer Drug Delivery and Imaging.

Science.gov (United States)

Chytil, Petr; Koziolová, Eva; Janoušková, Olga; Kostka, Libor; Ulbrich, Karel; Etrych, Tomáš

2015-06-01

High-molecular-weight star polymer drug nanocarriers intended for the treatment and/or visualisation of solid tumours were synthesised, and their physico-chemical and preliminary in vitro biological properties were determined. The water-soluble star polymer carriers were prepared by the grafting of poly(amido amine) (PAMAM) dendrimers by hetero-telechelic N-(2-hydroxypropyl)methacrylamide (HPMA) copolymers, synthesised by the controlled radical Reversible Addition Fragmentation chain Transfer (RAFT) polymerisation. The well-defined star copolymers with Mw values ranging from 2 · 10(5) to 6 · 10(5) showing a low dispersity (approximately 1.2) were prepared in a high yield. A model anticancer drug, doxorubicin, was bound to the star polymer through a hydrazone bond, enabling the pH-controlled drug release in the target tumour tissue. The activated polymer arm ends of the star copolymer carrier enable a one-point attachment for the targeting ligands and/or a labelling moiety. In this study, the model TAMRA fluorescent dye was used to prove the feasibility of the polymer carrier visualisation by optical imaging in vitro. The tailor-made structure of the star polymer carriers should facilitate the synthesis of targeted polymer-drug conjugates, even polymer theranostics, for simultaneous tumour drug delivery and imaging. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Surface morphology changes to tungsten under exposure to He ions from an electron cyclotron resonance plasma source

Science.gov (United States)

Donovan, David; Maan, Anurag; Duran, Jonah; Buchenauer, Dean; Whaley, Josh

2015-11-01

Exposure of tungsten to low energy (ALMT ITER grade tungsten samples. A similar He plasma exposure stage has now been developed at the University of Tennessee-Knoxville with an improved compact ECR plasma source. Status of the new UTK exposure stage will be discussed as well as planned experiments and new material characterization techniques (EBSD, GIXRD). Work supported by US DOE Contract DE-AC04-94AL85000 and the PSI Science Center.

Advanced reliability improvement of AC-modules (ARIA)

International Nuclear Information System (INIS)

Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.

2001-09-01

The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string

Mapa acústico parcial de Benetusser

OpenAIRE

MORILLA CASTELLANOS, EMILIO

2012-01-01

Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...

The PERC trademark process: Existing and potential applications for induction coupled plasma technology in hazardous and radioactive waste treatment

International Nuclear Information System (INIS)

Blutke, A.S.; Vavruska, J.S.; Serino, J.F.

1996-01-01

Plasma Technology, Inc. (PTI), a Santa Fe, New Mexico corporation has developed the Plasma Energy Recycle and Conversion (PERC)trademark treatment process as a safe and environmentally clean alternative to conventional thermal destruction technologies. The PERC trademark treatment process uses as its heat source an advanced Induction Coupled Plasma (ICP) torch connected to a reaction chamber system with an additional emission control system. For example, organic-based gas, liquid, slurry, and/or solid waste streams can be converted into usable or even salable products while residual emissions are reduced to an absolute minimum. In applications for treatment of hazardous and radioactive waste streams, the PERC system could be used for destruction of the hazardous organic constituents and/or significant waste volume reduction while capturing the radioactive fraction in a non-leachable form. Like Direct Current (DC) and Alternating Current (AC) arc plasma systems, ICP torches offer sufficient energy to decompose, melt and/or vitrify any waste stream. The decision for an arc plasma or an IC plasma system has to be made on a case by case evaluation and is highly dependent on the specific waste stream's form and composition. Induction coupled plasma technology offers one simple, but significant difference compared to DC or AC arc plasma systems: the ICP torch is electrodeless. To date, enormous research effort has been spent to improve the lifetime of electrodes and the effectiveness of related cooling systems. Arc plasma systems are established in research laboratories worldwide and are approaching a broad use in commercial applications. ICP technology has been improved relatively recently, but nowadays offers complete new and beneficial approaches in the field of waste conversion and treatment

Six switches solution for single-phase AC/DC/AC converter with capability of second-order power mitigation in DC-link capacitor

DEFF Research Database (Denmark)

Liu, Xiong; Wang, Peng; Loh, Poh Chiang

2011-01-01

This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...

AC conductivity of a quantum Hall line junction

International Nuclear Information System (INIS)

Agarwal, Amit; Sen, Diptiman

2009-01-01

We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.

Mass of AC Andromedae

International Nuclear Information System (INIS)

King, D.S.; Cox, A.N.; Hodson, S.W.

1975-01-01

Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)

ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus

International Nuclear Information System (INIS)

Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi

2007-01-01

orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae

Overview of plasma technology used in medicine

Science.gov (United States)

Ryan, Thomas P.; Stalder, Kenneth R.; Woloszko, Jean

2013-02-01

Plasma Medicine is a growing field that is having an impact in several important areas in therapeutic patient care, combining plasma physics, biology, and clinical medicine. Historically, plasmas in medicine were used in electrosurgery for cautery and non-contact hemostasis. Presently, non-thermal plasmas have attained widespread use in medicine due to their effectiveness and compatibility with biological systems. The paper will give a general overview of how low temperature, non-equilibrium, gas plasmas operate, both from physics and biology perspectives. Plasma is commonly described as the fourth state of matter and is typically comprised of charged species, active molecules and atoms, as well as a source of UV and photons. The most active areas of plasma technology applications are in wound treatment; tissue regeneration; inactivation of pathogens, including biofilms; treating skin diseases; and sterilization. There are several means of generating plasmas for use in medical applications, including plasma jets, dielectric barrier discharges, capacitively or inductively coupled discharges, or microplasmas. These systems overcome the former constraints of high vacuum, high power requirements and bulky systems, into systems that use room air and other gases and liquids at low temperature, low power, and hand-held operation at atmospheric pressure. Systems will be discussed using a variety of energy sources: pulsed DC, AC, microwave and radiofrequency, as well as the range of frequency, pulse duration, and gas combinations in an air environment. The ionic clouds and reactive species will be covered in terms of effects on biological systems. Lastly, several commercial products will be overviewed in light of the technology utilized, health care problems being solved, and clinical trial results.

Probable alpha and 14C cluster emission from hyper Ac nuclei

International Nuclear Information System (INIS)

Santhosh, K.P.

2013-01-01

A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)

Micro-hole array fluorescent sensor based on AC-Dielectrophoresis (DEP) for simultaneous analysis of nano-molecules

Science.gov (United States)

Kim, Hye Jin; Kang, Dong-Hoon; Lee, Eunji; Hwang, Kyo Seon; Shin, Hyun-Joon; Kim, Jinsik

2018-02-01

We propose a simple fluorescent bio-chip based on two types of alternative current-dielectrophoretic (AC-DEP) force, attractive (positive DEP) and repulsive (negative DEP) force, for simultaneous nano-molecules analysis. Various radius of micro-holes on the bio-chip are designed to apply the different AC-DEP forces, and the nano-molecules are concentrated inside the micro-hole arrays according to the intensity of the DEP force. The bio-chip was fabricated by Micro Electro Mechanical system (MEMS) technique, and was composed of two layers; a SiO2 layer and Ta/Pt layer were accomplished for an insulation layer and a top electrode with micro-hole arrays to apply electric fields for DEP force, respectively. Each SiO2 and Ta/Pt layers were deposited by thermal oxidation and sputtering, and micro-hole arrays were fabricated with Inductively Coupled Plasma (ICP) etching process. For generation of each positive and negative DEP at micro-holes, we applied two types of sine-wave AC voltage with different frequency range alternately. The intensity of the DEP force was controlled by the radius of the micro-hole and size of nano-molecule, and calculated with COMSOL multi-physics. Three types of nano-molecules labelled with different fluorescent dye were used and the intensity of nano-molecules was examined by the fluorescent optical analysis after applying the DEP force. By analyzing the fluorescent intensities of the nano-molecules, we verify the various nano-molecules in analyte are located successfully inside corresponding micro-holes with different radius according to their size.

Detection of Genetic Modification 'ac2' in Potato Foodstuffs

Directory of Open Access Journals (Sweden)

Petr Kralik

2009-01-01

Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

Arthroscopically Assisted Reconstruction of Acute Acromioclavicular Joint Dislocations: Anatomic AC Ligament Reconstruction With Protective Internal Bracing—The “AC-RecoBridge” Technique

Science.gov (United States)

Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk

2015-01-01

An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493

NMR spectroscopy and X-ray characterisation of cationic N-heteroaryl-pyridylamido Zr(IV) complexes: a further level of complexity for the elusive active species of pyridylamido olefin polymerisation catalysts.

Science.gov (United States)

Li, Gang; Zuccaccia, Cristiano; Tedesco, Consiglia; D'Auria, Ilaria; Macchioni, Alceo; Pellecchia, Claudio

2014-01-03

New [(N(-),N,N(-))ZrR2] dialkyl complexes (N(-),N,N(-)=pyrrolyl-pyridyl-amido or indolyl-pyridyl-amido; R=Me or CH2Ph) have been synthesised and tested as pre-catalysts for ethene and propene polymerisation in combination with different activators, such as B(C6F5)3, [Ph3C][B(C6F5)4], [HNMe2Ph][B(C6F5)4] or solid AlMe3-depleted methylaluminoxane (DMAO). Polyethylene (M(w)>2 MDa and M(w)/M(n)= 1.3-1.6) has been produced if pre-catalysts were activated with 1000 equivalents of DMAO (based on Al) [activity >1000 kg(PE)(mol([Zr]) h mol atm)(-1)] or by using a higher pre-catalyst concentration and a mixture of [HNPhMe2][B(C6F5)4] (1 equiv) and AliBu2H (60 equiv). In the case of propene polymerisation, activity has been observed only if pre-catalysts were treated with an excess of AliBu2H prior to addition of DMAO, which led to highly isotactic polypropylene ([mmmm]>95%). Neutral pre-catalysts and ion pairs derived from their activation have been characterised in solution by using advanced 1D and 2D NMR spectroscopy experiments. The detection and rationalisation of intercationic NOEs clearly showed the formation of dimeric species in which some pyrrolyl or indolyl π-electron density of one unit is engaged in stabilising the metal centre of the other unit, which relegates the counterions in the second coordination sphere. The solid-state structure of the dimeric indolyl-pyridyl-amidomethylzirconium derivative, determined by X-ray diffraction studies, points toward a weak Zr···η(3)-indolyl interaction. It can be hypothesised that the formation of dimeric cationic species hampers monomer coordination (especially of less reactive α-olefins) and that addition of AliBu2H is crucial to split the homodimers. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

Indian Academy of Sciences (India)

SHARIF F ZAMAN

the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.

Estimation of the Thurstonian model for the 2-AC protocol

DEFF Research Database (Denmark)

Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

2012-01-01

. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...

System and method for determining stator winding resistance in an AC motor

Science.gov (United States)

Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI

2011-05-31

A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.

Lamin A/C might be involved in the EMT signalling pathway.

Science.gov (United States)

Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu

2018-07-15

We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.

Assembling a supercapacitor electrode with dual metal oxides and activated carbon using a liquid phase plasma.

Science.gov (United States)

Ki, Seo Jin; Jeon, Ki-Joon; Park, Young-Kwon; Park, Hyunwoong; Jeong, Sangmin; Lee, Heon; Jung, Sang-Chul

2017-12-01

Developing supercapacitor electrodes at an affordable cost while improving their energy and/or power density values is still a challenging task. This study introduced a recipe which assembled a novel electrode composite using a liquid phase plasma that was applied to a reactant solution containing an activated carbon (AC) powder with dual metal precursors of iron and manganese. A comparison was made between the composites doped with single and dual metal components as well as among those synthesized under different precursor concentrations and plasma durations. The results showed that increasing the precursor concentration and plasma duration raised the content of both metal oxides in the composites, whereas the deposition conditions were more favorable to iron oxide than manganese oxide, due to its higher standard potential. The composite treated with the longest plasma duration and highest manganese concentration was superior to the others in terms of cyclic stability and equivalent series resistance. In addition, the new composite selected out of them showed better electrochemical performance than the raw AC material only and even two types of single metal-based composites, owing largely to the synergistic effect of the two metal oxides. Therefore, the proposed methodology can be used to modify existing and future composite electrodes to improve their performance with relatively cheap host and guest materials. Copyright © 2017 Elsevier Ltd. All rights reserved.

Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

DEFF Research Database (Denmark)

Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

2013-01-01

sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...

The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology

Directory of Open Access Journals (Sweden)

Anja Pahor

2018-01-01

Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.

AC power losses in Bi-2223/Ag HTS tapes

International Nuclear Information System (INIS)

Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.

1998-01-01

Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

Nuclear structure of {sup 231}Ac

Energy Technology Data Exchange (ETDEWEB)

Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

2008-10-15

The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

Statistical time lags in ac discharges

International Nuclear Information System (INIS)

Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F

2011-01-01

The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

Statistical time lags in ac discharges

Energy Technology Data Exchange (ETDEWEB)

Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)

2011-04-06

The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

Study on AC loss measurements of HTS power cable for standardizing

Science.gov (United States)

Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi

2017-09-01

High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..

a.c. conductance study of polycrystal C60

International Nuclear Information System (INIS)

Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin

1995-01-01

The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))

Study of plasma-wall interactions in Tore-supra; Etude des phenomenes d'interaction plasma/paroi dans Tore Supra

Energy Technology Data Exchange (ETDEWEB)

Ruggieri, R

2000-01-01

In tokamaks the interaction between wall and plasma generates impurities that affect the thermonuclear fusion. This thesis is divided into 2 parts. The first part describes the physico-chemical processes that are involved in chemical erosion, the second part deals with the study of the wear of Tore-supra's walls due to chemical erosion. Chapter 1 presents the wall-plasma interaction and reviews the different processes between plasma and carbon that occur in Tore-supra. Chapter 2 considers the various crystallographic and electronic structures of the carbon that interferes with Tore-supra plasma, the evolution of these structures during irradiation and their temperature dependence are studied. Chapter 3 presents a crystallo-chemical study of graphite samples that have undergone different surface treatments: ionic bombardment, annealing and air exposure. This experimental study has been performed by using energy-loss spectroscopy. It is shown that air exposure modifies the crystallo-chemical structure of surfaces, so it is necessary to prevent air from contaminating wall samples from Tore-supra. Chapter 4 presents a parametric study of chemical erosion rate of plasma facing components (LPM) of Tore-supra. A relation such as Y{sub cd4}{alpha}{gamma}{sup -0.1} gives a good agreement for chemical erosion rate between measurements and the numerical values of the simulation. (A.C.)

Control of Power Converters in AC Microgrids

DEFF Research Database (Denmark)

Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

2012-01-01

The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

Droop-free Distributed Control for AC Microgrids

DEFF Research Database (Denmark)

Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.

2016-01-01

A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...

Effect of AC electric fields on the stabilization of premixed bunsen flames

KAUST Repository

Kim, Minkuk

2011-01-01

The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

Large-aperture Tunable Plasma Meta-material to Interact with Electromagnetic Waves

Science.gov (United States)

Corke, Thomas; Matlis, Eric

2016-11-01

The formation of spatially periodic arrangements of glow discharge plasma resulting from charge instabilities were investigated as a tuneable plasma meta-material. The plasma was formed between two 2-D parallel dielectric covered electrodes: one consisting of an Indium-Tin-Oxide coated glass sheet, and the other consisting of a glass-covered circular electrode. The dielectric covered electrodes were separated by a gap that formed a 2-D channel. The gap spacing was adjustable. The electrodes were powered by a variable amplitude AC generator. The parallel electrode arrangement was placed in a variable pressure vacuum chamber. Various combinations of gap spacing, pressure and voltage resulted in the formation of spatially periodic arrangements (lattice) of glow discharge plasma. The lattice spacing perfectly followed 2-D packing theory, and was fully adjustable through the three governing parameters. Lattice arrangements were designed to interact with electromagnetic (EM) waves in the frequency range between 10GHz-80GHz. Its feasibility was investigate through an EM wave simulation that we adapted to allow for plasma permittivity. The results showed a clear suppression of the EM wave amplitude through the plasma gratings. Supported by AFOSR.

Active probing of plasma edge turbulence and feedback studies on the Texas Experimental Tokamak (TEXT)

International Nuclear Information System (INIS)

Uckan, T.; Richards, B.; Bengtson, R.D.

1993-08-01

A novel experiment is under way on the Texas Experimental Tokamak (TEXT) to actively modify the turbulence at the plasma edge by launching waves using electrostatic probes in the shadow of the limiter. The experiments are carried out with a wave launching system consisting of two Langmuir probes, which are about 1.8 cm apart in the poloidal direction, with respect to the magnetic field. These probes are operated in the electron side of the (I,V) characteristic. The probe tips are fed separately by independent ac power supplies. Measurements indicate that the wave, launched with a typical frequency image of 15--50 kHz from the edge of the machine top, is received by sensing probes located halfway around the torus. The detected signal strength depends on the frequency of the wave, the plasma current, and the phasing of the applied ac signal between the launching probes. Modifications to the spectra of the density and potential fluctuations are observed. These experiments have been extended to control of the edge plasma fluctuation level using feedback to explore its effects on confinement. When the launcher is driven by the floating potential of the fluctuating plasma at the location of the launching probes, then the fluctuations are suppressed or excited, depending on the phasing between the probe tips, both locally and at the downstream sensing probes. The fluctuation-induced particle flux also varies with the feedback phasing

Objectives and status of development of AC600

International Nuclear Information System (INIS)

Zhao Chengkun

1997-01-01

AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600

Introduction of hvdc transmission into a predominantly ac network

Energy Technology Data Exchange (ETDEWEB)

Casson, W; Last, F H; Huddart, K W

1966-02-01

Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.

21 CFR 880.5510 - Non-AC-powered patient lift.

Science.gov (United States)

2010-04-01

...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...

Effect of temperature on the AC impedance of protein

Indian Academy of Sciences (India)

The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...

Study of atmospheric air AC glow discharge using optical emission spectroscopy and near infrared diode laser cavity ringdown spectroscopy

Science.gov (United States)

Srivastava, Nimisha; Wang, Chuji; Dibble, Theodore S.

2008-11-01

AC glow discharges were generated in atmospheric pressure by applying high voltage AC in the range of 3500-15000 V to a pair of stainless steel electrodes separated by an air gap. The discharges were characterized by optical emission spectroscopy (OES) and continuous wave cavity ringdown spectroscopy (cw-CRDS). The electronic (Tex), vibrational (Tv), and rotational (Tr) temperatures were measured. Spectral stimulations of the emission spectra of several vibronic bands of the 2^nd positive system of N2, the 1^st negative system of N2^+, the (0,1,2,3-0) bands of NO (A-X), and the (0-0) band of OH (A-X), which were obtained under various plasma operating conditions, show that Tr, Tv, and Tex are in the ranges of 2000 - 3800, 3500 - 5000, and 6000 - 10500^ K, respectively. Emission spectra show that OH concentration increases while NO concentration decreases with an increase of electrode spacing. The absorption spectra of H2O and OH overtone in the near infrared (NIR) were measured by the cw-CRDS with a telecommunications diode laser at wavelength near 1515 nm.

Time-dependent simulation of plasma and electrodes in high-intensity discharge lamps with different electrode shapes

CERN Document Server

Flesch, P

2003-01-01

The subject of this paper is the modelling of d.c. and a.c. high-intensity Hg-discharge lamps with differently shaped electrodes. Different arc attachments on the electrodes are studied and insight for the development of new electrodes is gained. The model includes the entire discharge plasma (plasma column, hot plasma spots in front of electrodes, near-electrode non-LTE-plasma) as well as anode and cathode. No subdivision of the discharge space into different regions is necessary (like space charge layer, ionization zone, plasma column). This is achieved by using a differential equation for a non-LTE electrical conductivity which is applicable for local thermal equilibrium (LTE-)regions as well as for non-LTE plasma regions close to the electrodes in a high pressure plasma. Modelling results for a 0.6 MPa mercury discharge considering six different electrode shapes (anode and cathode) are presented and compared with experimental results. The electrodes have different diameters and different electrode tips, s...

Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

Directory of Open Access Journals (Sweden)

Vinod Kumar Singh

2016-09-01

Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

Plasma Polymerized Thin Films of Maleic Anhydride and 1,2-methylenedioxybenzene for Improving Adhesion to Carbon Surfaces

DEFF Research Database (Denmark)

Drews, Joanna Maria; Goutianos, Stergios; Kingshott, Peter

2007-01-01

Low power 2-phase AC plasma polymerization has been used to surface modify glassy carbon substrates that are used as an experimental model for carbon fibers in reinforced composites. In order to probe the role of carboxylic acid density on the interfacial adhesion strength a combination...

Research on Two-channel Interleaved Two-stage Paralleled Buck DC-DC Converter for Plasma Cutting Power Supply

DEFF Research Database (Denmark)

Yang, Xi-jun; Qu, Hao; Yao, Chen

2014-01-01

As for high power plasma power supply, due to high efficiency and flexibility, multi-channel interleaved multi-stage paralleled Buck DC-DC Converter becomes the first choice. In the paper, two-channel interleaved two- stage paralleled Buck DC-DC Converter powered by three-phase AC power supply...

Effect of the valence electron concentration on the bulk modulus and chemical bonding in Ta2AC and Zr2AC (A=Al, Si, and P)

International Nuclear Information System (INIS)

Schneider, Jochen M.; Music, Denis; Sun Zhimei

2005-01-01

We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion

Low ac loss geometries in YBCO coated conductors and impact on conductor stability

Energy Technology Data Exchange (ETDEWEB)

Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.

Communication through a plasma sheet around a fast moving vehicle

Science.gov (United States)

Sotnikov, V. I.; Mudaliar, S.; Genoni, T.; Rose, D.; Oliver, B. V.; Mehlhorn, T. A.

2011-10-01

Investigation of the complicated problem of scattering of electromagnetic waves on turbulent pulsations induced by a sheared flow inside a plasma sheath is important for many applications including communication with hypersonic and re-entry vehicles. Theoretical and computational work aimed at improving the understanding of electromagnetic wave scattering processes in such turbulent plasmas is presented. We analyze excitation of low frequency ion-acoustic type oscillations in a compressible plasma flow with flow velocity shear and influence of such turbulent pulsations on scattering of high frequency electromagnetic waves used for communication purposes. We have appropriately included in our analysis the presence of electron and ion collisions with neutrals as well as electron - ion collisions. Results of numerical solutions for plasma density and electric field perturbations for different velocity profiles have been used in the derived expressions for scattered wave energy and scattering cross section. Work supported by the Air Force Research Laboratory and Air Force Office Of Scientific Research Sandia is a multiprogram laboratory operated by Sandia Corporation, A Lockheed Martin Company, under contract DE-AC04-94AL85000.

Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven

International Nuclear Information System (INIS)

Smedley, K.

1992-04-01

The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab

Flame spread over inclined electrical wires with AC electric fields

KAUST Repository

Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho

2017-01-01

Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field

DC and AC biasing of a transition edge sensor microcalorimeter

International Nuclear Information System (INIS)

Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.

2002-01-01

We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode

Directory of Open Access Journals (Sweden)

Dwi Riana Aryani

2016-06-01

Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.

Aragonite coating solutions (ACS) based on artificial seawater

International Nuclear Information System (INIS)

Tas, A. Cuneyt

2015-01-01

Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry

Aragonite coating solutions (ACS) based on artificial seawater

Energy Technology Data Exchange (ETDEWEB)

Tas, A. Cuneyt, E-mail: c_tas@hotmail.com

2015-03-01

Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

Abscisic Acid Antagonizes Ethylene Production through the ABI4-Mediated Transcriptional Repression of ACS4 and ACS8 in Arabidopsis.

Science.gov (United States)

Dong, Zhijun; Yu, Yanwen; Li, Shenghui; Wang, Juan; Tang, Saijun; Huang, Rongfeng

2016-01-04

Increasing evidence has revealed that abscisic acid (ABA) negatively modulates ethylene biosynthesis, although the underlying mechanism remains unclear. To identify the factors involved, we conducted a screen for ABA-insensitive mutants with altered ethylene production in Arabidopsis. A dominant allele of ABI4, abi4-152, which produces a putative protein with a 16-amino-acid truncation at the C-terminus of ABI4, reduces ethylene production. By contrast, two recessive knockout alleles of ABI4, abi4-102 and abi4-103, result in increased ethylene evolution, indicating that ABI4 negatively regulates ethylene production. Further analyses showed that expression of the ethylene biosynthesis genes ACS4, ACS8, and ACO2 was significantly decreased in abi4-152 but increased in the knockout mutants, with partial dependence on ABA. Chromatin immunoprecipitation-quantitative PCR assays showed that ABI4 directly binds the promoters of these ethylene biosynthesis genes and that ABA enhances this interaction. A fusion protein containing the truncated ABI4-152 peptide accumulated to higher levels than its full-length counterpart in transgenic plants, suggesting that ABI4 is destabilized by its C terminus. Therefore, our results demonstrate that ABA negatively regulates ethylene production through ABI4-mediated transcriptional repression of the ethylene biosynthesis genes ACS4 and ACS8 in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.

The Cryogenic Anti-Coincidence detector for ATHENA X-IFU: pulse analysis of the AC-S7 single pixel prototype

Science.gov (United States)

D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.

2016-07-01

The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC particle rejection efficiency.

Arc Voltage Fluctuation in DC Laminar and Turbulent Plasma Jets Generation

International Nuclear Information System (INIS)

Pan Wenxia; Meng Xian; Wu Chengkang

2006-01-01

Arc voltage fluctuations in a direct current (DC) non-transferred arc plasma generator are experimentally studied, in generating a jet in the laminar, transitional and turbulent regimes. The study is with a view toward elucidating the mechanism of the fluctuations and their relationship with the generating parameters, arc root movement and flow regimes. Results indicate that the existence of a 300 Hz alternating current (AC) component in the power supply ripples does not cause the transition of the laminar plasma jet into a turbulent state. There exists a high frequency fluctuation at 4 kHz in the turbulent jet regime. It may be related to the rapid movement of the anode attachment point of the arc

In-situ polymerisation of fully bioresorbable polycaprolactone/phosphate glass fibre composites: In vitro degradation and mechanical properties.

Science.gov (United States)

Chen, Menghao; Parsons, Andrew J; Felfel, Reda M; Rudd, Christopher D; Irvine, Derek J; Ahmed, Ifty

2016-06-01

Fully bioresorbable composites have been investigated in order to replace metal implant plates used for hard tissue repair. Retention of the composite mechanical properties within a physiological environment has been shown to be significantly affected due to loss of the integrity of the fibre/matrix interface. This study investigated phosphate based glass fibre (PGF) reinforced polycaprolactone (PCL) composites with 20%, 35% and 50% fibre volume fractions (Vf) manufactured via an in-situ polymerisation (ISP) process and a conventional laminate stacking (LS) followed by compression moulding. Reinforcing efficiency between the LS and ISP manufacturing process was compared, and the ISP composites revealed significant improvements in mechanical properties when compared to LS composites. The degradation profiles and mechanical properties were monitored in phosphate buffered saline (PBS) at 37°C for 28 days. ISP composites revealed significantly less media uptake and mass loss (pproperties of ISP composites were substantially higher (p<0.0001) than those of the LS composites, which showed that the ISP manufacturing process provided a significantly enhanced reinforcement effect than the LS process. During the degradation study, statistically higher flexural property retention profiles were also seen for the ISP composites compared to LS composites. SEM micrographs of fracture surfaces for the LS composites revealed dry fibre bundles and poor fibre dispersion with polymer rich zones, which indicated poor interfacial bonding, distribution and adhesion. In contrast, evenly distributed fibres without dry fibre bundles or polymer rich zones, were clearly observed for the ISP composite samples, which showed that a superior fibre/matrix interface was achieved with highly improved adhesion. Copyright © 2015 Elsevier Ltd. All rights reserved.

Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies

Science.gov (United States)

Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.

2016-11-01

We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.

Development of low AC loss windings for superconducting traction transformer

International Nuclear Information System (INIS)

Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K

2010-01-01

We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.

Hybrid AC-High Voltage DC Grid Stability and Controls

Science.gov (United States)

Yu, Jicheng

The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

Material for electrodes of low temperature plasma generators

Science.gov (United States)

Caplan, Malcolm; Vinogradov, Sergel Evge'evich; Ribin, Valeri Vasil'evich; Shekalov, Valentin Ivanovich; Rutberg, Philip Grigor'evich; Safronov, Alexi Anatol'evich

2008-12-09

Material for electrodes of low temperature plasma generators. The material contains a porous metal matrix impregnated with a material emitting electrons. The material uses a mixture of copper and iron powders as a porous metal matrix and a Group IIIB metal component such as Y.sub.2O.sub.3 is used as a material emitting electrons at, for example, the proportion of the components, mass %: iron: 3-30; Y.sub.2O.sub.3:0.05-1; copper: the remainder. Copper provides a high level of heat conduction and electric conductance, iron decreases intensity of copper evaporation in the process of plasma creation providing increased strength and lifetime, Y.sub.2O.sub.3 provides decreasing of electronic work function and stability of arc burning. The material can be used for producing the electrodes of low temperature AC plasma generators used for destruction of liquid organic wastes, medical wastes, and municipal wastes as well as for decontamination of low level radioactive waste, the destruction of chemical weapons, warfare toxic agents, etc.

AC Calorimetric Design for Dynamic of Biological Materials

OpenAIRE

Shigeo Imaizumi

2006-01-01

We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...

High power plasma heating experiments on the Proto-MPEX facility

Science.gov (United States)

Bigelow, T. S.; Beers, C. J.; Biewer, T. M.; Caneses, J. F.; Caughman, J. B. O.; Diem, S. J.; Goulding, R. H.; Green, D. L.; Kafle, N.; Rapp, J.; Showers, M. A.

2017-10-01

Work is underway to maximize the power delivered to the plasma that is available from heating sources installed on the Prototype Materials Plasma Exposure eXperiment (Proto-MPEX) at ORNL. Proto-MPEX is a linear device that has a >100 kW, 13.56 MHz helicon plasma generator available and is intended for material sample exposure to plasmas. Additional plasma heating systems include a 10 kW 18 GHz electron cyclotron heating (ECH) system, a 25 kW 8 MHz ion cyclotron heating ICH system, and a 200 kW 28 GHz electron Bernstein wave (EBW) and ECH system. Most of the heating systems have relatively good power transmission efficiency, however, the 28 GHz EBW system has a lower efficiency owing to stringent requirements on the microwave launch characteristics for EBW coupling combined with the lower output mode purity of the early-model gyrotron in use and its compact mode converter system. A goal for the Proto-MPEX is to have a combined heating power of 200 kW injected into the plasma. Infrared emission diagnostics of the target plate combined with Thomson Scattering, Langmuir probe, and energy analyzer measurements near the target are utilized to characterize the plasmas and coupling efficiency of the heating systems. ORNL is managed by UT-Battelle, LLC, for the U.S. DOE under contract DE-AC-05-00OR22725.

Effects of gas residence time of CH4/H2 on sp2 fraction of amorphous carbon films and dissociated methyl density during radical-injection plasma-enhanced chemical vapor deposition

Science.gov (United States)

Sugiura, Hirotsugu; Jia, Lingyun; Kondo, Hiroki; Ishikawa, Kenji; Tsutsumi, Takayoshi; Hayashi, Toshio; Takeda, Keigo; Sekine, Makoto; Hori, Masaru

2018-06-01

Quadruple mass spectrometric measurements of CH3 density during radical-injection plasma-enhanced chemical vapor deposition to consider the sp2 fraction of amorphous carbon (a-C) films were performed. The sp2 fraction of the a-C films reached a minimum of 46%, where the CH3 density was maximum for a residence time of 6 ms. The sp2 fraction of the a-C films was tailored with the gaseous phase CH3 density during the deposition. This knowledge is useful for understanding the formation mechanism of bonding structures in the a-C films, which enables the precise control of their electronic properties.

Study of dielectric relaxation and AC conductivity of InP:S single crystal

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.

2012-07-01

The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.

Self-field AC losses in Bi-2223 superconducting tapes

International Nuclear Information System (INIS)

Mueller, K. H.; Leslie, K.E.

1996-01-01

Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed

AC susceptibility of thin Pb films in intermediate and mixed state

Energy Technology Data Exchange (ETDEWEB)

Janu, Zdenek, E-mail: janu@fzu.cz [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Svindrych, Zdenek [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Trunecek, Otakar [Charles University in Prague, Faculty of Mathematics and Physics, Ke Karlovu 3, CZ-121 16 Prague 2 (Czech Republic); Kus, Peter; Plecenik, Andrej [Komenius University in Bratislava, Faculty of Mathematics, Physics, and Informatics, Mlynska dolina, 842 48 Bratislava 4 (Slovakia)

2011-12-15

Thickness dependent transition in AC susceptibility between intermediate and mixed state in type-I superconducting films. The temperature induced crossover between reversible and irreversible behavior was observed in the thicker film. The temperature dependence of the AC susceptibility in mixed state follows prediction of model based on Bean critical state. The temperature dependence of the harmonics of the complex AC susceptibility in the intermediate state is explained. Thin films of type I superconductors of a thickness comparable or less than a flux penetration length behave like type II superconductors in a mixed state. With decreasing film thickness normal domains carrying a magnetic flux get smaller with smaller number of flux quanta per domain and finally transform into single quantum flux lines, i.e. quantum vortices similar to those found in type II superconductors. We give an evidence of this behavior from the measurements of the nonlinear response of a total magnetic moment to an applied AC magnetic field, directly from the temperature dependence of an AC susceptibility.

Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

Science.gov (United States)

Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.

2010-11-01

AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

Flexible AC transmission systems: the state of the art

Energy Technology Data Exchange (ETDEWEB)

Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

1994-12-31

Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

Operation of AC Adapters Visualized Using Light-Emitting Diodes

Science.gov (United States)

Regester, Jeffrey

2016-01-01

A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

A.C. losses in current-carrying superconductors

International Nuclear Information System (INIS)

Reuver, J.L. de.

1985-01-01

The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

Logistics Reduction: Advanced Clothing System (ACS)

Data.gov (United States)

National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

Investigation on structural, optical and electrical properties of polythiophene-Al2O3 composites

Science.gov (United States)

Vijeth, H.; Yesappa, L.; Niranjana, M.; Ashokkumar, S. P.; Devendrappa, H.

2018-05-01

The polythiophene (PTH) and polythiophene-Al2O3 composites prepared by in situ chemical polymerisation in the presence of anionic surfactant camphor sulfonic acid (CSA). The formation of composite is confirmed by X-ray Diffraction (XRD) and Energy Dispersive X-ray spectroscopy (EDX) analysis. The surface morphology was studied using Field Emission Electron Microscopy (FESEM). Optical properties was studied using UV-visible spectroscopy, it observed decrease in the band gap reveals material has potential application in optical devices. The dielectric constant and AC conductivity of composite have been studied for different temperature in the frequency range 1 kHz -1 MHz.

Early function of the Abutilon mosaic virus AC2 gene as a replication brake.

Science.gov (United States)

Krenz, Björn; Deuschle, Kathrin; Deigner, Tobias; Unseld, Sigrid; Kepp, Gabi; Wege, Christina; Kleinow, Tatjana; Jeske, Holger

2015-04-01

The C2/AC2 genes of monopartite/bipartite geminiviruses of the genera Begomovirus and Curtovirus encode important pathogenicity factors with multiple functions described so far. A novel function of Abutilon mosaic virus (AbMV) AC2 as a replication brake is described, utilizing transgenic plants with dimeric inserts of DNA B or with a reporter construct to express green fluorescent protein (GFP). Their replicational release upon AbMV superinfection or the individual and combined expression of epitope-tagged AbMV AC1, AC2, and AC3 was studied. In addition, the effects were compared in the presence and in the absence of an unrelated tombusvirus suppressor of silencing (P19). The results show that AC2 suppresses replication reproducibly in all assays and that AC3 counteracts this effect. Examination of the topoisomer distribution of supercoiled DNA, which indicates changes in the viral minichromosome structure, did not support any influence of AC2 on transcriptional gene silencing and DNA methylation. The geminiviral AC2 protein has been detected here for the first time in plants. The experiments revealed an extremely low level of AC2, which was slightly increased if constructs with an intron and a hemagglutinin (HA) tag in addition to P19 expression were used. AbMV AC2 properties are discussed with reference to those of other geminiviruses with respect to charge, modification, and size in order to delimit possible reasons for the different behaviors. The (A)C2 genes encode a key pathogenicity factor of begomoviruses and curtoviruses in the plant virus family Geminiviridae. This factor has been implicated in the resistance breaking observed in agricultural cotton production. AC2 is a multifunctional protein involved in transcriptional control, gene silencing, and regulation of basal biosynthesis. Here, a new function of Abutilon mosaic virus AC2 in replication control is added as a feature of this protein in viral multiplication, providing a novel finding on

Monolithic blue LED series arrays for high-voltage AC operation

Energy Technology Data Exchange (ETDEWEB)

Ao, Jin-Ping [Satellite Venture Business Laboratory, University of Tokushima, Tokushima 770-8506 (Japan); Sato, Hisao; Mizobuchi, Takashi; Morioka, Kenji; Kawano, Shunsuke; Muramoto, Yoshihiko; Sato, Daisuke; Sakai, Shiro [Nitride Semiconductor Co. Ltd., Naruto, Tokushima 771-0360 (Japan); Lee, Young-Bae; Ohno, Yasuo [Department of Electrical and Electronic Engineering, University of Tokushima, Tokushima 770-8506 (Japan)

2002-12-16

Design and fabrication of monolithic blue LED series arrays that can be operated under high ac voltage are described. Several LEDs, such as 3, 7, and 20, are connected in series and in parallel to meet ac operation. The chip size of a single device is 150 {mu}m x 120 {mu}m and the total size is 1.1 mm x 1 mm for a 40(20+20) LED array. Deep dry etching was performed as device isolation. Two-layer interconnection and air bridge are utilized to connect the devices in an array. The monolithic series array exhibit the expected operation function under dc and ac bias. The output power and forward voltage are almost proportional to LED numbers connected in series. On-wafer measurement shows that the output power is 40 mW for 40(20+20) LED array under ac 72 V. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

pH sensing via bicarbonate-regulated ‘soluble’ adenylyl cyclase (sAC

Directory of Open Access Journals (Sweden)

Nawreen eRahman

2013-11-01

Full Text Available Soluble adenylyl cyclase (sAC is a source of the second messenger cyclic adenosine 3',5' monophosphate (cAMP. sAC is directly regulated by bicarbonate (HCO3- ions. In living cells, HCO3- ions are in nearly instantaneous equilibrium with carbon dioxide (CO2 and pH due to the ubiquitous presence of carbonic anhydrases. Numerous biological processes are regulated by CO2, HCO3-, and/or pH, and in a number of these, sAC has been shown to function as a physiological CO2/HCO3/pH sensor. In this review, we detail the known pH sensing functions of sAC, and we discuss two highly-studied, pH-dependent pathways in which sAC might play a role.

Studies on the relationship between plasma CRP and TNF-α, IL-1β levels in aged patients with acute coronary syndrome

International Nuclear Information System (INIS)

Luo Nanping; Wang Xiangang; Hu Chengjin; Wang Ruishan

2002-01-01

Objective: To investigate the relationship between plasma TNF-α, IL-1β and CRP levels in aged patients with coronary heart disease and to define the inflammation marker which might recognize and predict acute coronary syndrome. Methods: Radioimmunoassay was used to detect plasma levels of TNF-α, IL-1β and CRP. Results: Plasma levels of TNF-α and IL-β in patients with acute coronary syndrome (ACS) were significantly higher than those in controls (p<0.05; p<0.01) and stable coronary heart disease (SCHD) (p<0.05; p<0.01). Plasma CRP levels in patients with ACS (7.99 +- 11.9 ml/L) were also significantly higher than those in controls (0.99 +- 1.5 mg/L; p<0.01) and patients with SCHD (2.71 +- 5.45 mg/L; p<0.05). There was positive correlation between CRP level and TNF-α (r=0.0545; p<0.01) as well as IL-β (r=0.31, p<0.05). Conclusion: The abnormal expression of cytokines in aged patients with coronary heart disease was correlative to inflammation marker CRP, which suggested that the abnormal expression to the occurrence of acute coronary syndrome and might serve as a marker of unstable atherosclerosis plaque

Normal form of particle motion under the influence of an ac dipole

Directory of Open Access Journals (Sweden)

R. Tomás

2002-05-01

Full Text Available ac dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the ac dipole is adiabatically turned on and off. Therefore the ac dipole seems to be an adequate tool for nonlinear diagnostics provided the particle motion is well described in the presence of the ac dipole and nonlinearities. Normal forms and Lie algebra are powerful tools to study the nonlinear content of an accelerator lattice. In this article a way to obtain the normal form of the Hamiltonian of an accelerator with an ac dipole is described. The particle motion to first order in the nonlinearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the ac dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn motion and the Hamiltonian terms.

Improved transistorized AC motor controller for battery powered urban electric passenger vehicles

Science.gov (United States)

Peak, S. C.

1982-01-01

An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.

Low-frequency, self-sustained oscillations in inductively coupled plasmas used for optical pumping

Energy Technology Data Exchange (ETDEWEB)

Coffer, J.; Encalada, N.; Huang, M.; Camparo, J. [Physical Sciences Laboratories, The Aerospace Corporation 2310, E. El Segundo Blvd., El Segundo, California 90245 (United States)

2014-10-28

We have investigated very low frequency, on the order of one hertz, self-pulsing in alkali-metal inductively-coupled plasmas (i.e., rf-discharge lamps). This self-pulsing has the potential to significantly vary signal-to-noise ratios and (via the ac-Stark shift) resonant frequencies in optically pumped atomic clocks and magnetometers (e.g., the atomic clocks now flying on GPS and Galileo global navigation system satellites). The phenomenon arises from a nonlinear interaction between the atomic physics of radiation trapping and the plasma's electrical nature. To explain the effect, we have developed an evaporation/condensation theory (EC theory) of the self-pulsing phenomenon.

Global Modeling of Uranium Molecular Species Formation Using Laser-Ablated Plasmas

Science.gov (United States)

Curreli, Davide; Finko, Mikhail; Azer, Magdi; Armstrong, Mike; Crowhurst, Jonathan; Radousky, Harry; Rose, Timothy; Stavrou, Elissaios; Weisz, David; Zaug, Joseph

2016-10-01

Uranium is chemically fractionated from other refractory elements in post-detonation nuclear debris but the mechanism is poorly understood. Fractionation alters the chemistry of the nuclear debris so that it no longer reflects the chemistry of the source weapon. The conditions of a condensing fireball can be simulated by a low-temperature plasma formed by vaporizing a uranium sample via laser heating. We have developed a global plasma kinetic model in order to model the chemical evolution of U/UOx species within an ablated plasma plume. The model allows to track the time evolution of the density and energy of an uranium plasma plume moving through an oxygen atmosphere of given fugacity, as well as other relevant quantities such as average electron and gas temperature. Comparison of model predictions with absorption spectroscopy of uranium-ablated plasmas provide preliminary insights on the key chemical species and evolution pathways involved during the fractionation process. This project was sponsored by the DoD, Defense Threat Reduction Agency, Grant HDTRA1-16-1-0020. This work was performed in part under the auspices of the U.S. DoE by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.

Maternal plasma pyridoxal-5'-phosphate concentrations and risk of isolated oral clefts in the Philippines.

Science.gov (United States)

Tamura, Tsunenobu; Munger, Ronald G; Nepomuceno, Buena; Corcoran, Christopher; Cembrano, Joselito; Solon, Florentino

2007-04-01

We report that inadequate vitamin B-6 status of Filipino mothers, assessed by erythrocyte aspartate aminotransferase activity coefficient (EAST-AC), is associated with an increased risk for isolated cleft lip with or without cleft palate (CL/P) in their children. Its association with the status assessed by plasma pyridoxal-5'-phosphate (PLP) concentrations is unknown. In a case-control study in the Philippines including 46 cases (mothers of a child with CL/P) and 392 controls (mothers of an unaffected child), we evaluated the association between the risk for CL/P and maternal vitamin B-6 status assessed by PLP and EAST-AC. The ORs of CL/P were estimated by classifying mothers by PLP (>30, 20-30, and values, compared to those with adequate status by both values. Inadequate vitamin B-6 status assessed by maternal PLP and EAST-AC values independently and both combined was associated with an increased risk for CL/P. The association was highest when both values were considered, suggesting that the measurement of both PLP and EAST-AC provides better assessment of vitamin B-6 status than either measurement alone.

Analysis of Input and Output Ripples of PWM AC Choppers

Directory of Open Access Journals (Sweden)

Pekik Argo Dahono

2008-11-01

Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

Cosmic shear analysis of archival HST/ACS data. I. Comparison of early ACS pure parallel data to the HST/GEMS survey

Science.gov (United States)

Schrabback, T.; Erben, T.; Simon, P.; Miralles, J.-M.; Schneider, P.; Heymans, C.; Eifler, T.; Fosbury, R. A. E.; Freudling, W.; Hetterscheidt, M.; Hildebrandt, H.; Pirzkal, N.

2007-06-01

Context: This is the first paper of a series describing our measurement of weak lensing by large-scale structure, also termed “cosmic shear”, using archival observations from the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope (HST). Aims: In this work we present results from a pilot study testing the capabilities of the ACS for cosmic shear measurements with early parallel observations and presenting a re-analysis of HST/ACS data from the GEMS survey and the GOODS observations of the Chandra Deep Field South (CDFS). Methods: We describe the data reduction and, in particular, a new correction scheme for the time-dependent ACS point-spread-function (PSF) based on observations of stellar fields. This is currently the only technique which takes the full time variation of the PSF between individual ACS exposures into account. We estimate that our PSF correction scheme reduces the systematic contribution to the shear correlation functions due to PSF distortions to MUSIC sample, we determine a local single field estimate for the mass power spectrum normalisation σ8, CDFS=0.52+0.11-0.15 (stat) ± 0.07(sys) (68% confidence assuming Gaussian cosmic variance) at a fixed matter density Ω_m=0.3 for a ΛCDM cosmology marginalising over the uncertainty of the Hubble parameter and the redshift distribution. We interpret this exceptionally low estimate to be due to a local under-density of the foreground structures in the CDFS. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archives at the Space Telescope European Coordinating Facility and the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.

Pantallas acústicas submarinas de material compuesto multilaminar con matriz metálica

OpenAIRE

Gallego, V.; Laguna, M.; Vázquez, A. J.

1999-01-01

7 pp.-- PACS nr.: 43.30.Ky.-- Comunicación presentada en los siguientes congresos: XXX Jornadas Nacionales de Acústica – TecniAcústica 1999. Encuentro Ibérico de Acústica (Ávila, 20-22 Octubre 1999).

ac superconducting articles

International Nuclear Information System (INIS)

Meyerhoff, R.W.

1977-01-01

A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface

Autonomous Operation of Hybrid Microgrid with AC and DC Sub-Grids

DEFF Research Database (Denmark)

Loh, Poh Chiang; Blaabjerg, Frede

2011-01-01

the power flow among all the sources distributed throughout the two types of sub-grids, which certainly is tougher than previous efforts developed for only either ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc...... sources, ac sources and interlinking converters. Suitable control and normalization schemes are therefore developed for controlling them with results presented for showing the overall performance of the hybrid microgrid.......This paper investigates on the active and reactive power sharing of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac sub-grids, interconnected by power electronic interfaces. The main challenge here is to manage...

A Floquet-Green's function approach to mesoscopic transport under ac bias

International Nuclear Information System (INIS)

Wu, B H; Cao, J C

2008-01-01

The current response of a mesoscopic system under a periodic ac bias is investigated by combining the Floquet theorem and the nonequilibrium Green's function method. The band structure of the lead under ac bias is fully taken into account by using appropriate self-energies in an enlarged Floquet space. Both the retarded and lesser Green's functions are obtained in the Floquet basis to account for the interference and interaction effects. In addition to the external ac bias, the time-varying Coulomb interaction, which is treated at the self-consistent Hartree-Fock level, provides another internal ac field. The numerical results show that the time-varying Coulomb field yields decoherence and reduces the ringing behavior of the current response to a harmonic bias

Optimal football strategies: AC Milan versus FC Barcelona

OpenAIRE

Papahristodoulou, Christos

2012-01-01

In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

Preliminary design of reactor coolant pump canned motor for AC600

International Nuclear Information System (INIS)

Deng Shaowen

1998-01-01

The reactor coolant pump canned motor of AC600 PWR is the kind of shielded motors with high moment of inertia, high reliability, high efficiency and nice starting performance. The author briefly presents the main feature, design criterion and technical requirements, preliminary design, computation results and analysis of performance of AC600 reactor coolant pump canned motor, and proposes some problems to be solved for study and design of AC600 reactor coolant pump canned motor

Analytical theory and possible detection of the ac quantum spin Hall effect.

Science.gov (United States)

Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y

2017-07-11

We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.

The Hubble Legacy Archive ACS grism data

Science.gov (United States)

Kümmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.

2011-06-01

A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 μm, with a dispersion of 40 Å/pixel and a resolution of ~80 Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47 919 datasets (65% of the total number of extracted spectra) for 32 149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2 - 4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects

Alpha decay 225 Ac → 221Fr

International Nuclear Information System (INIS)

Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.

2004-01-01

Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the

Reducing AC-Winding Losses in High-Current High-Power Inductors

DEFF Research Database (Denmark)

Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.

2009-01-01

Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...

Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid

Directory of Open Access Journals (Sweden)

Dwi Riana Aryani

2017-11-01

Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.

On-Chip AC self-test controller

Science.gov (United States)

Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY

2009-09-29

A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

Ac-driven vortex-antivortex dynamics in nanostructured superconductor-ferromagnetic hybrids

Energy Technology Data Exchange (ETDEWEB)

Lima, Clessio L.S., E-mail: clsl@df.ufpe.br [Nucleo de Tecnologia, Centro Academico do Agreste, Universidade Federal de Pernambuco, 55002-970 Caruaru-PE (Brazil); Souza Silva, Clecio C. de; Aguiar, J. Albino [Departamento de Fisica, Universidade Federal de Pernambuco, 50670-901 Recife-PE (Brazil)

2012-09-15

The dynamics of ac-driven vortices and antivortices in a superconducting film interacting with an array of magnetic dipoles on top is investigated via hybrid molecular dynamics-Monte Carlo simulations. The dipole array considered in this study is capable to stabilize in equilibrium vortex-antivortex pairs. The appearance of a net electric field out of the ac excitation demonstrates that this system behaves as a voltage rectifier. Because of the asymmetric nature of the effective pinning potential generated by the dipole array, the ac-driven vortices and antivortices are ratcheted in opposite directions, thereby contributing additively to the observed net voltage. In addition, for high frequency values, the dc electric field-ac amplitude curves present a series of steps. A careful analysis of the time series of the electric field and number of vortex-antivortex (v-av) pairs reveals that these steps are related to mode-locking between the drive frequency and the number of v-av creation-annihilation events.

The Use of AC-DC-AC Methods in Assessing Corrosion Resistance Performance of Coating Systems for Magnesium Alloys

Science.gov (United States)

McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante

The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.

Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

Science.gov (United States)

Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.

2008-02-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.

Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

International Nuclear Information System (INIS)

Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C

2008-01-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability

AC conductivity for a holographic Weyl semimetal

Energy Technology Data Exchange (ETDEWEB)

Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)

2017-03-23

We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.

Influence of Arm-cranking on Changes in Plasma CK Activity after High Force Eccentric Exercise of the Elbow Flexors

OpenAIRE

Kosaka, Kazunori; Sakamoto, Kei; Newton, Mike

2002-01-01

NOSAKA, K., SAKAMOTO, K. and NEWTON, M., Influence of Armcranking on Changes in Plasma CK Activlty after High Force Eccentric Exerclse of the Elbow Flexours. Abv. Exerc. Sports Physiol., Vol.8, No.2 pp.45-50, 2002. It was hypothesized that the time course of changes in plasma creatine kinase(CK) activity following eccentrie exercise was influenced by rhythmical muscle contractions performned after eccentric exercise. This study examined whether arm-cranking (AC) alters the time course of chan...

Studies of Particle Wake Potentials in Plasmas

Science.gov (United States)

Ellis, Ian; Graziani, Frank; Glosli, James; Strozzi, David; Surh, Michael; Richards, David; Decyk, Viktor; Mori, Warren

2011-10-01

Fast Ignition studies require a detailed understanding of electron scattering, stopping, and energy deposition in plasmas with variable values for the number of particles within a Debye sphere. Presently there is disagreement in the literature concerning the proper description of these processes. Developing and validating proper descriptions requires studying the processes using first-principle electrostatic simulations and possibly including magnetic fields. We are using the particle-particle particle-mesh (PPPM) code ddcMD and the particle-in-cell (PIC) code BEPS to perform these simulations. As a starting point in our study, we examine the wake of a particle passing through a plasma in 3D electrostatic simulations performed with ddcMD and with BEPS using various cell sizes. In this poster, we compare the wakes we observe in these simulations with each other and predictions from Vlasov theory. Prepared by LLNL under Contract DE-AC52-07NA27344 and by UCLA under Grant DE-FG52-09NA29552.

Comparative single-cell genomics reveals potential ecological niches for the freshwater acI Actinobacteria lineage.

Science.gov (United States)

Ghylin, Trevor W; Garcia, Sarahi L; Moya, Francisco; Oyserman, Ben O; Schwientek, Patrick; Forest, Katrina T; Mutschler, James; Dwulit-Smith, Jeffrey; Chan, Leong-Keat; Martinez-Garcia, Manuel; Sczyrba, Alexander; Stepanauskas, Ramunas; Grossart, Hans-Peter; Woyke, Tanja; Warnecke, Falk; Malmstrom, Rex; Bertilsson, Stefan; McMahon, Katherine D

2014-12-01

Members of the acI lineage of Actinobacteria are the most abundant microorganisms in most freshwater lakes; however, our understanding of the keys to their success and their role in carbon and nutrient cycling in freshwater systems has been hampered by the lack of pure cultures and genomes. We obtained draft genome assemblies from 11 single cells representing three acI tribes (acI-A1, acI-A7, acI-B1) from four temperate lakes in the United States and Europe. Comparative analysis of acI SAGs and other available freshwater bacterial genomes showed that acI has more gene content directed toward carbohydrate acquisition as compared to Polynucleobacter and LD12 Alphaproteobacteria, which seem to specialize more on carboxylic acids. The acI genomes contain actinorhodopsin as well as some genes involved in anaplerotic carbon fixation indicating the capacity to supplement their known heterotrophic lifestyle. Genome-level differences between the acI-A and acI-B clades suggest specialization at the clade level for carbon substrate acquisition. Overall, the acI genomes appear to be highly streamlined versions of Actinobacteria that include some genes allowing it to take advantage of sunlight and N-rich organic compounds such as polyamines, di- and oligopeptides, branched-chain amino acids and cyanophycin. This work significantly expands the known metabolic potential of the cosmopolitan freshwater acI lineage and its ecological and genetic traits.

Effect of temperature on the AC impedance of protein and ...

Indian Academy of Sciences (India)

2016-08-26

Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...

Liquid Phase Plasma Synthesis of Iron Oxide Nanoparticles on Nitrogen-Doped Activated Carbon Resulting in Nanocomposite for Supercapacitor Applications.

Science.gov (United States)

Lee, Heon; Lee, Won-June; Park, Young-Kwon; Ki, Seo Jin; Kim, Byung-Joo; Jung, Sang-Chul

2018-03-25

Iron oxide nanoparticles supported on nitrogen-doped activated carbon powder were synthesized using an innovative plasma-in-liquid method, called the liquid phase plasma (LPP) method. Nitrogen-doped carbon (NC) was prepared by a primary LPP reaction using an ammonium chloride reactant solution, and an iron oxide/NC composite (IONCC) was prepared by a secondary LPP reaction using an iron chloride reactant solution. The nitrogen component at 3.77 at. % formed uniformly over the activated carbon (AC) surface after a 1 h LPP reaction. Iron oxide nanoparticles, 40~100 nm in size, were impregnated homogeneously over the NC surface after the LPP reaction, and were identified as Fe₃O₄ by X-ray photoelectron spectroscopy and X-ray diffraction. NC and IONCCs exhibited pseudo-capacitive characteristics, and their specific capacitance and cycling stability were superior to those of bare AC. The nitrogen content on the NC surface increased the compatibility and charge transfer rate, and the composites containing iron oxide exhibited a lower equivalent series resistance.

Calculation of single phase AC and monopolar DC hybrid corona effects

International Nuclear Information System (INIS)

Zhao, T.; Sebo, S.A.; Kasten, D.G.

1996-01-01

Operating a hybrid HVac and HVdc line is an option for increasing the efficiency of power transmission and overcoming the difficulties in obtaining a new right-of-way. This paper proposes a new calculation method for the study of hybrid line corona. The proposed method can be used to calculate dc corona losses and corona currents in dc or ac conductors for single phase ac and monopolar dc hybrid lines. Profiles of electric field strength and ion current density at ground level can be estimated. The effects of the presence of an energized ac conductor on dc conductor corona and dc voltage on ac conductor corona are included in the method. Full-scale and reduced-scale experiments were utilized to investigate the hybrid line corona effects. Verification of the proposed calculation method is given

In search of the quark-gluon plasma

International Nuclear Information System (INIS)

Schutz, Y.; Delagrange, H.

2002-01-01

This article describes in a very pedagogical manner the ultimate state of matter when quarks are no longer confined in hadrons. This state is called quark and gluon plasma, its existence is suspected through 4 facts: 1) a quark and gluon plasma that has just been created from a high energy ion-collision is mainly made up of light quarks (up and down), then this plasma should evolve towards other quarks (particularly strange quarks) because of the Pauli exclusion principle. This fact has been experimentally confirmed: at the CERN accelerator physicists have detected a higher production of strange hadrons when the energy of the collision increases; 2) some particles like ρ 0 mesons, that are made up of 2 quarks, are massively produced in ion collisions, their mass has been measured at the moment of the collision and later in the quark and gluon plasma, 2 different values have been found so it confirms the theory that predicts that free quarks have a mass that decreases as energy increases; 3) J/Ψ mesons are made up of a charmed quark combined with its anti-quark, physicists have noticed that less J/Ψ mesons are detected when the energy of the collision rises, this result agrees with the fact that in quark gluon plasma where quarks are free and of different colours and flavors, it is highly unlikely that a charmed quark combines with its anti-quark to form a J/Ψ meson; and 4) the theory of the formation of quark gluon plasma predicts that its electromagnetic radiation has a thermal radiation specificity, physicists have studied the radiation spectra emitted in the core of a ion collision, they have shown that it is a thermal radiation and that the temperature of the emitter corresponds to the temperature of a quark gluon plasma. (A.C.)

Power Controllability of Three-phase Converter with Unbalanced AC Source

DEFF Research Database (Denmark)

Ma, Ke; Chen, Wenjie; Liserre, Marco

2015-01-01

Three-phase DC-AC power converters suffer from power oscillation and overcurrent problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zerosequence components are proposed to enhance the power control ability under this adverse condition. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC voltage....

A direct power conversion topology for grid integrations of hybrid AC/DC resources

DEFF Research Database (Denmark)

Liu, Xiong; Loh, Poh Chiang; Wang, Peng

2012-01-01

and modulation schemes are proposed to extract the commanded current from the input ac/dc sources to the grid and guarantee high quality ac/dc inputs and ac output current waveforms with unity power factors. The proposed modulation scheme for sinusoidal outputs of the VMC is mathematically proved...

Low frequency ac conduction and dielectric relaxation in poly(N ...

Indian Academy of Sciences (India)

The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

Productos «Celotex» para acondicionamientos Acústicos

Directory of Open Access Journals (Sweden)

Editorial, Equipo

1958-02-01

Full Text Available Not availableBajo la denominación general «Celotex», que es un nombre registrado, la Casa Americana The Celotex Corporation, cuyo domicilio social es 120 South, La Salle Street, Chicago J. lllinois, fabrica diversos materiales para fines de acondicionamiento acústico elaborados, según los tipos de que se trate, con fibra de caña de azúcar, lanas minerales, acero, amianto, etc., perforados o no y de acuerdo con el efecto estético y acústico que se desee obtener.

CTE Corrections for WFPC2 and ACS

Science.gov (United States)

Dolphin, Andrew

2003-07-01

The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

Superconducting ac cable

Science.gov (United States)

Schmidt, F.

1980-11-01

The components of a superconducting 110 kV ac cable for power ratings or = 2000 MVA were developed. The cable design is of the semiflexible type, with a rigid cryogenic envelope containing a flexible hollow coaxial cable core. The cable core consists of spirally wound Nb-A1 composite wires electrically insulated by high pressure polyethylene tape wrappings. A 35 m long single phase test cable with full load terminals rated at 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of this cable design.

Superconducting ac cable

International Nuclear Information System (INIS)

Schmidt, F.

1980-01-01

The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de

Diode-rectified multiphase AC arc for the improvement of electrode erosion characteristics

Science.gov (United States)

Tanaka, Manabu; Hashizume, Taro; Saga, Koki; Matsuura, Tsugio; Watanabe, Takayuki

2017-11-01

An innovative multiphase AC arc (MPA) system was developed on the basis of a diode-rectification technique to improve electrode erosion characteristics. Conventionally, electrode erosion in AC arc is severer than that in DC arc. This originated from the fact that the required properties for the cathode and anode are different, although an AC electrode works as the cathode and the anode periodically. To solve this problem, a separation of AC electrodes into pairs of thoriated tungsten cathode and copper anode by diode-rectification was attempted. A diode-rectified multiphase AC arc (DRMPA) system was then successfully established, resulting in a drastic improvement of the erosion characteristics. The electrode erosion rate in the DRMPA was less than one-third of that in the conventional MPA without the diode rectification. In order to clarify its erosion mechanism, electrode phenomena during discharge were visualized by a high-speed camera system with appropriate band-pass filters. Fluctuation characteristics of the electrode temperature in the DRMPA were revealed.

Complex study of transport AC loss in various 2G HTS racetrack coils

Energy Technology Data Exchange (ETDEWEB)

Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)

2013-04-15

Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.

a.c. conductance study of polycrystal C{sub 60}

Energy Technology Data Exchange (ETDEWEB)

Yan Feng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Wang Yening [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Huang Yineng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Gu Min [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Zhang Qingming [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Shen Huimin [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure

1995-06-05

The a.c. (1a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law {sigma} similar {omega}{sup s} (s{approx}0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C{sub 60}. ((orig.)).

Faradaic AC Electrokinetic Flow and Particle Traps

Science.gov (United States)

Ben, Yuxing; Chang, Hsueh-Chia

2004-11-01

Faradaic reaction at higher voltages can produce co-ion polarization at AC electrodes instead of counter-ion polarization due to capacitive charging from the bulk. The Faradaic co-ion polarization also does not screen the external field and hence can produce large net electro-kinetic flows at frequencies lower than the inverse RC time of the double layer. Due to the opposite polarization of capacitve and Faradaic charging, we can reverse the direction of AC flows on electrodes by changing the voltage and frequency. Particles and bacteria are trapped and then dispersed at stagnation lines, at locations predicted by our theory, by using these two flows sequentially. This technique offers a good way to concentrate and detect bacteria.

AC application of second generation HTS wire

Science.gov (United States)

Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.

2008-02-01

For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.

AC Losses and Their Thermal Effect in High Temperature Superconducting Machines

DEFF Research Database (Denmark)

Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan

2015-01-01

In transient operations or fault conditions, high temperature superconducting (HTS) machines suffer AC losses which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate AC losses and their thermal effect in HTS machines is presented....... The method consists of three sub-models that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an AC loss model which has...

AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines

DEFF Research Database (Denmark)

Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan

2016-01-01

In transient operations or fault conditions, hightemperature superconducting (HTS) machines suffer ac losses, which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate ac losses and their thermal effect in HTS machines is presented....... The method consists of three submodels that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an ac loss model that has a homogeneous...

ELECTRONIC SYSTEM FOR EXPERIMENTATION IN AC ELECTROGRAVIMETRY I: TECHNIQUE FUNDAMENTALS

Directory of Open Access Journals (Sweden)

Róbinson Torres

Full Text Available Basic fundamentals of AC electrogravimetry are introduced. Their main requirements and characteristics are detailed to establish the design of an electronic system that allows the appropriate extraction of data needed to determine the electrogravimetric transfer function (EGTF and electrochemical impedance (EI, in an experimental set-up for the AC electrogravimetry technique.

AC Conductivity Studies of Lithium Based Phospho Vanadate Glasses

International Nuclear Information System (INIS)

Nagendra, K.; Babu, G. Satish; Gowda, Veeranna; Reddy, C. Narayana

2011-01-01

Glasses in the system xLi 2 SO 4 -20Li 2 O-(80-x) [80P 2 O 5 -20V 2 O 5 ](5≥x≥20 mol%) has been prepared by melt quenching method. Dc and ac conductivity has been studied over a wide range of frequency (10 Hz to 10 MHz) and temperature (298 K-523 K). The dc conductivity found to increase with increase of Li 2 SO 4 concentration. The ac conductivities have been fitted to the Almond-West type single power law equation σ(ω) = σ(0)+Aω s where 's' is the power law exponent. The ac conductivity found to increase with increase of Li 2 SO 4 concentration. An attempt is made to elucidate the enhancement of lithium ion conduction in phosphor-vanadate glasses by considering the expansion of network structure.

Non-Federal participation in AC Intertie: Final environmental impact statement

International Nuclear Information System (INIS)

1994-01-01

Bonneville Power Administration (BPA) is considering action in two areas: (1) non-Federal access to the AC Intertie, and, (2) BPA Intertie marketing. BPA's preferred alternative for non-Federal access is the Capacity Ownership alternative combined with the Increased Assured Delivery -- Access for Non-Scheduling Utilities alternative; the preferred alternative for BPA Intertie marketing is the Federal Marketing and Joint Ventures alternative. BPA considered these two areas previously in its Intertie Development and Use EIS of April 1988. The EIS resulted in BPA decisions to participate in the construction of the Third AC Intertie, to allow non-Federal access to BPA's share of the Pacific Northwest-Pacific Southwest (PNW-PSW) Intertie (AC and DC lines) pursuant to a Long-Term Intertie Access Policy (LTIAP), and to pursue BPA's export marketing alternative. The decision on allowing direct financial non-Federal participation in the Third AC line was deferred to a later, separate process, examined here. Also, BPA's export marketing objectives must now be examined in view of changed operations of Columbia River hydro facilities for improved fish survival

AC-loss considerations of a pulse SMES for an accelerator

International Nuclear Information System (INIS)

Lyly, M; Hiltunen, I; Jaervelae, J; Korpela, A; Lehti, L; Stenvall, A; Mikkonen, R

2010-01-01

In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.

Pregnancy associated plasma protein A, a potential marker for vulnerable plaque in patients with non-ST-segment elevation acute coronary syndrome

DEFF Research Database (Denmark)

Iversen, Kasper K; Teisner, Ane S; Teisner, Borge

2009-01-01

OBJECTIVES: To describe the presence and time-related pattern of circulating pregnancy associated plasma protein A (PAPP-A) levels in patients with non ST-segment elevation acute coronary syndrome (NSTE-ACS). DESIGN AND METHODS: Consecutively admitted patients (N=573) with clinical signs of NSTE-...

A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

Directory of Open Access Journals (Sweden)

Cuidong Xu

2015-09-01

Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

Lamin A/C mutations with lipodystrophy, cardiac abnormalities, and muscular dystrophy

NARCIS (Netherlands)

van der Kooi, A. J.; Bonne, G.; Eymard, B.; Duboc, D.; Talim, B.; van der Valk, M.; Reiss, P.; Richard, P.; Demay, L.; Merlini, L.; Schwartz, K.; Busch, H. F. M.; de Visser, M.

2002-01-01

Mutations in the lamin A/C gene are found in Emery-Dreifuss muscular dystrophy, limb girdle muscular dystrophy with cardiac conduction disturbances, dilated cardiomyopathy with conduction system disease, and familial partial lipodystrophy. Cases with lamin A/C mutations presenting with lipodystrophy

Power Controllability of Three-phase Converter with Unbalanced AC Source

DEFF Research Database (Denmark)

Ma, Ke; Liserre, Marco; Blaabjerg, Frede

2013-01-01

Three-phase DC-AC power converters suffer from power oscillation and overcurrentt problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zero-sequence components are proposed to enhance the power control ability under this adverse conditions. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC sources....

AC Application of HTS Conductors in Highly Dynamic Electric Motors

International Nuclear Information System (INIS)

Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K

2006-01-01

Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit

AC ignition of HID lamps

NARCIS (Netherlands)

Sobota, A.; Kanters, J.H.M.; Manders, F.; Veldhuizen, van E.M.; Haverlag, M.

2010-01-01

Our aim was to examine the starting behaviour of mid-pressure argon discharges in pin-pin (point-to-point) geometry, typically used in HID lamps. We focused our work on AC ignition of 300 and 700 mbar Ar discharges in Philips 70W standard burners. Frequency was varied between 200 kHz and 1 MHz. In

AC-Induced Bias Potential Effect on Corrosion of Steels

Science.gov (United States)

2009-02-05

induction, variable conduction Experimental Setup Super- martensitic stainless steel composition Analysis: C Mn Si Cr Ni Mo Cu N Typical 13 Cr ɘ.01 0.6... stainless steel used in pipelines. •Low carbon (ɘ.01): allows the formation of a “soft” martensite that is more resistant than standard martensitic ...Proposed AC Corrosion Models  AC Simulated Corrosion testing  Stainless steel pipe and coating  Cathodic protection  Experimental Setup  Preliminary

AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications

Science.gov (United States)

Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.

2017-12-01

This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.

The effect of ac magnetic fields on the lifting power of levitating superconductors

International Nuclear Information System (INIS)

Smolyak, B M; Ermakov, G V; Chubraeva, L I

2007-01-01

This study deals with the decrease in the levitation force under the action of an ac field up to the frequency at which oscillations of the superconducting suspension are limited by inertia. The lifting force was measured as a function of the ac field amplitude and the exposure time. It was shown that the force quickly decreased at the moment the ac field was applied and then continued diminishing, but at a lower rate. A qualitative model was proposed, taking into account two effects of the ac field on the magnetization of the levitating superconductor: a complete destruction of the critical state in some section of the superconductor (to a depth λ ac ) and the initiation of a faster magnetic relaxation in the region where the induction gradient is preserved

AC Electric Field Communication for Human-Area Networking

Science.gov (United States)

Kado, Yuichi; Shinagawa, Mitsuru

We have proposed a human-area networking technology that uses the surface of the human body as a data transmission path and uses an AC electric field signal below the resonant frequency of the human body. This technology aims to achieve a “touch and connect” intuitive form of communication by using the electric field signal that propagates along the surface of the human body, while suppressing both the electric field radiating from the human body and mutual interference. To suppress the radiation field, the frequency of the AC signal that excites the transmitter electrode must be lowered, and the sensitivity of the receiver must be raised while reducing transmission power to its minimally required level. We describe how we are developing AC electric field communication technologies to promote the further evolution of a human-area network in support of ubiquitous services, focusing on three main characteristics, enabling-transceiver technique, application-scenario modeling, and communications quality evaluation. Special attention is paid to the relationship between electro-magnetic compatibility evaluation and regulations for extremely low-power radio stations based on Japan's Radio Law.

AC Conductivity and Dielectric Properties of Borotellurite Glass

Science.gov (United States)

Taha, T. A.; Azab, A. A.

2016-10-01

Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.

Control of Reactive Species Generated by Low-frequency Biased Nanosecond Pulse Discharge in Atmospheric Pressure Plasma Effluent

Science.gov (United States)

Takashima, Keisuke; Kaneko, Toshiro

2016-09-01

The control of hydroxyl radical and the other gas phase species generation in the ejected gas through air plasma (air plasma effluent) has been experimentally studied, which is a key to extend the range of plasma treatment. Nanosecond pulse discharge is known to produce high reduced electric field (E/N) discharge that leads to efficient generation of the reactive species than conventional low frequency discharge, while the charge-voltage cycle in the low frequency discharge is known to be well-controlled. In this study, the nanosecond pulse discharge biased with AC low frequency high voltage is used to take advantages of these discharges, which allows us to modulate the reactive species composition in the air plasma effluent. The utilization of the gas-liquid interface and the liquid phase chemical reactions between the modulated long-lived reactive species delivered from the air plasma effluent could realize efficient liquid phase chemical reactions leading to short-lived reactive species production far from the air plasma, which is crucial for some plasma agricultural applications.

Space Charge Modulated Electrical Breakdown of Oil Impregnated Paper Insulation Subjected to AC-DC Combined Voltages

Directory of Open Access Journals (Sweden)

Yuanwei Zhu

2018-06-01

Full Text Available Based on the existing acknowledgment that space charge modulates AC and DC breakdown of insulating materials, this investigation promotes the related investigation into the situations of more complex electrical stress, i.e., AC-DC combined voltages. Experimentally, the AC-DC breakdown characteristics of oil impregnated paper insulation were systematically investigated. The effects of pre-applied voltage waveform, AC component ratio, and sample thickness on AC-DC breakdown characteristics were analyzed. After that, based on an improved bipolar charge transport model, the space charge profiles and the space charge induced electric field distortion during AC-DC breakdown were numerically simulated to explain the differences in breakdown characteristics between the pre-applied AC and pre-applied DC methods under AC-DC combined voltages. It is concluded that large amounts of homo-charges are accumulated during AC-DC breakdown, which results in significantly distorted inner electric field, leading to variations of breakdown characteristics of oil impregnated paper insulation. Therefore, space charges under AC-DC combined voltages must be considered in the design of converter transformers. In addition, this investigation could provide supporting breakdown data for insulation design of converter transformers and could promote better understanding on the breakdown mechanism of insulating materials subjected to AC-DC combined voltages.

Induced AC voltages on pipelines may present a serious hazard

International Nuclear Information System (INIS)

Kirkpatrick, E.L.

1997-01-01

The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP

System and Battery Charge Control for PV-Powered AC Lighting Systems

Energy Technology Data Exchange (ETDEWEB)

Kern, G.

1999-04-01

This report reviews a number of issues specific to stand-alone AC lighting systems. A review of AC lighting technology is presented, which discusses the advantages and disadvantages of various lamps. The best lamps for small lighting systems are compact fluorescent. The best lamps for intermediate-size systems are high- or low-pressure sodium. Specifications for battery charging and load control are provided with the goal of achieving lamp lifetimes on the order of 16,000 to 24,000 hours and battery lifetimes of 4 to 5 years. A rough estimate of the potential domestic and global markets for stand-alone AC lighting systems is presented. DC current injection tests were performed on high-pressure sodium lamps and the test results are presented. Finally, a prototype system was designed and a prototype system controller (with battery charger and DC/AC inverter) was developed and built.

Photovoltaic system with improved AC connections and method of making same

Energy Technology Data Exchange (ETDEWEB)

Cioffi, Philip Michael; Todorovic, Maja Harfman; Herzog, Michael Scott; Korman, Charles Steven; Doherty, Donald M.; Johnson, Neil Anthony

2018-02-13

An alternating current (AC) harness for a photovoltaic (PV) system includes a wire assembly having a first end and a second end, the wire assembly having a plurality of lead wires, and at least one AC connection module positioned at a location along a length of the wire assembly between the first end and the second end. Further, the at least one AC connection module includes a first connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a first PV module of the PV system. The at least one AC connection module also includes a second connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a second PV module of the PV system.

A decomposition method for network-constrained unit commitment with AC power flow constraints

International Nuclear Information System (INIS)

Bai, Yang; Zhong, Haiwang; Xia, Qing; Kang, Chongqing; Xie, Le

2015-01-01

To meet the increasingly high requirement of smart grid operations, considering AC power flow constraints in the NCUC (network-constrained unit commitment) is of great significance in terms of both security and economy. This paper proposes a decomposition method to solve NCUC with AC power flow constraints. With conic approximations of the AC power flow equations, the master problem is formulated as a MISOCP (mixed integer second-order cone programming) model. The key advantage of this model is that the active power and reactive power are co-optimised, and the transmission losses are considered. With the AC optimal power flow model, the AC feasibility of the UC result of the master problem is checked in subproblems. If infeasibility is detected, feedback constraints are generated based on the sensitivity of bus voltages to a change in the unit reactive power generation. They are then introduced into the master problem in the next iteration until all AC violations are eliminated. A 6-bus system, a modified IEEE 30-bus system and the IEEE 118-bus system are used to validate the performance of the proposed method, which provides a satisfactory solution with approximately 44-fold greater computational efficiency. - Highlights: • A decomposition method is proposed to solve the NCUC with AC power flow constraints • The master problem considers active power, reactive power and transmission losses. • OPF-based subproblems check the AC feasibility using parallel computing techniques. • An effective feedback constraint interacts between the master problem and subproblem. • Computational efficiency is significantly improved with satisfactory accuracy

Electrical actuation of electrically conducting and insulating droplets using ac and dc voltages

International Nuclear Information System (INIS)

Kumari, N; Bahadur, V; Garimella, S V

2008-01-01

Electrical actuation of liquid droplets at the microscale offers promising applications in the fields of microfluidics and lab-on-chip devices. Much prior research has targeted the electrical actuation of electrically conducting liquid droplets using dc voltages (classical electrowetting). Electrical actuation of conducting droplets using ac voltages and the actuation of insulating droplets (using dc or ac voltages) has remained relatively unexplored. This paper utilizes an energy-minimization-based analytical framework to study the electrical actuation of a liquid droplet (electrically conducting or insulating) under ac actuation. It is shown that the electromechanical regimes of classical electrowetting, electrowetting under ac actuation and insulating droplet actuation can be extracted from the generic electromechanical actuation framework, depending on the electrical properties of the droplet, the underlying dielectric layer and the frequency of the actuation voltage. This paper also presents experiments which quantify the influence of the ac frequency and the electrical properties of the droplet on its velocity under electrical actuation. The velocities of droplets moving between two parallel plates under ac actuation are experimentally measured; these velocities are then related to the actuation force on the droplet which is predicted by the electromechanical model developed in this work. It is seen that the droplet velocities are strongly dependent on the frequency of the ac actuation voltage; the cut-off ac frequency, above which the droplet fails to actuate, is experimentally determined and related to the electrical conductivity of the liquid. This paper then analyzes and directly compares the various electromechanical regimes for the actuation of droplets in microfluidic applications

Procedure for marking, encryption, labelling and optical coding

OpenAIRE

Barranco, Ángel; Rodríguez-González, Agustín; Sánchez Valencia, Juan Ramón; Aparicio, Francisco J.; Blaszczyk-Lezak, Iwona Krystina; Holgado Bolaños, Miguel; Casquel del Campo, Rafael; Ocaña, J. L.; Molpeceres, C.; García-Ballesteros Ramírez, Juan José; Morales Furió, Miguel

2009-01-01

[EN] It permits marking or recording motifs (301) on surfaces whereon there has been deposited previously a fluorescent polymer layer (300) through a procedure of plasma polymerisation (100) of molecules of a colourant. The procedure combines the special characteristics of the polymer layers making them suitable for being capable of recording diverse motifs (301) thereon, and the possibility of recording by laser (10 1) or other techniques. Among such characteristics s...

Calorimetric method of ac loss measurement in a rotating magnetic field

Energy Technology Data Exchange (ETDEWEB)

Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)

2010-07-15

A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

Catalytic and Noncatalytic Conversion of Methane to Olefins and Synthesis Gas in an AC Parallel Plate Discharge Reactor

Directory of Open Access Journals (Sweden)

Mohammad Ali Khodagholi

2013-01-01

Full Text Available Direct conversion of methane to ethylene, acetylene, and synthesis gas at ambient pressure and temperature in a parallel plate discharge reactor was investigated. The experiments were carried out using a quartz reactor of outer diameter of 9 millimeter and a driving force of ac current of 50 Hz. The input power to the reactor to establish a stable gas discharge varied from 9.6 to maximum 15.3 watts (w. The effects of ZSM5, Fe–ZSM5, and Ni–ZSM5 catalysts combined with corona discharge for conversion of methane to more valued products have been addressed. It was found that in presence or absence of a catalyst in gas discharge reactor, the rate of methane and oxygen conversion increased upon higher input power supplied to the reactor. The effect of Fe–ZSM5 catalyst combined with gas discharge plasma yields C2 hydrocarbons up to 21.9%, which is the highest productions of C2 hydrocarbons in this work. The effect of combined Ni–ZSM5 and gas discharge plasma was mainly production of synthesis gas. The advantage of introducing ZSM5 to the plasma zone was increase in synthesis gas and acetylene production. The highest energy efficiency was 0.22 mmol/kJ, which belongs to lower rate of energy injection to the reactor.

Antifriction coatings based on a-C for biomedicine applications

International Nuclear Information System (INIS)

Yurjev, Y N; Kiseleva, D V; Zaitcev, D A; Sidelev, D V; Korneva, O S

2016-01-01

This article reports on the investigation of mechanical properties of carbon films deposited by dual magnetron sputtering system with closed and mirror magnetic field. There is shown that a-C films with predominantly sp 2 -phase have relatively high hardness (up to 20 GPa) and low friction index (∼0.01). The influence of magnetic field on friction index is determined. The analysis of experimental data shows the obtained a-C samples can be used for biomedicine applications. (paper)

AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios

Energy Technology Data Exchange (ETDEWEB)

Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z

2004-10-01

AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger.

AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios

International Nuclear Information System (INIS)

Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z.

2004-01-01

AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger

Iterative Addition of Kinetic Effects to Cold Plasma RF Wave Solvers

Science.gov (United States)

Green, David; Berry, Lee; RF-SciDAC Collaboration

2017-10-01

The hot nature of fusion plasmas requires a wave vector dependent conductivity tensor for accurate calculation of wave heating and current drive. Traditional methods for calculating the linear, kinetic full-wave plasma response rely on a spectral method such that the wave vector dependent conductivity fits naturally within the numerical method. These methods have seen much success for application to the well-confined core plasma of tokamaks. However, quantitative prediction of high power RF antenna designs for fusion applications has meant a requirement of resolving the geometric details of the antenna and other plasma facing surfaces for which the Fourier spectral method is ill-suited. An approach to enabling the addition of kinetic effects to the more versatile finite-difference and finite-element cold-plasma full-wave solvers was presented by where an operator-split iterative method was outlined. Here we expand on this approach, examine convergence and present a simplified kinetic current estimator for rapidly updating the right-hand side of the wave equation with kinetic corrections. This research used resources of the Oak Ridge Leadership Computing Facility at the Oak Ridge National Laboratory, which is supported by the Office of Science of the U.S. Department of Energy under Contract No. DE-AC05-00OR22725.

Plasma etching treatment for surface modification of boron-doped diamond electrodes

Energy Technology Data Exchange (ETDEWEB)

Kondo, Takeshi [Department of Industrial Chemistry, Faculty of Engineering, Tokyo University of Science, 1-3 Kagurazaka, Shinjuku-ku, Tokyo 162-8601 (Japan); Ito, Hiroyuki [Department of Industrial Chemistry, Faculty of Engineering, Tokyo University of Science, 1-3 Kagurazaka, Shinjuku-ku, Tokyo 162-8601 (Japan); Kusakabe, Kazuhide [Department of Applied Physics, Faculty of Science, Tokyo University of Science, 1-3 Kagurazaka, Shinjuku-ku, Tokyo 162-8601 (Japan); Ohkawa, Kazuhiro [Department of Applied Physics, Faculty of Science, Tokyo University of Science, 1-3 Kagurazaka, Shinjuku-ku, Tokyo 162-8601 (Japan); Einaga, Yasuaki [Department of Chemistry, Faculty of Science and Technology, Keio University, 3-14-1 Hiyoshi, Yokohama 223-8522 (Japan); Fujishima, Akira [Kanagawa Academy of Science and Technology (KAST), 3-2-1 Sakado, Takatsu-ku, Kawasaki, Kanagawa 213-0012 (Japan); Kawai, Takeshi [Department of Industrial Chemistry, Faculty of Engineering, Tokyo University of Science, 1-3 Kagurazaka, Shinjuku-ku, Tokyo 162-8601 (Japan)]. E-mail: kawai@ci.kagu.tus.ac.jp

2007-03-01

Boron-doped diamond (BDD) thin film surfaces were modified by brief plasma treatment using various source gases such as Cl{sub 2}, CF{sub 4}, Ar and CH{sub 4}, and the electrochemical properties of the surfaces were subsequently investigated. From X-ray photoelectron spectroscopy analysis, Cl and F atoms were detected on the BDD surfaces after 3 min of Cl{sub 2} and CF{sub 4} plasma treatments, respectively. From the results of cyclic voltammetry and electrochemical AC impedance measurements, the electron-transfer rate for Fe(CN){sub 6} {sup 3-/4-} and Fe{sup 2+/3+} at the BDD electrodes was found to decrease after Cl{sub 2} and CF{sub 4} plasma treatments. However, the electron-transfer rate for Ru(NH{sub 3}){sub 6} {sup 2+/3+} showed almost no change after these treatments. This may have been related to the specific interactions of surface halogen (C-Cl and C-F) moieties with the redox species because no electrical passivation was observed after the treatments. In addition, Raman spectroscopy showed that CH{sub 4} plasma treatment of diamond surfaces formed an insulating diamond-like carbon thin layer on the surfaces. Thus, by an appropriate choice of plasma source, short-duration plasma treatments can be an effective way to functionalize diamond surfaces in various ways while maintaining a wide potential window and a low background current.

Investigation of mechanism of anode plasma formation in ion diode with dielectric anode

International Nuclear Information System (INIS)

Pushkarev, A.

2015-01-01

The results of investigation of the anode plasma formation in a diode with a passive anode in magnetic insulation mode are presented. The experiments have been conducted using the BIPPAB-450 ion accelerator (350–400 kV, 6–8 kA, 80 ns) with a focusing conical diode with B r external magnetic field (a barrel diode). For analysis of plasma formation at the anode and the distribution of the ions beam energy density, infrared imaging diagnostics (spatial resolution of 1–2 mm) is used. For analysis of the ion beam composition, time-of-flight diagnostics (temporal resolution of 1 ns) were used. Our studies have shown that when the magnetic induction in the A-C gap is much larger than the critical value, the ion beam energy density is close to the one-dimensional Child-Langmuir limit on the entire working surface of the diode. Formation of anode plasma takes place only by the flashover of the dielectric anode surface. In this mode, the ion beam consists primarily of singly ionized carbon ions, and the delay of the start of formation of the anode plasma is 10–15 ns. By reducing the magnetic induction in the A-C gap to a value close to the critical one, the ion beam energy density is 3–6 times higher than that calculated by the one-dimensional Child-Langmuir limit, but the energy density of the ion beam is non-uniform in cross-section. In this mode, the anode plasma formation occurs due to ionization of the anode material with accelerated electrons. In this mode, also, the delay in the start of the formation of the anode plasma is much smaller and the degree of ionization of carbon ions is higher. In all modes occurred effective suppression of the electronic component of the total current, and the diode impedance was 20–30 times higher than the values calculated for the mode without magnetic insulation of the electrons. The divergence of the ion beam was 4.5°–6°

Study of the electric Held in HTS tape caused by perpendicular AC magnetic field

International Nuclear Information System (INIS)

Roiberg, V; Kopansky, F.

2004-01-01

Full Text: In a previous work we studied the influence of AC magnetic fields on voltage-currents (V-I) characteristics of high temperature superconducting (HTS) multi filament BSCC0-2223 tapes. It was found that AC magnetic fields perpendicular to the ab plane (the wide surface of the tape) cause a linear decrease of the critical current (IC) with amplitude of the AC magnetic field. The degradation of IC in .AC field was explained by the geometrical model according to which the transport current floe: is confined to the central zone of the tape where .AC field does not penetrate. For deeper understanding of the observed phenomena we carried out a study of the time dependence of the electric field during the cycle of AC field. At the same time we expanded the frequency range to low frequencies down to 1 Hz. The main results of the work are as following. 1. The time modulation of the electric field E in the HTS tape carrying transport DC current has the double frequency relating to AC magnetic field. 2. In field amplitudes less than 70 G the electric field modulation decreases with increasing frequency in opposite to its well-pronounced increase in higher AC field amplitudes. Alcove 70 G, the electric field increases with increasing the frequency of the external magnetic field. The wave forms of the electric field are different in both amplitudes ranges. 3. E-I curves of the tape in low amplitudes are frequency independent and coincide with E-l curves in AC field with intensity equal to the AC field amplitude. 4. In high AC field amplitudes, a strong dependence of the E-I curves on frequency is observed in the frequency range of 1-40 Hz and no dependence is observed in higher frequencies. Our results suggest that a combination of the geometrical model with flux creep concepts is necessary for a better understanding of the electric field behavior in our measurement conditions

Modelling and measurement of ac loss in BSCCO/Ag-tape windings

International Nuclear Information System (INIS)

Oomen, M P; Nanke, R; Leghissa, M

2003-01-01

High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications

AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts

Energy Technology Data Exchange (ETDEWEB)

Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

2011-01-01

While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.

Transport ac losses in Bi-2223 multifilamentary tapes - conductor materials aspect

Energy Technology Data Exchange (ETDEWEB)

Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge BC2 3QZ (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Institute of Electrical Engineering, SAS, Bratislava (Slovakia)

2000-05-01

Transport ac losses in technical superconductors based on Bi-2223 tape material are influenced by many parameters. The major factors that define the ac performance of such conductors are the following: the size and number of filaments, their geometrical arrangement in the cross-section of the conductor, the twist pitch length, the resistivity of the matrix, the presence of oxide barriers around the filaments and deformation procedures such as sequential pressing or rolling followed by appropriate thermal treatment. In the present paper the above aspects are addressed from the viewpoint of the materials science of technical conductor design. Transport ac losses at power frequencies in different types of Bi-2223 conductor are presented and analysed. The results of conductor design analysis with respect to the coexistence of the superconductor with other materials in the conductor structure are presented. New concepts for minimization of the transport ac losses are discussed in detail. (author)

AC electric field assisted orientational photorefractive effect in C60-doped nematic liquid crystal

International Nuclear Information System (INIS)

Sun Xiudong; Pei Yanbo; Yao Fengfeng; Zhang Jianlong; Hou Chunfeng

2007-01-01

Photorefractive gratings were produced in a C 60 -doped nematic liquid crystal cell under the application of two coherent beams and a nonbiased sinusoidal ac electric field. The beam coupling and diffraction of the ac electric field assisted gratings were studied systematically. A stable asymmetric energy transference was obtained. Diffraction was observed when the angle (between the normal of the cell and the bisector of the writing beams) was 0 0 , and the dependence of diffraction efficiency on the peak-to-peak value of the ac voltage was similar to that at an incidence angle of 45 0 , suggesting that the role of the ac field was to facilitate the charge separation, and the space-charge field (SCF) originated predominantly from the diffusion of the ac electric field assisted photo-induced carriers under the application of nonuniform illumination and an applied ac field. The grating was produced by director reorientation induced by the cooperation of the SCF and the applied ac electric field. A self-erasing phenomenon was observed in this cell. An explanation in terms of the movement of two kinds of carriers with opposite signs was proposed

Bacillus thuringiensis delta-endotoxin Cry1Ac domain III enhances activity against Heliothis virescens in some, but not all Cry1-Cry1Ac hybrids

NARCIS (Netherlands)

Karlova, R.B.; Weemen, W.M.J.; Naimov, S.; Ceron, J.; Dukiandjiev, S.; Maagd, de R.A.

2005-01-01

We investigated the role of domain III of Bacillus thuringiensis d-endotoxin Cry1Ac in determining toxicity against Heliothis virescens. Hybrid toxins, containing domain III of Cry1Ac with domains I and II of Cry1Ba, Cry1Ca, Cry1Da, Cry1Ea, and Cry1Fb, respectively, were created. In this way Cry1Ca,

Update History of This Database - AcEST | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us AcEST Update History of This Database Date Update contents 2013/01/10 Errors found on AcEST ...s Database Database Description Download License Update History of This Data...base Site Policy | Contact Us Update History of This Database - AcEST | LSDB Archive ... ...Conting data have been correceted. For details, please refer to the following page. Data correction 2010/03/29 AcEST English archi

Design and implementation of co-operative control strategy for hybrid AC/DC microgrids

Science.gov (United States)

Mahmud, Rasel

This thesis is mainly divided in two major sections: 1) Modeling and control of AC microgrid, DC microgrid, Hybrid AC/DC microgrid using distributed co-operative control, and 2) Development of a four bus laboratory prototype of an AC microgrid system. At first, a distributed cooperative control (DCC) for a DC microgrid considering the state-of-charge (SoC) of the batteries in a typical plug-in-electric-vehicle (PEV) is developed. In DC microgrids, this methodology is developed to assist the load sharing amongst the distributed generation units (DGs), according to their ratings with improved voltage regulation. Subsequently, a DCC based control algorithm for AC microgrid is also investigated to improve the performance of AC microgrid in terms of power sharing among the DGs, voltage regulation and frequency deviation. The results validate the advantages of the proposed methodology as compared to traditional droop control of AC microgrid. The DCC-based control methodology for AC microgrid and DC microgrid are further expanded to develop a DCC-based power management algorithm for hybrid AC/DC microgrid. The developed algorithm for hybrid microgrid controls the power flow through the interfacing converter (IC) between the AC and DC microgrids. This will facilitate the power sharing between the DGs according to their power ratings. Moreover, it enables the fixed scheduled power delivery at different operating conditions, while maintaining good voltage regulation and improved frequency profile. The second section provides a detailed explanation and step-by-step design and development of an AC/DC microgrid testbed. Controllers for the three-phase inverters are designed and tested on different generation units along with their corresponding inductor-capacitor-inductor (LCL) filters to eliminate the switching frequency harmonics. Electric power distribution line models are developed to form the microgrid network topology. Voltage and current sensors are placed in the proper

Stretched exponential relaxation and ac universality in disordered dielectrics

DEFF Research Database (Denmark)

Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

2007-01-01

This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...

Plasma metabolism of apolipoprotein A-IV in humans

International Nuclear Information System (INIS)

Ghiselli, G.; Krishnan, S.; Beigel, Y.; Gotto, A.M. Jr.

1986-01-01

As assessed by molecular sieve chromatography and quantitation by a specific radioimmunoassay, apoA-IV is associated in plasma with the triglyceride-rich lipoproteins, to a high density lipoprotein (HDL) subfraction of smaller size than HDL3, and to the plasma lipoprotein-free fraction (LFF). In this study, the turnover of apoA-IV associated to the triglyceride-rich lipoproteins, HDL and LFF was investigated in vivo in normal volunteers. Human apoA-IV isolated from the thoracic duct lymph chylomicrons was radioiodinated and incubated with plasma withdrawn from normal volunteers after a fatty meal. Radioiodinated apoA-IV-labeled triglyceride-rich lipoproteins, HDL, and LFF were then isolated by chromatography on an AcA 34 column. Shortly after the injection of the radioiodinated apoA-IV-labeled triglyceride-rich lipoproteins, most of the radioactivity could be recovered in the HDL and LFF column fractions. On the other hand, when radioiodinated apoA-IV-labeled HDL or LFF were injected, the radioactivity remained with the originally injected fractions at all times. The residence time in plasma of 125 I-labeled apoA-IV, when injected in association with HDL or LFF, was 1.61 and 0.55 days, respectively. When 125 I-labeled apoA-IV was injected as a free protein, the radioactivity distributed rapidly among the three plasma pools in proportion to their mass. The overall fractional catabolic rate of apoA-IV in plasma was measured in the three normal subjects and averaged 1.56 pools per day. The mean degradation rate of apoA-IV was 8.69 mg/kg X day