Bu çalışmada, metal-kükürt yarı iletken nano parçacıklarının mikrodalga ışınlama yöntemi ile sentezlenmesi ve karakterize edilmesidir. Çeşitli metal tuzları ve kükürt kaynağı olarak tiyoasetamit kullanılarak mikrodalga fırında ZnS, CdS, CuS SnS, MnS, CoS metal kükürt nano parçacıkların su ve formaldehit ortamında sentezi yapıldı. ...
A simple algorithm for computing the smallest enclosing circle
DEFF Research Database (Denmark)
Skyum, Sven
1991-01-01
Presented is a simple O(n log n) algorithm for computing the smallest enclosing circle of a convex polygon. It can be easily extended to algorithms that compute the farthest-and the closest-point Voronoi diagram of a convex polygon within the same time bound.......Presented is a simple O(n log n) algorithm for computing the smallest enclosing circle of a convex polygon. It can be easily extended to algorithms that compute the farthest-and the closest-point Voronoi diagram of a convex polygon within the same time bound....
Statistical characteristics of transient enclosure voltage in ultra-high-voltage gas-insulated switchgear
Science.gov (United States)
Cai, Yuanji; Guan, Yonggang; Liu, Weidong
2017-06-01
Transient enclosure voltage (TEV), which is a phenomenon induced by the inner dielectric breakdown of SF6 during disconnector operations in a gas-insulated switchgear (GIS), may cause issues relating to shock hazard and electromagnetic interference to secondary equipment. This is a critical factor regarding the electromagnetic compatibility of ultra-high-voltage (UHV) substations. In this paper, the statistical characteristics of TEV at UHV level are collected from field experiments, and are analyzed and compared to those from a repeated strike process. The TEV waveforms during disconnector operations are recorded by a self-developed measurement system first. Then, statistical characteristics, such as the pulse number, duration of pulses, frequency components, magnitude and single pulse duration, are extracted. The transmission line theory is introduced to analyze the TEV and is validated by the experimental results. Finally, the relationship between the TEV and the repeated strike process is analyzed. This proves that the pulse voltage of the TEV is proportional to the corresponding breakdown voltage. The results contribute to the definition of the standard testing waveform of the TEV, and can aid the protection of electronic devices in substations by minimizing the threat of this phenomenon.
AC Calorimetry and Thermophysical Properties of Bulk Glass-Forming Metallic Liquids
Science.gov (United States)
Johnson, William L.
2000-01-01
Thermo-physical properties of two bulk metallic glass forming alloys, Ti34Zr11Cu47Ni8 (VIT 101) and Zr57Nb5Ni12.6Al10CU15.4 (VIT 106), were investigated in the stable and undercooled melt. Our investigation focused on measurements of the specific heat in the stable and undercooled liquid using the method of AC modulation calorimetry. The VIT 106 exhibited a maximum undercooling of 140 K in free radiative cooling. Specific heat measurements could be performed in stable melt down to an undercooling of 80 K. Analysis of the specific heat data indicate an anomaly near the equilibrium liquidus temperature. This anomaly is also observed in y the temperature dependencies of the external relaxation time, the specific volume, and the surface tension; it is tentatively attributed to a phase separation in the liquid state. The VIT 101 specimen exhibited a small undercooling of about 50 K. Specific heat measurements were performed in the stable and undercooled melt. These various results will be combined with ground based work such as the measurement of T-T-T curves in the electrostatic levitator and low temperature viscosity and specific heat measurements for modeling the nucleation kinetics of these alloys.
AC impedance behaviour and state-of-charge dependence of Zr0 ...
Indian Academy of Sciences (India)
Unknown
measurement encompasses a wide range of AC signal frequencies, various characteristic parameters of the electrochemical cell and kinetics of the associated reactions can be evaluated. Metal-hydride (MH) electrodes form the anode or the negative plate of a nickel-metal- hydride battery. However, the development of MH ...
Analytical theory and possible detection of the ac quantum spin Hall effect.
Science.gov (United States)
Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y
2017-07-11
We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.
Ecological stoichiometry of C, N and P on different time enclosed in desertification steppe soil
Science.gov (United States)
Yang, W. Z.; Jiao, Y.; Jia, Y. Q.
2017-08-01
It is the research object for the ecological stoichiometry of C, N and P on the different time of desertification grasslands enclosed and grazing grassland in Taibusi country of the Inner Mongolia, China. Through the measurement and analysis on ecological stoichiometric ratio of C, N and P in soil, the time of desertification grassland enclosed is determined. There are 13 soil of desertification grassland with different en-closure time, and 1 soil of grazing grassland. They are analyzed for the soil organic carbon, total nitro-gen, total phosphorus content and their density. The C/N of soil were increased with the extension of the time of desertification grassland enclosed. To 22 years enclosed, the C/N of grassland desertification soil enclosed is greater than the soil of grazing grassland that is 17. After the desertification grassland is en-closed, the C/N of soil is 13, and it is accumulated to maximum for C and N, and The grazing period is the best.
RF tissue-heating near metallic implants during magnetic resonance examinations: an approach in the ac limit.
Science.gov (United States)
Ballweg, Verena; Eibofner, Frank; Graf, Hansjorg
2011-10-01
State of the art to access radiofrequency (RF) heating near implants is computer modeling of the devices and solving Maxwell's equations for the specific setup. For a set of input parameters, a fixed result is obtained. This work presents a theoretical approach in the alternating current (ac) limit, which can potentially render closed formulas for the basic behavior of tissue heating near metallic structures. Dedicated experiments were performed to support the theory. For the ac calculations, the implant was modeled as an RLC parallel circuit, with L being the secondary of a transformer and the RF transmission coil being its primary. Parameters influencing coupling, power matching, and specific absorption rate (SAR) were determined and formula relations were established. Experiments on a copper ring with a radial gap as capacitor for inductive coupling (at 1.5 T) and on needles for capacitive coupling (at 3 T) were carried out. The temperature rise in the embedding dielectric was observed as a function of its specific resistance using an infrared (IR) camera. Closed formulas containing the parameters of the setup were obtained for the frequency dependence of the transmitted power at fixed load resistance, for the calculation of the resistance for optimum power transfer, and for the calculation of the transmitted power in dependence of the load resistance. Good qualitative agreement was found between the course of the experimentally obtained heating curves and the theoretically determined power curves. Power matching revealed as critical parameter especially if the sample was resonant close to the Larmor frequency. The presented ac approach to RF heating near an implant, which mimics specific values for R, L, and C, allows for closed formulas to estimate the potential of RF energy transfer. A first reference point for worst-case determination in MR testing procedures can be obtained. Numerical approaches, necessary to determine spatially resolved heating maps, can
Measuring ac-loss in high temperature superconducting cable-conductors using four probe methods
DEFF Research Database (Denmark)
Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Olsen, Søren Krüger
1999-01-01
Measuring the ac-loss of superconducting cable conductors have many aspects in common with measuring the ac-loss of single superconducting tapes. In a cable conductor all tapes are connected to each other and to the test circuit through normal metal joints in each end. This makes such measurement...
46 CFR 28.340 - Ventilation of enclosed engine and fuel tank spaces.
Science.gov (United States)
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Ventilation of enclosed engine and fuel tank spaces. 28... of enclosed engine and fuel tank spaces. (a) Applicability. Each vessel with a gasoline outboard engine or gasoline storage tank must comply with the requirements of this section. (b) Ventilation of...
Removal of Radioactive Nuclides by Multi-Functional Microcapsules Enclosing Inorganic Ion-Exchangers and Organic Extractants
Energy Technology Data Exchange (ETDEWEB)
Mimura, H.; Akiba, K.; Onodera, Y.
2002-02-26
The microcapsules enclosing two kinds of functional materials, inorganic ion-exchangers and organic extractants, were prepared by taking advantage of the high immobilization ability of alginate gel polymer. The fine powders of inorganic ion-exchanger and oil drops of extractant were kneaded with sodium alginate (NaALG) solution and the kneaded sol readily gelled in a salt solution of CaCl2, BaCl2 or HCl to form spherical gel particles. The uptake properties of various nuclides, 137Cs, 85Sr, 60Co, 88Y, 152Eu and 241Am, for thirty-four specimens of microcapsules in the presence of 10-1-10-4 M HNO3 were evaluated by the batch method. The distribution coefficient (Kd) of Cs+ above 103 cm3/g was obtained for the microcapsules enclosing CuFC or AMP. The Kd of Sr2+ around 102 cm3/g was obtained for the microcapsules containing clinoptilolite, antimonic acid, zeolite A, zeolite X or titanic acid. The microcapsules enclosing DEHPA exhibited relatively large Kd values of trivalent metal ions above 103 cm3/g; for example, the Kd values of Cs+, Sr2+, Co2+, Y3+, Eu3+ and Am3+ for a favorable microcapsule (CuFC/clinoptilolite/DEHPA/CaALG) were 1.1x104, 7.5x10, 1.1x10, 1.0x104, 1.4x104, 3.4x103 cm3/g, respectively. The uptake rates of Cs+, Y3+, Eu3+ and Am3+ for this microcapsule were rather fast; the uptake percentage above 90% was obtained after 19 h-shaking and the uptake equilibrium was attained within 1 d. The AMP/CaALG exhibited high uptake ability for Cs+ even after irradiation of 188 kGy, and DEHPA/CaALG microcapsule had similar Kd values of Cs+, Sr2+, Co2+, Y3+, Eu3+ and Am3+ ions before and after irradiation. The microcapsules with various shapes such as spherical, columnar, fibrous and filmy forms were easily prepared by changing the way of dipping kneaded sol into gelling salt solution. The microcapsules enclosing inorganic ion-exchangers and extractants have a potential possibility for the simultaneous removal of various radioactive nuclides from waste solutions.
INFLUENCE OF NON-PERFORATED SCREEN LOCATION ON HEAT TRANSFER PROCESS IN BUILDING ENCLOSING PARTS
Directory of Open Access Journals (Sweden)
V. D. Sizov
2017-01-01
Full Text Available It is recommended to have a vapor-proof barrier on the internal side of heat insulation system in multi-layer building enclosing parts in order to ensure protection of a heat-insulation layer against humidification because relative humidity of internal air is generally higher than external one and diffusion of water steam is directed from premises outside. While having a barrier with high vapor permeability a part of moisture can be accumulated in the structure and heat insulation core and difference of actual and maximum possible partial pressures leads to condensate formation. In order to improve thermal properties of enclosing parts the necessity arises to create a vapor-proof protection screen. It complies with the design of a panel with a vapor-proof screen in the form of non-perforated aluminium foil. The given screen located at internal panel layer prevents penetration of water vapor from premises into enclosing part and heat insulation layer. In such a case condensation zones and, consequently, their moistening can occur in some layers of enclosing parts according to their thermal and physical characteristics. The paper contains a calculation of thermal and moisture regime of the enclosing parts with vapor-proof layer (non-perforated aluminium foil located in enclosing part core between various layers. An analysis of thermal and moisture regime diagrams for multi-layer external enclosing part demonstrates that the part of non-perforated screen (aluminium foil located between internal concrete layer and perforated heat insulation layer is considered the most rational one. At the same time other screens between separate layers are perforated.
Global change in marine ecosystems: implications for semi-enclosed Arabian seas
KAUST Repository
Duarte, Carlos M.
2015-12-07
Global Change has been defined as the impact of human activities on the key processes that determine the functioning of the Biosphere. Global Change is a major threat for marine ecosystems and includes climate change as well as other global impacts such as inputs of pollutants, overfishing and coastal sprawl. The Semi-enclosed Arabian Seas, including the Arabian Gulf and the Red Sea, have supported human livelihoods in the Arabian Peninsula over centuries and continue to do so, but are also threatened by Global Change. These threats are particularly severe as Semi-enclosed Arabian Seas already present rather extreme conditions, in terms of temperature, salinity and oxygen concentration. The vulnerability of the unique marine ecosystems of the Semi-enclosed Arabian Seas to Global Change vectors is largely unknown, but predictions based on first principles suggest that they may be at or near the tipping point for many pressures, such as warming and hypoxia. There is an urgent need to implement international collaborative research programs to accelerate our understanding of the vulnerability of Semi-enclosed Arabian Seas to Global Change vectors in order to inform conservation and management plans to ensure these Seas continue to support the livelihoods and well-being of the Arab nations.
Evaluation of seismic resistance of low voltage switchgear, NPP V1 Jaslovske Bohunice, Slovakia
International Nuclear Information System (INIS)
Zeman, P.
1999-01-01
During this year, company Stevenson and Associates took part in the project of evaluation of seismic resistance of NPP V-1 Jaslovske Bohunice in Slovakia. It was responsible for a part of electrical equipment, mainly for the evaluation of low voltage switchgears. There were four steps of the evaluation: Detailed Walkdown; Application of GIP-WWER Methodology; Developing, of In Cabinet Response Spectra; and Evaluation of Acceptance of Formerly Performed Relay Tests According to the Russian Standard OEG l-330.00-3). Tests performed according to the Russian Standard OAG are acceptable only if the tested subject shows just one dominant natural frequency in the significant energy frequency range. If there is no knowledge of modal properties of the tested subject (that is a frequent situation because test reports usually contain only generalized Fourier loading spectrum) the enveloping of In Cabinet Response Spectra (ICRS) in all significant energy frequency ranges by Response Spectra (RS) of harmonic signal on one arbitrary frequency. This criteria is usually not satisfied because the shake tables used for the tests are not able to produce the sufficient level of excitation in the low frequency range. It may lead to the demand for test repeating
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
AC conductivity of a quantum Hall line junction
International Nuclear Information System (INIS)
Agarwal, Amit; Sen, Diptiman
2009-01-01
We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.
An effective device for gas-liquid oxygen removal in enclosed microalgae culture.
Science.gov (United States)
Su, Zhenfeng; Kang, Ruijuan; Shi, Shaoyuan; Cong, Wei; Cai, Zhaoling
2010-01-01
A high-performance gas-liquid transmission device (HPTD) was described in this paper. To investigate the HPTD mass transfer characteristics, the overall volumetric mass transfer coefficients, K(A)(La,CO(2)) for the absorption of gaseous CO(2) and K(A)(La,O(2)) for the desorption of dissolved O(2) were determined, respectively, by titration and dissolved oxygen electrode. The mass transfer capability of carbon dioxide was compared with that of dissolved oxygen in the device, and the operating conditions were optimized to suit for the large-scale enclosed micro-algae cultivation. Based on the effectiveness evaluation of the HPTD applied in one enclosed flat plate Spirulina culture system, it was confirmed that the HPTD can satisfy the demand of the enclosed system for carbon supplement and excessive oxygen removal.
Enclosed nests may provide greater thermal than nest predation benefits compared with open nests across latitudes
Science.gov (United States)
Martin, Thomas E.; Boyce, Andy J.; Fierro-Calderon, Karolina; Mitchell, Adam E.; Armstad, Connor E.; Mouton, James C.; Bin Soudi, Evertius E.
2017-01-01
Nest structure is thought to provide benefits that have fitness consequences for several taxa. Traditionally, reduced nest predation has been considered the primary benefit underlying evolution of nest structure, whereas thermal benefits have been considered a secondary or even non-existent factor. Yet, the relative roles of these factors on nest structures remain largely unexplored.Enclosed nests have a constructed or natural roof connected to sides that allow a restricted opening or tube entrance that provides cover in all directions except the entrance, whereas open nests are cups or platforms that are open above. We show that construction of enclosed nests is more common among songbirds (Passeriformes) in tropical and southern hemisphere regions than in north temperate regions. This geographic pattern may reflect selection from predation risk, under long-standing assumptions that nest predation rates are higher in southern regions and that enclosed nests reduce predation risk compared with open cup nests. We therefore compared nest predation rates between enclosed vs. open nests in 114 songbird species that do not nest in tree holes among five communities of coexisting birds, and for 205 non-hole-nesting species from the literature, across northern temperate, tropical, and southern hemisphere regions.Among coexisting species, enclosed nests had lower nest predation rates than open nests in two south temperate sites, but not in either of two tropical sites or a north temperate site. Nest predation did not differ between nest types at any latitude based on literature data. Among 319 species from both our field studies and the literature, enclosed nests did not show consistent benefits of reduced predation and, in fact, predation was not consistently higher in the tropics, contrary to long-standing perspectives.Thermal benefits of enclosed nests were indicated based on three indirect results. First, species that built enclosed nests were smaller than species using
-
UHF Signal Processing and Pattern Recognition of Partial Discharge in Gas-Insulated Switchgear Using Chromatic Methodology.
Science.gov (United States)
Wang, Xiaohua; Li, Xi; Rong, Mingzhe; Xie, Dingli; Ding, Dan; Wang, Zhixiang
2017-01-18
The ultra-high frequency (UHF) method is widely used in insulation condition assessment. However, UHF signal processing algorithms are complicated and the size of the result is large, which hinders extracting features and recognizing partial discharge (PD) patterns. This article investigated the chromatic methodology that is novel in PD detection. The principle of chromatic methodologies in color science are introduced. The chromatic processing represents UHF signals sparsely. The UHF signals obtained from PD experiments were processed using chromatic methodology and characterized by three parameters in chromatic space ( H , L , and S representing dominant wavelength, signal strength, and saturation, respectively). The features of the UHF signals were studied hierarchically. The results showed that the chromatic parameters were consistent with conventional frequency domain parameters. The global chromatic parameters can be used to distinguish UHF signals acquired by different sensors, and they reveal the propagation properties of the UHF signal in the L-shaped gas-insulated switchgear (GIS). Finally, typical PD defect patterns had been recognized by using novel chromatic parameters in an actual GIS tank and good performance of recognition was achieved.
-
Comparison of photovoltaic cell temperatures in modules operating with exposed and enclosed back surfaces
Science.gov (United States)
Namkoong, D.; Simon, F. F.
1981-01-01
Four different photovoltaic module designs were tested to determine the cell temperature of each design. The cell temperatures were compared to those obtained on identical design, using the same nominal operating cell temperature (NOCT) concept. The results showed that the NOCT procedure does not apply to the enclosed configurations due to continuous transient conditions. The enclosed modules had higher cell temperatures than the open modules, and insulated modules higher than the uninsulated. The severest performance loss - when translated from cell temperatures - 17.5 % for one enclosed, insulated module as a compared to that module mounted openly.
-
A nonlinear model for AC induced corrosion
Directory of Open Access Journals (Sweden)
N. Ida
2012-09-01
Full Text Available The modeling of corrosion poses particular difficulties. The understanding of corrosion as an electrochemical process has led to simple capacitive-resistive models that take into account the resistance of the electrolytic cell and the capacitive effect of the surface potential at the interface between conductors and the electrolyte. In some models nonlinear conduction effects have been added to account for more complex observed behavior. While these models are sufficient to describe the behavior in systems with cathodic protection, the behavior in the presence of induced AC currents from power lines and from RF sources cannot be accounted for and are insufficient to describe the effects observed in the field. Field observations have shown that a rectifying effect exists that affects the cathodic protection potential and this effect is responsible for corrosion in the presence of AC currents. The rectifying effects of the metal-corrosion interface are totally missing from current models. This work proposes a nonlinear model based on finite element analysis that takes into account the nonlinear behavior of the metal-oxide interface and promises to improve modeling by including the rectification effects at the interface.
-
AC electric field induced dipole-based on-chip 3D cell rotation.
Science.gov (United States)
Benhal, Prateek; Chase, J Geoffrey; Gaynor, Paul; Oback, Björn; Wang, Wenhui
2014-08-07
The precise rotation of suspended cells is one of the many fundamental manipulations used in a wide range of biotechnological applications such as cell injection and enucleation in nuclear transfer (NT) cloning. Noticeably scarce among the existing rotation techniques is the three-dimensional (3D) rotation of cells on a single chip. Here we present an alternating current (ac) induced electric field-based biochip platform, which has an open-top sub-mm square chamber enclosed by four sidewall electrodes and two bottom electrodes, to achieve rotation about the two axes, thus 3D cell rotation. By applying an ac potential to the four sidewall electrodes, an in-plane (yaw) rotating electric field is generated and in-plane rotation is achieved. Similarly, by applying an ac potential to two opposite sidewall electrodes and the two bottom electrodes, an out-of-plane (pitch) rotating electric field is generated and rolling rotation is achieved. As a prompt proof-of-concept, bottom electrodes were constructed with transparent indium tin oxide (ITO) using the standard lift-off process and the sidewall electrodes were constructed using a low-cost micro-milling process and then assembled to form the chip. Through experiments, we demonstrate rotation of bovine oocytes of ~120 μm diameter about two axes, with the capability of controlling the rotation direction and the rate for each axis through control of the ac potential amplitude, frequency, and phase shift, and cell medium conductivity. The maximum observed rotation rate reached nearly 140° s⁻¹, while a consistent rotation rate reached up to 40° s⁻¹. Rotation rate spectra for zona pellucida-intact and zona pellucida-free oocytes were further compared and found to have no effective difference. This simple, transparent, cheap-to-manufacture, and open-top platform allows additional functional modules to be integrated to become a more powerful cell manipulation system.
-
Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org
2002-12-01
The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.
-
10 CFR 830 Major Modification Determination for the ATR Diesel Bus (E-3) and Switchgear Replacement
International Nuclear Information System (INIS)
Duckwitz, Noel
2011-01-01
Near term replacement of aging and obsolescent original ATR equipment has become important to ensure ATR capability in support of NE's long term national missions. To that end, a mission needs statement has been prepared for a non-major system acquisition which is comprised of three interdependent subprojects. The first project, subject of this determination, will replace the existent diesel-electrical bus (E-3) and associated switchgear. More specifically, INL proposes transitioning ATR to 100% commercial power with appropriate emergency backup to include: (1) Provide commercial power as the normal source of power to the ATR loads currently supplied by diesel-electric power. (2) Provide backup power to the critical ATR loads in the event of a loss of commercial power. (3) Replace obsolescent critical ATR power distribution equipment, e.g., switchgear, transformers, motor control centers, distribution panels. Completion of this and two other age-related projects (primary coolant pump and motor replacement and emergency firewater injection system replacement) will resolve major age related operational issues plus make a significant contribution in sustaining the ATR safety and reliability profile. The major modification criteria evaluation of the project pre-conceptual design identified several issues make the project a major modification: (1) Evaluation Criteria No.2 (Footprint change). The addition of a new PC-4 structure to the ATR Facility to house safety-related SSCs requires careful attention to maintaining adherence to applicable engineering and nuclear safety design criteria (e.g., structural qualification, fire suppression) to ensure no adverse impacts to the safety-related functions of the housed equipment. (2) Evaluation Criteria No.3 (Change of existing process). The change to the strategy for providing continuous reliable power to the safety-related emergency coolant pumps requires careful attention and analysis to ensure it meets a project primary
-
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
-
The spatial distribution of dissolved and particulate heavy metals and their response to land-based inputs and tides in a semi-enclosed industrial embayment: Jiaozhou Bay, China.
Science.gov (United States)
Wang, Changyou; Liang, Shengkang; Li, Yanbin; Li, Keqiang; Wang, Xiulin
2015-07-01
In order to evaluate heavy metal contamination in surface waters in the Jiaozhou Bay (JZB), a typical semi-enclosed bay in the north of China, and to identify the response of heavy metal distribution to terrigenous sources and tides, the land-based discharge flux of dissolved Cu, Pb, Zn and Cd and their particulates, as well as their concentrations, were synchronously surveyed in JZB in flood season and normal season respectively. The survey results showed that the amount of dissolved Cu clearly increased from the estuaries to the offshore waters during the flood season, especially from the Dagu estuary to the mouth of JZB. The same trend was observed for Pb. The isopleths of dissolved Zn during the flood season presented a different pattern in which a clear decrease was observed from the Lianwan, Moshui and Dagu estuaries to the offshore waters. However, the particulate Cu isopleths during the flood season, which had the same pattern as those of particulate Pb, Zn and Cd, showed a clear decrease from the Dagu estuary to the mouth of JZB. The isopleths for dissolved and particulate Cu during the normal season showed a clear decrease from the northeast to the entrance of JZB, and the same trend was observed for Pb, Zn and Cd. Observations based on synchronous investigations of the fluvial fluxes of the selected metals and their average concentrations in JZB showed that these patterns were controlled by the strong external fluvial inputs, especially from the Dagu River. The diurnal change in the Cu, Pb, Zn and Cd concentrations showed a periodicity with a cycle length of approximately 12 h in JZB, which indicates the noticeable impact of the semi-diurnal tide. The weighed average concentration from freshwater inputs calculated for dissolved Cu, Pb, Zn and Cd were higher than their average concentrations in JZB. This indicated that JZB had been contaminated with these metals, whose concentrations were also higher than those found in uncontaminated waters.
-
Low AC-Loss Superconducting Cable Technology for Electric Aircraft Propulsion, Phase I
Data.gov (United States)
National Aeronautics and Space Administration — The availability of low AC loss magnesium diboride (MgB2) superconducting wires enables much lighter weight superconducting stator coils than with any other metal or...
-
THE ACS NEARBY GALAXY SURVEY TREASURY. IX. CONSTRAINING ASYMPTOTIC GIANT BRANCH EVOLUTION WITH OLD METAL-POOR GALAXIES
International Nuclear Information System (INIS)
Girardi, Leo; Williams, Benjamin F.; Gilbert, Karoline M.; Rosenfield, Philip; Dalcanton, Julianne J.; Marigo, Paola; Boyer, Martha L.; Dolphin, Andrew; Weisz, Daniel R.; Skillman, Evan; Melbourne, Jason; Olsen, Knut A. G.; Seth, Anil C.
2010-01-01
In an attempt to constrain evolutionary models of the asymptotic giant branch (AGB) phase at the limit of low masses and low metallicities, we have examined the luminosity functions and number ratios between AGB and red giant branch (RGB) stars from a sample of resolved galaxies from the ACS Nearby Galaxy Survey Treasury. This database provides Hubble Space Telescope optical photometry together with maps of completeness, photometric errors, and star formation histories for dozens of galaxies within 4 Mpc. We select 12 galaxies characterized by predominantly metal-poor populations as indicated by a very steep and blue RGB, and which do not present any indication of recent star formation in their color-magnitude diagrams. Thousands of AGB stars brighter than the tip of the RGB (TRGB) are present in the sample (between 60 and 400 per galaxy), hence, the Poisson noise has little impact in our measurements of the AGB/RGB ratio. We model the photometric data with a few sets of thermally pulsing AGB (TP-AGB) evolutionary models with different prescriptions for the mass loss. This technique allows us to set stringent constraints on the TP-AGB models of low-mass, metal-poor stars (with M sun , [Fe/H]∼ sun . This is also in good agreement with recent observations of white dwarf masses in the M4 old globular cluster. These constraints can be added to those already derived from Magellanic Cloud star clusters as important mileposts in the arduous process of calibrating AGB evolutionary models.
-
AC Initiation System.
Science.gov (United States)
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
-
Designing of Metallic Photonic Structures and Applications
International Nuclear Information System (INIS)
Yong-Sung Kim
2006-01-01
In this thesis our main interest has been to investigate metallic photonic crystal and its applications. We explained how to solve a periodic photonic structure with transfer matrix method and when and how to use modal expansion method. Two different coating methods were introduced, modifying a photonic structure's intrinsic optical properties and rigorous calculation results are presented. Two applications of metallic photonic structures are introduced. For thermal emitter, we showed how to design and find optimal structure. For conversion efficiency increasing filter, we calculated its efficiency and the way to design it. We presented the relation between emitting light spectrum and absorption and showed the material and structural dependency of the absorption spectrum. By choosing a proper base material and structural parameters, we can design a selective emitter at a certain region we are interested in. We have developed a theoretical model to analyze a blackbody filament enclosed by a metallic mesh which can increase the efficiency of converting a blackbody radiation to visible light. With this model we found that a square lattice metallic mesh enclosing a filament might increase the efficiency of incandescent lighting sources. Filling fraction and thickness dependency were examined and presented. Combining these two parameters is essential to achieve the maximum output result
-
Pipeline grounding condition: A control of pipe-to-soil potential for AC interference induced corrosion reduction
CSIR Research Space (South Africa)
Adedeji, KB
2017-02-01
Full Text Available The interference effect from high voltage overhead lines on nearby metallic pipelines is a major challenge for utility owners due to the induced AC potentials on metallic pipelines. Nevertheless, numerous mitigation techniques have been proposed...
-
Vulnerability of semi-enclosed marine systems to environmental disturbances
Digital Repository Service at National Institute of Oceanography (India)
MacCracken, M.; Escobar-Briones, E; Gilbert, D.; Korotaev, G.; Naqvi, S.W.A.; Perillo, G.M.E; Rixen, T.; Stanev, E; Sundby, B.; Thomas, H.; Unger, D.; Urban, E
Semi-Enclosed Marine Systems to Environmental Disturbances Michael MacCracken t Elva Escobar-Briones t Denis Gilbert, Gennady Korotaev, Wajih Naqvi, Gerardo M.E. Perillo, Tim Rixen, Emil Stanev, Bj0rn Sundby, Helmuth Thomas t Daniela Unger, and Edward R. Urban, Jr...
-
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
-
Multi-phase AC/AC step-down converter for distribution systems
Science.gov (United States)
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
-
Facile Synthesis of Gold Nanorice Enclosed by High- Index Facets and Its Application for CO Oxidation
International Nuclear Information System (INIS)
Zheng, Y.; Tao, J.; Liu, H.; Zeng, J.; Yu, T.; Ma, Y.; Moran, C.; Wu, L.; Zhu, Y.; Liu, J.; Xia, Y.
2011-01-01
A facile method for generating Au nanorice enclosed by high-index facets in high purity. The nanorice shows much higher catalytic activity for CO oxidation than multiply twinned particles of Au enclosed by {111} facets at temperatures below 300 C.
-
Enclosed belts in the ascendancy
Energy Technology Data Exchange (ETDEWEB)
NONE
2010-03-15
Although there will always be a place for traditional overland belt conveyors, enclosed belt systems are increasingly being specified where environmental protection assumes high priority or where there is a need to protect material from the weather. The article reports on recent conveyor projects such as: an MRC cable Belt in a 6.4 km system to carry coal in the Appalachian Mountains; a $40 m contract awarded to FL Smidth to supply an integrated coal handling system to LILIAMA in Vietnam and other contracts to handle coal for India's Coastal Gujarat Power; and a contract awarded to Bateman Engineered Technologies to supply a 7 km Japan Pipe Conveyor for a coal power station in Brazil. 3 photos.
-
AC – AC Converters for UPS
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
-
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
-
Computational and experimental methods for enclosed natural convection
International Nuclear Information System (INIS)
Larson, D.W.; Gartling, D.K.; Schimmel, W.P. Jr.
1977-10-01
Two computational procedures and one optical experimental procedure for studying enclosed natural convection are described. The finite-difference and finite-element numerical methods are developed and several sample problems are solved. Results obtained from the two computational approaches are compared. A temperature-visualization scheme using laser holographic interferometry is described, and results from this experimental procedure are compared with results from both numerical methods
-
Segmentally enclosed thrombolysis in percutaneous transluminal angioplasty for femoropopliteal occlusions
DEFF Research Database (Denmark)
Jørgensen, B; Tønnesen, K H; Nielsen, J D
1991-01-01
Segmentally enclosed thrombolysis (SET) was performed immediately following 34 percutaneous transluminal angioplasties (PTAs) for femoropopliteal occlusions. The dilated segment was sealed off with a double balloon catheter, and recombinant tissue plasminogen activator (rt-PA) 1 mg/ml and heparin...
-
Magnet power system for the Microwave Tokamak Experiment (MTX)
International Nuclear Information System (INIS)
Jackson, M.C.; Musslewhite, R.C.
1987-01-01
The system configuration, layout, and general philosophy for the MTX magnet power system is described. The vast majority of the magnet power equipment was quite successfully used on the ALCATOR-C experiment at the Massachusetts Institute of Technology. The AC power for the magnet system at MIT was obtained from a 225MVA alternator. The power for the system at LLNL is obtained directly from the local utility's 230 kV line. This installation, therefore, necessitates the addition of a great deal of equipment in ranges from new switchgear in the substation to using existing switchgear obtained from MIT as contractors for intershop electrical isolation as well as safety isolation for personnel entry into the experimental area. Additionally, some discussion is made of the unique layout of this facility and the tradeoffs made to accommodate them. 2 refs., 6 figs
-
Quantum transport in coupled resonators enclosed synthetic magnetic flux
International Nuclear Information System (INIS)
Jin, L.
2016-01-01
Quantum transport properties are instrumental to understanding quantum coherent transport processes. Potential applications of quantum transport are widespread, in areas ranging from quantum information science to quantum engineering, and not restricted to quantum state transfer, control and manipulation. Here, we study light transport in a ring array of coupled resonators enclosed synthetic magnetic flux. The ring configuration, with an arbitrary number of resonators embedded, forms a two-arm Aharonov–Bohm interferometer. The influence of magnetic flux on light transport is investigated. Tuning the magnetic flux can lead to resonant transmission, while half-integer magnetic flux quantum leads to completely destructive interference and transmission zeros in an interferometer with two equal arms. -- Highlights: •The light transport is investigated through ring array of coupled resonators enclosed synthetic magnetic field. •Aharonov–Bohm ring interferometer of arbitrary configuration is investigated. •The half-integer magnetic flux quantum leads to destructive interference and transmission zeros for two-arm at equal length. •Complete transmission is available via tuning synthetic magnetic flux.
-
21 CFR 886.4400 - Electronic metal locator.
Science.gov (United States)
2010-04-01
...) MEDICAL DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4400 Electronic metal locator. (a) Identification. An electronic metal locator is an AC-powered device with probes intended to locate metallic foreign bodies in the eye or eye socket. (b) Classification. Class II. ...
-
Expert System Control of Plant Growth in an Enclosed Space
Science.gov (United States)
May, George; Lanoue, Mark; Bathel, Matthew; Ryan, Robert E.
2008-01-01
The Expert System is an enclosed, controlled environment for growing plants, which incorporates a computerized, knowledge-based software program that is designed to capture the knowledge, experience, and problem-solving skills of one or more human experts in a particular discipline. The Expert System is trained to analyze crop/plant status, to monitor the condition of the plants and the environment, and to adjust operational parameters to optimize the plant-growth process. This system is intended to provide a way to remotely control plant growth with little or no human intervention. More specifically, the term control implies an autonomous method for detecting plant states such as health (biomass) or stress and then for recommending and implementing cultivation and/or remediation to optimize plant growth and to minimize consumption of energy and nutrients. Because of difficulties associated with delivering energy and nutrients remotely, a key feature of this Expert System is its ability to minimize this effort and to achieve optimum growth while taking into account the diverse range of environmental considerations that exist in an enclosed environment. The plant-growth environment for the Expert System could be made from a variety of structures, including a greenhouse, an underground cavern, or another enclosed chamber. Imaging equipment positioned within or around the chamber provides spatially distributed crop/plant-growth information. Sensors mounted in the chamber provide data and information pertaining to environmental conditions that could affect plant development. Lamps in the growth environment structure supply illumination, and other additional equipment in the chamber supplies essential nutrients and chemicals.
-
Comparative architecture of octahedral protein cages. I. Indexed enclosing forms
Science.gov (United States)
Janner, A.
2008-07-01
The architecture of four protein cages (bacterio ferritin, human mitochondrial ferritin, sulfur oxygenase reductase and small heat-shock protein) are compared top-to-bottom, starting from polyhedra with vertices at cubic lattice points enclosing the cage down to indexed polyhedral forms of single monomers.
-
The application of prepared porous carbon materials: Effect of different components on the heavy metal adsorption.
Science.gov (United States)
Song, Min; Wei, Yuexing; Yu, Lei; Tang, Xinhong
2016-06-01
In this study, five typical municipal solid waste (MSW) components (tyres, cardboard, polyvinyl chloride (PVC), acrylic textile, toilet paper) were used as raw materials to prepare four kinds of MSW-based carbon materials (paperboard-based carbon materials (AC1); the tyres and paperboard-based carbon materials (AC2); the tyres, paperboard and PVC-based carbon materials (AC3); the tyres, paperboard, toilet paper, PVC and acrylic textile-based carbon materials (AC4)) by the KOH activation method. The characteristic results illustrate that the prepared carbon adsorbents exhibited a large pore volume, high surface area and sufficient oxygen functional groups. Furthermore, the application of AC1, AC2, AC3, AC4 on different heavy metal (Cu(2+), Zn(2+), Pb(2+), Cr(3+)) removals was explored to investigate their adsorption properties. The effects of reaction time, pH, temperature and adsorbent dosage on the adsorption capability of heavy metals were investigated. Comparisons of heavy metal adsorption on carbon of different components were carried out. Among the four samples, AC1 exhibits the highest adsorption capacity for Cu(2+); the highest adsorption capacities of Pb(2+) and Zn(2+) are obtained for AC2; that of Cr(3+) are obtained for AC4. In addition, the carbon materials exhibit better adsorption capability of Cu(2+) and Pb(2+) than the other two kind of metal ions (Zn(2+) and Cr(3+)). © The Author(s) 2016.
-
AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts
Energy Technology Data Exchange (ETDEWEB)
Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2011-01-01
While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.
-
Analysis of the ac SQUID with low inductance and low critical current
DEFF Research Database (Denmark)
Sørensen, O. H.
1976-01-01
The properties of the ac SQUID magnetometer has been analyzed. The results are valid in the low-inductance low-critical-current regime, where the Lri0 producted is belowthe value at which the relation between the enclosed and externally applied magnetic dc flux becomes reentrant. The effects...... of the screening current circulating in the SQUID ring as well as of the SQUID-ring time constant, tau-Lr/R9 are taken into account. Here LR IS THE SQUID-ring inductance, and R is the shunt resistance in the shunted junction model assumed to describe the weak link. It is shown that for finite values of omegatau...... constriuctively with the result that the optimal response occurs at a definite and finite value of omegatau. If omegatau is increased beyond this optimal value the weak link behavior is dominated by the Ohmic current channel implying that only if the shunt conductance contains a term depending...
-
Effect of alkali content on AC conductivity of borate glasses containing two transition metals
International Nuclear Information System (INIS)
Kashif, I.; Rahman, Samy A.; Soliman, A.A.; Ibrahim, E.M.; Abdel-Khalek, E.K.; Mostafa, A.G.; Sanad, A.M.
2009-01-01
Sodium borate glasses containing iron and molybdenum ions with the total concentration of transition ions constant and gradual substitution of sodium oxide (network modifier) by borate oxide (network former) was prepared. Densities, molar volume, DC and AC conductivities are measured. The trends of these properties are attributed to changes in the glass network structure. Their DC and AC conductivity increased with increasing NaO concentration. The increase of AC conductivity of sodium borate glasses is attributed to the chemical composition and the hopping mechanism of conduction. Measurements of the dielectric constant (ε) and dielectric loss (tan δ) as a function of frequency (50 Hz-100 kHz) and temperature (RT-600 K) indicate that the increase in dielectric constant and loss (ε and tan δ) values with increasing sodium ion content could be attributed to the assumption that Fe and Mo ions tend to assume network-forming position in the glass compositions studied. The variation of the value of frequency exponent s for all glass samples as the function of temperature at a definite frequency indicates that the value of s decreases with increasing the temperature which agrees with the correlated barrier-hopping (CBH) model.
-
Planning aspects of ac extra high voltage lines
Energy Technology Data Exchange (ETDEWEB)
Engelhardt, H
1964-01-01
The technical points arising in any project for application of higher voltages on power grids in Europe are discussed. The cost aspects of two alternative ways of extending the voltage level of existing systems are discussed in detail. The short-circuit current in a high-power system with isolated or grounded neutral point and its relation to the mode of grounding is examined. For a transmission distance of 200 kVm, operating cost for each kWh transmitted are shown on curves for voltages of 220, 380 and 700 kV against transmitted energy. This shows that for any rated voltage there is a range of energy values which can be transmitted economically. Factors to be considered in maintaining, selecting or rejecting transformers and switchgear of other systems for higher voltage purposes are mentioned.
-
Ethical and legal analyses of policy prohibiting tobacco smoking in enclosed public spaces.
Science.gov (United States)
Oriola, Taiwo A
2009-01-01
A spate of legislations prohibiting cigarette smoking in enclosed public spaces, mainly on grounds of public health protection, recently swept across cities around the world. This is in tandem with a raft of increasingly restrictive national laws that emerged on the back of the ratification of the WHO Framework for Tobacco Control by more than one 168 countries in 2005. The central debate on the increasingly restrictive tobacco laws revolves on the extent to which public health interests justification should ground political intervention in a private right as basic as tobacco smoking, which interestingly is often lumped in the food and beverage category. The pertinent legal and ethical questions therefore are the following: Is or should there be a general unrestricted right to tobacco smoking? If there were such a right, should public health or ethical considerations trump private right to smoke in enclosed public spaces? And if public health interests were so paramount, should they go farther and ground tobacco smoking proscription in all private and public spheres? Using ethical principles and rights-based arguments, the paper critically examines the legal and ethical ramifications of public health justification for tobacco smoking proscription in enclosed public spaces.
-
Fullerenes doped with metal halides
International Nuclear Information System (INIS)
Martin, T.P.; Heinebrodt, M.; Naeher, U.; Goehlich, H.; Lange, T.; Schaber, H.
1993-01-01
The cage-like structure of fullerenes is a challenge to every experimental to put something inside - to dope the fullerenes. In fact, the research team that first identified C 60 as a football-like molecule quickly succeeded in trapping metal atoms inside and in shrinking the cage around this atom by photofragmentation. In this paper we report the results of ''shrink-wrapping'' the fullerenes around metal halide molecules. Of special interest is the critical size (the minimum number of carbon atoms) that can still enclose the dopant. A rough model for the space available inside a carbon cage gives good agreement with the measured shrinking limits. (author). 8 refs, 6 figs
-
Inkjet printing of multifilamentary YBCO for low AC loss coated conductors
International Nuclear Information System (INIS)
Hopkins, S C; Joseph, D; Mitchell-Williams, T B; Glowacki, B A; Calleja, A; Vlad, V R; Vilardell, M; Ricart, S; Granados, X; Puig, T; Obradors, X; Usoskin, A; Falter, M; Bäcker, M
2014-01-01
Considerable progress has been made with the development of REBCO coated conductors in recent years, and high performance conductors are available commercially. For many applications, however, the cost remains prohibitive, and AC losses discourage their selection for higher frequency applications. Chemical solution deposition (CSD) methods are attractive for low-cost, scalable preparation of buffer and superconductor layers, and in many respects inkjet printing is the method of choice, permitting non-contact deposition with minimal materials wastage and excellent control of coating thickness. Highly textured coatings of YBCO and Gd-doped CeO 2 have previously been reported on buffered metal substrates. Inkjet printing also introduces the possibility of patterning - directly depositing two and three dimensional structures without subtractive processing - offering a low-cost route to coated conductors with reduced AC losses. In this contribution, the inkjet deposition of superconducting YBCO tracks is reported on industrially relevant buffered metal substrates both by direct printing and an inverse patterning approach. In the latter approach, ceria tracks were printed reported, which are a candidate both for resistive filament spacers and buffer layers. TFA-based precursor solutions have been printed on SS/ABAD-YSZ/CeO 2 and Ni-W/LZO/CeO 2 RABiTS substrates, and the resulting multifilamentary samples characterised by microscopy and scanning Hall probe measurements. The prospects for future inkjet-printed low AC loss coated conductors are discussed, including control of interfilamentary resistivity and bridging, transposed filamentary structures and stabilisation material.
-
Peltier ac calorimeter
OpenAIRE
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
-
Specification of indoor climate design parameters at the assessment of moisture protective properties of enclosing structures
Directory of Open Access Journals (Sweden)
Kornienko Sergey Valer’evich
2016-11-01
Full Text Available Due to wide implementation of enveloping structures with increased heat-insulation properties in modern construction here appeared a necessity to assess their moisture conditions. Assessment of moisture conditions of enveloping structures is carried out according to maximum allowable moisture state basing on determining the surface of maximum damping. In relation to it the necessity of additional vapour barrier is checked using moisture balance equation. Though the change of indoor climate parameters in premises is not taken into account in moisture balance equations defined for different seasons. The author improves the method of calculating moisture protective parameters of enclosing structures according to the maximum allowable damping state for a year and a period of moisture accumulation. It is shown in this article that accounting of temperature and relative humidity change of inside air allows specifying calculated parameters of indoor climate in residential and office rooms in assessment of moisture protective properties of enclosing structures for the case of an effective enclosing structure with a façade heat-insulation composite system. Coordinates of the maximum moistened surface of the envelope depends on indoor climate design parameters. It is concluded that the increase of requirements for moisture protection of enclosing structures when using design values of temperature and relative humidity of internal air according to the Russian regulation (SP 50.13330.2012 is not always reasonable. Accounting of changes of indoor climate parameters allows more precise assessment of moisture protective properties of enclosing structures during their design.
-
Cover Letter Dear Editor, Please find enclosed a paper entitled ...
African Journals Online (AJOL)
Ajamein
Dear Editor,. Please find enclosed a paper entitled ' Intrinsic Kinetics of Fischer- Tropsch Synthesis Over a. Promoted Iron Catalyst '. I am submitting to your journal to be considered for publication as a research paper in Bulletin of the Chemical Society of Ethiopia. The manuscript has not been previously published, is not ...
-
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
-
Adventitious Carbon on Primary Sample Containment Metal Surfaces
Science.gov (United States)
Calaway, M. J.; Fries, M. D.
2015-01-01
Future missions that return astromaterials with trace carbonaceous signatures will require strict protocols for reducing and controlling terrestrial carbon contamination. Adventitious carbon (AC) on primary sample containers and related hardware is an important source of that contamination. AC is a thin film layer or heterogeneously dispersed carbonaceous material that naturally accrues from the environment on the surface of atmospheric exposed metal parts. To test basic cleaning techniques for AC control, metal surfaces commonly used for flight hardware and curating astromaterials at JSC were cleaned using a basic cleaning protocol and characterized for AC residue. Two electropolished stainless steel 316L (SS- 316L) and two Al 6061 (Al-6061) test coupons (2.5 cm diameter by 0.3 cm thick) were subjected to precision cleaning in the JSC Genesis ISO class 4 cleanroom Precision Cleaning Laboratory. Afterwards, the samples were analyzed by X-ray photoelectron spectroscopy (XPS) and Raman spectroscopy.
-
Global change in marine ecosystems: implications for semi-enclosed Arabian seas
KAUST Repository
Duarte, Carlos M.
2015-01-01
-enclosed Arabian Seas to Global Change vectors is largely unknown, but predictions based on first principles suggest that they may be at or near the tipping point for many pressures, such as warming and hypoxia. There is an urgent need to implement international
-
Removal and recovery of gas-phase element mercury by metal oxide-loaded activated carbon
International Nuclear Information System (INIS)
Mei Zhijian; Shen Zhemin; Zhao Qingjie; Wang Wenhua; Zhang Yejian
2008-01-01
The reusability of Co 3 O 4 (AC-Co), MnO 2 (AC-Mn) and CuCoO 4 (AC-CC) loaded activated carbon (AC) and their element mercury removal efficiency had been studied using a laboratory-scale fixed-bed reactor under simulated flue gas conditions. Tests showed that spent AC-Co could be regenerated through heating at 673 K under N 2 atmosphere and the enrichment regenerated Hg 0 could be collected to eliminate the secondary pollution. Regenerated AC-Mn and AC-CC's Hg 0 removal efficiency decreased greatly due to AC's decomposition and MnO 2 's crystal structure variation. Compared with AC and metal oxides, metal oxide-loaded AC had higher Hg 0 capture ability and capacity due to AC huge surface areas and lots of function groups. TGA analysis results showed that AC-Co and AC-Mn's HgO adsorptive capacity at 523 K reached 19.8 mg g -1 and 5.21 mg g -1 , respectively. High loading values and adsorption temperatures were beneficial to AC-Co's Hg 0 removal efficiency. However, CuCoO 4 and MnO 2 's AC decomposition ability had negative effect on AC-CC and AC-Mn's performance, respectively, especially at high adsorption temperatures and loading values. SO 2 tests showed that AC-CC had higher anti SO 2 -poisoning ability than AC-Co and AC-Mn
-
Operation of an enclosed aquatic ecosystem in the Shenzhou-8 mission
Science.gov (United States)
Li, Xiaoyan; Richter, Peter R.; Hao, Zongjie; An, Yanjun; Wang, Gaohong; Li, Dunhai; Liu, Yongding; Strauch, Sebastian M.; Schuster, Martin; Haag, Ferdinand W.; Lebert, Michael
2017-05-01
Long- term spaceflight needs reliable Biological life support systems (BLSS) to supply astronauts with enough food, fresh air and recycle wasters, but the knowledge about the operation pattern and controlling strategy is rear. For this purpose, a miniaturized enclosed aquatic ecosystem was developed and flown on the Chinese spaceship Shenzhou-8. The system with a total volume of about 60 mL was separated into two chambers by means of a gas transparent membrane. The lower chamber was inoculated with Euglena gracilis cells, and the upper chamber was cultured with Chlorella cells and three snails. After 17.5 days flight, the samples were analyzed. It was found that all snails in the ground module (GM) were alive, while in the flight module (FM) only one snail survived. The total cell numbers, assimilation of nutrients like nitrogen and phosphorus, soluble proteins and carbohydrate contents showed a decrease in FM than in GM. The correlation analysis showed upper chambers of both FM and GM had the same positive and negative correlation factors, while differential correlation was found in lower chambers. These results suggested primary productivity in the enclosed system decreased in microgravity, accompanied with nutrients assimilation. The FM chamber endured lacking of domination species to sustain the system development and GM chamber endured richness in population abundance. These results implied photosynthesis intensity should be reduced to keep the system healthy. More Chlorella but less Euglena might be a useful strategy to sustain system stability. It is the first systematic analysis of enclosed systems in microgravity.
-
Electrical conductivity of metal (hydr)oxide–activated carbon composites under compression. A comparison study
Energy Technology Data Exchange (ETDEWEB)
Barroso-Bogeat, A., E-mail: adrianbogeat@unex.es [Department of Organic and Inorganic Chemistry, Faculty of Sciences, University of Extremadura, Avda. de Elvas s/n, E-06006 Badajoz (Spain); Alexandre-Franco, M.; Fernández-González, C. [Department of Organic and Inorganic Chemistry, Faculty of Sciences, University of Extremadura, Avda. de Elvas s/n, E-06006 Badajoz (Spain); Sánchez-González, J. [Department of Mechanical, Energetic and Materials Engineering, University of Extremadura, Avda. de Elvas s/n, E-06006 Badajoz (Spain); Gómez-Serrano, V. [Department of Organic and Inorganic Chemistry, Faculty of Sciences, University of Extremadura, Avda. de Elvas s/n, E-06006 Badajoz (Spain)
2015-02-15
From a granular commercial activated carbon (AC) and six metal (hydr)oxide precursors, including Al(NO{sub 3}){sub 3}, Fe(NO{sub 3}){sub 3}, SnCl{sub 2}, TiO{sub 2}, Na{sub 2}WO{sub 4} and Zn(NO{sub 3}){sub 2}, a broadly varied series of metal (hydr)oxide–AC composites were prepared by wet impregnation and subsequent oven-drying at 120 °C. Here, the electrical conductivity of the resulting products was studied under moderate compression. The influence of the applied pressure, sample volume, mechanical work, and density of the hybrid materials was thoroughly investigated. The dc electrical conductivity of the compressed samples was measured at room temperature by the four-probe method. Compaction assays show that the mechanical properties of the composites are largely determined by the carbon matrix. Both the decrease in volume and the increase in density under compression were very small and only significant at pressures lower than 100 kPa for AC and most composites. By contrast, the bulk electrical conductivity of the hybrid materials was strongly influenced by the nature, content and intrinsic conductivity of the supported metal phases, which act as insulating thin layers thereby hindering the effective electron transport between AC cores of neighbouring sample particles in contact under compression. Conductivity values for the composites were lower than for the raw AC, all of them falling in the range of typical semiconductor materials. The patterns of variation of the electrical conductivity with pressure and mechanical work were slightly similar, thus suggesting the predominance of the pressure effects rather than the volume ones. - Highlights: • Pressure-dependent conductivity is studied for metal (hydr)oxide–AC composites. • Mechanical properties of the composites are essentially determined by AC. • Supported metal (hydr)oxides determine the bulk conductivity of the composites. • Metal (hydr)oxides act as insulating thin layers hindering the
-
Experiments with Liquid Metal Walls: Status of the Lithium Tokamak Experiment
OpenAIRE
Boyle, Dennis; Gray, Timothy; Granstedt, Erik; Kozub, Thomas; Berzak, Laura; Hammett, Gregory; Kugel, Henry; Leblanc, Benoit; Logan, Nicholas; Jacobson, Craig M.; Lucia, Matthew; Jones, Andrew; Lundberg, Daniel; Timberlake, John; Majeski, Richard
2010-01-01
Liquid metal walls have been proposed to address the first wall challenge for fusion reactors. The Lithium Tokamak Experiment (LTX) at the Princeton Plasma Physics Laboratory (PPPL) is the first magnetic confinement device to have liquid metal plasma-facing components (PFC's) that encloses virtually the entire plasma. In the Current Drive Experiment-Upgrade (CDX-U), a predecessor to LTX at PPPL, the highest improvement in energy confinement ever observed in Ohmically-heated tokamak plasmas wa...
-
ACS Zero Point Verification
Science.gov (United States)
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
-
Effect of dispersion hardening on impact resistance of EN AC-AlSi12Cu2Fe silumin
Directory of Open Access Journals (Sweden)
J. Pezda
2009-04-01
Full Text Available Development of modern technology have generated supply of better and better, more resistant structural materials not attainable earlier.Weight of metal structures is of a great importance, and as a consequence, also weight of materials used for a given structure. More often, for metal structures are used lightweight metals and their alloys, from which aluminum and its alloys have become the most widespread. These alloys, based on Al-Si equilibrium system, contain additional constituents (e.g.: Mg, Cu enabling, except modification,improvement of mechanical properties obtained in result of heat treatment. The paper presents an effect of modification process and heat treatment on impact resistance of EN AC-AlSi12Cu2Fe alloy. Solutioning and ageing temperatures were selected on base of registered curves of the ATD method. For the neareutectic EN AC-AlSi12Cu2Fe silumin one obtained growth of the impact resistance both due to performed modification treatment and performed heat treatments of the alloy.
-
Low Offset AC Correlator.
Science.gov (United States)
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
-
AC power supply systems
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
-
Removal and recovery of gas-phase element mercury by metal oxide-loaded activated carbon
Energy Technology Data Exchange (ETDEWEB)
Mei Zhijian [School of Environmental Science and Engineering, Shanghai Jiao Tong University, 800 Dong Chuan Road, Shanghai 200240 (China); Shen Zhemin [School of Environmental Science and Engineering, Shanghai Jiao Tong University, 800 Dong Chuan Road, Shanghai 200240 (China)], E-mail: pnyql520@hotmail.com; Zhao Qingjie [Shanghai Academy of Environmental Science, 508 Qin-Zhou Road, Shanghai 200233 (China); Wang Wenhua; Zhang Yejian [School of Environmental Science and Engineering, Shanghai Jiao Tong University, 800 Dong Chuan Road, Shanghai 200240 (China)
2008-04-01
The reusability of Co{sub 3}O{sub 4} (AC-Co), MnO{sub 2} (AC-Mn) and CuCoO{sub 4} (AC-CC) loaded activated carbon (AC) and their element mercury removal efficiency had been studied using a laboratory-scale fixed-bed reactor under simulated flue gas conditions. Tests showed that spent AC-Co could be regenerated through heating at 673 K under N{sub 2} atmosphere and the enrichment regenerated Hg{sup 0} could be collected to eliminate the secondary pollution. Regenerated AC-Mn and AC-CC's Hg{sup 0} removal efficiency decreased greatly due to AC's decomposition and MnO{sub 2}'s crystal structure variation. Compared with AC and metal oxides, metal oxide-loaded AC had higher Hg{sup 0} capture ability and capacity due to AC huge surface areas and lots of function groups. TGA analysis results showed that AC-Co and AC-Mn's HgO adsorptive capacity at 523 K reached 19.8 mg g{sup -1} and 5.21 mg g{sup -1}, respectively. High loading values and adsorption temperatures were beneficial to AC-Co's Hg{sup 0} removal efficiency. However, CuCoO{sub 4} and MnO{sub 2}'s AC decomposition ability had negative effect on AC-CC and AC-Mn's performance, respectively, especially at high adsorption temperatures and loading values. SO{sub 2} tests showed that AC-CC had higher anti SO{sub 2}-poisoning ability than AC-Co and AC-Mn.
-
Determination of stable shapes of a thin liquid metal layer using a boundary integral method
Energy Technology Data Exchange (ETDEWEB)
Hinaje, M [Groupe de Recherche en Electrotechnique et Electronique de Nancy, 2 avenue de la Foret de Haye, 54516 Vandoeuvre-les-Nancy (France); Vinsard, G [Laboratoire d' Energetique et de Mecanique Theorique et Appliquee, 2 avenue de la Foret de Haye, 54516 Vandoeuvre-les-Nancy (France); Dufour, S [Groupe de Recherche en Electrotechnique et Electronique de Nancy, 2 avenue de la Foret de Haye, 54516 Vandoeuvre-les-Nancy (France)
2006-03-21
This paper deals with a thin liquid metal layer submitted to an ac magnetic field. Experimentally, we have noticed that even if the system (inductor+liquid metal) is axisymmetric, when an ac magnetic field is applied the symmetry is broken. The observed deformations of the liquid metal are in three dimensions. Therefore, our aim is to investigate this deformation using a numerical method as boundary element method in three dimensions.
-
Determination of stable shapes of a thin liquid metal layer using a boundary integral method
International Nuclear Information System (INIS)
Hinaje, M; Vinsard, G; Dufour, S
2006-01-01
This paper deals with a thin liquid metal layer submitted to an ac magnetic field. Experimentally, we have noticed that even if the system (inductor+liquid metal) is axisymmetric, when an ac magnetic field is applied the symmetry is broken. The observed deformations of the liquid metal are in three dimensions. Therefore, our aim is to investigate this deformation using a numerical method as boundary element method in three dimensions
-
ACS Photometric Zero Point Verification
Science.gov (United States)
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
-
Enclosed outdoor photobioreactors: light regime, photosynthetic efficiency, scale-up, and future prospects
NARCIS (Netherlands)
Janssen, M.G.J.; Tramper, J.; Mur, L.R.; Wijffels, R.H.
2003-01-01
Enclosed outdoor photobioreactors need to be developed and designed for large-scale production of phototrophic microorganisms. Both light regime and photosynthetic efficiency were analyzed in characteristic examples of state-of-the-art pilot-scale photobioreactors. In this study it is shown that
-
Influence of topography on tide propagation and amplification in semi-enclosed basins
NARCIS (Netherlands)
Roos, Pieter C.; Schuttelaars, Henk M.
2011-01-01
An idealized model for tide propagation and amplification in semi-enclosed rectangular basins is presented, accounting for depth differences by a combination of longitudinal and lateral topographic steps. The basin geometry is formed by several adjacent compartments of identical width, each having
-
Influence of topography on tide propagation and amplification in semi-enclosed basins
NARCIS (Netherlands)
Roos, P.C.; Schuttelaars, H.M.
2010-01-01
An idealized model for tide propagation and amplification in semi-enclosed rectangular basins is presented, accounting for depth differences by a combination of longitudinal and lateral topographic steps. The basin geometry is formed by several adjacent compartments of identical width, each having
-
Physicochemical characteristics and sorption capacities of heavy metal ions of activated carbons derived by activation with different alkyl phosphate triesters
Science.gov (United States)
Wang, Jing; Liu, Hai; Yang, Shaokun; Zhang, Jian; Zhang, Chenglu; Wu, Haiming
2014-10-01
Five alkyl phosphate triesters (APTEs), including trimethyl phosphate (TMP), triethyl phosphate (TEP), triisopropyl phosphate (TPP), tributyl phosphate (TBP) and trioctyl phosphate (TOP), were used as activating agents for preparing activated carbons (AC-APTEs) with high surface acidity and metal ion sorption capacity. N2 adsorption/desorption isotherms, surface morphologies, elemental compositions, results of Boehm's titration and sorption capacities of heavy metal ions of the carbons were investigated. AC-APTEs contained much more acidic groups and exhibited much less surface area (phosphoric acid activation. For the AC-APTEs, AC-TOP had the highest surface area (488 m2/g), AC-TMP showed the highest yield (41.1%), and AC-TBP possessed the highest acidic groups (2.695 mmol/g), oxygen content (47.0%) and metal ion sorption capacities (40.1 mg/g for Ni(II) and 53.5 mg/g for Cd(II)). For the carbons, AC-APTEs showed much larger Ni(II) and Cd(II) sorption capacities than AC-PPA, except AC-TPP. The differences of the carbons in the physicochemical and sorption properties suggested surface chemistry of the carbons was the main factor influencing their sorption capacities whereas the pore structure played a secondary role.
-
Two-dimensional modelling of internal arc effects in an enclosed MV cell provided with a protection porous filter
International Nuclear Information System (INIS)
Rochette, D; Clain, S; Andre, P; Bussiere, W; Gentils, F
2007-01-01
Medium voltage (MV) cells have to respect standards (for example IEC ones (IEC TC 17C 2003 IEC 62271-200 High Voltage Switchgear and Controlgear-Part 200 1st edn)) that define security levels against internal arc faults such as an accidental electrical arc occurring in the apparatus. New protection filters based on porous materials are developed to provide better energy absorption properties and a higher protection level for people. To study the filter behaviour during a major electrical accident, a two-dimensional model is proposed. The main point is the use of a dedicated numerical scheme for a non-conservative hyperbolic problem. We present a numerical simulation of the process during the first 0.2 s when the safety valve bursts and we compare the numerical results with tests carried out in a high power test laboratory on real electrical apparatus
-
Two-dimensional modelling of internal arc effects in an enclosed MV cell provided with a protection porous filter
Science.gov (United States)
Rochette, D.; Clain, S.; André, P.; Bussière, W.; Gentils, F.
2007-05-01
Medium voltage (MV) cells have to respect standards (for example IEC ones (IEC TC 17C 2003 IEC 62271-200 High Voltage Switchgear and Controlgear—Part 200 1st edn)) that define security levels against internal arc faults such as an accidental electrical arc occurring in the apparatus. New protection filters based on porous materials are developed to provide better energy absorption properties and a higher protection level for people. To study the filter behaviour during a major electrical accident, a two-dimensional model is proposed. The main point is the use of a dedicated numerical scheme for a non-conservative hyperbolic problem. We present a numerical simulation of the process during the first 0.2 s when the safety valve bursts and we compare the numerical results with tests carried out in a high power test laboratory on real electrical apparatus.
-
Two-dimensional modelling of internal arc effects in an enclosed MV cell provided with a protection porous filter
Energy Technology Data Exchange (ETDEWEB)
Rochette, D [Laboratoire Arc Electrique et Plasmas Thermiques, CNRS UMR 6069, Universite Blaise Pascal, IUT de Montlucon, Avenue Aristide Briand, BP 2235, 03101 Montlucon Cedex (France); Clain, S [Laboratoire de Mathematiques pour l' Industrie et la Physique, CNRS UMR 5640, Universite Paul Sabatier Toulouse 3, 118 route de Narbonne, 31062 Toulouse Cedex 4 (France); Andre, P [Laboratoire Arc Electrique et Plasmas Thermiques, CNRS UMR 6069, Universite Blaise Pascal, IUT de Montlucon, Avenue Aristide Briand, BP 2235, 03101 Montlucon Cedex (France); Bussiere, W [Laboratoire Arc Electrique et Plasmas Thermiques, CNRS UMR 6069, Universite Blaise Pascal, IUT de Montlucon, Avenue Aristide Briand, BP 2235, 03101 Montlucon Cedex (France); Gentils, F [Schneider Electric-Science and Technology Division-Research Center A2, 38050 Grenoble Cedex 9 (France)
2007-05-21
Medium voltage (MV) cells have to respect standards (for example IEC ones (IEC TC 17C 2003 IEC 62271-200 High Voltage Switchgear and Controlgear-Part 200 1st edn)) that define security levels against internal arc faults such as an accidental electrical arc occurring in the apparatus. New protection filters based on porous materials are developed to provide better energy absorption properties and a higher protection level for people. To study the filter behaviour during a major electrical accident, a two-dimensional model is proposed. The main point is the use of a dedicated numerical scheme for a non-conservative hyperbolic problem. We present a numerical simulation of the process during the first 0.2 s when the safety valve bursts and we compare the numerical results with tests carried out in a high power test laboratory on real electrical apparatus.
-
AC characterization of bulk organic solar cell in the dark and under illumination
International Nuclear Information System (INIS)
Váry, Michal; Perný, Milan; Šály, Vladimír; Packa, Juraj
2014-01-01
Highlights: • A study of organic bulk photovoltaic (PV) solar cell. • Current–voltage characteristics in the dark and under illumination. • AC measurements, both under illumination and in the dark conditions. • Equivalent AC circuit. • Effective lifetime assigned with electron–hole recombination and diffusion time of the electron was estimated. - Abstract: Impedance spectroscopy has been used widely to evaluate the transport processes in photovoltaic, mainly based on inorganic semiconductors, structures – solar cells. The aim of this research was to characterize improved organic bulk photovoltaic (PV) solar cells exploiting this method. Progress in technology of investigated organic solar cell involves the use of an active layer based on low band gap type of polymer. The organic PV cell with front transparent electrode and rear metal electrode and active layer produced by Konarka Technologies was analyzed by electrical DC and AC measurements. Current–voltage (I–V) characteristics in the dark and under illumination were measured and basic PV parameters were calculated. AC measurements, both under illumination and in the dark conditions, were processed in order to identify electronic behavior using equivalent AC circuit which was suggested by fitting of measured impedance data. Circuit with the best correlation to measured data is analyzed in details. Voltage and frequency dependences of fitted equivalent circuit components and calculated parameters are explained and presented in the paper
-
Estimation of the loss of Offsite power frequency for the probabilistic safety assessment of the Juragua NPP
International Nuclear Information System (INIS)
Vilaragut Llanes, J.J.; Valhuerdi Debesa, C.
1996-01-01
The loss offsite power is defined as the interruption of the preferred power supply to the essential and non essential switchgear buses necessitating or resulting in the use of emergency AC power supply. Because many safety system required for reactor core decay heat removal and containment heat removal depend on AC power, a loss of offsite power, if emergency power supply (diesel generators) fails, could be severe accidents The purpose of this work was to determine, for the Probabilistic Safety Assessment of the Juragua NPP, the causes, frequency and duration relationships of the loss of offsite power. A description is presented of the different factor that determine the occurrence of this event and the characteristics for the Juragua NPP
-
FLUIDIC AC AMPLIFIERS.
Science.gov (United States)
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
-
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
Science.gov (United States)
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
-
Single channel double-duct liquid metal electrical generator using a magnetohydrodynamic device
Science.gov (United States)
Haaland, Carsten M.; Deeds, W. Edward
1999-01-01
A single channel double-duct liquid metal electrical generator using a magnetohydrodynamic (MHD) device. The single channel device provides useful output AC electric energy. The generator includes a two-cylinder linear-piston engine which drives liquid metal in a single channel looped around one side of the MHD device to form a double-duct contra-flowing liquid metal MHD generator. A flow conduit network and drive mechanism are provided for moving liquid metal with an oscillating flow through a static magnetic field to produce useful AC electric energy at practical voltages and currents. Variable stroke is obtained by controlling the quantity of liquid metal in the channel. High efficiency is obtained over a wide range of frequency and power output.
-
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
-
Experimental investigations of overvoltages in 6kV station service cable networks of thermal power plants
Energy Technology Data Exchange (ETDEWEB)
Vukelja, P.I.; Naumov, R.M.; Drobnjak, G.V.; Mrvic, J.D. [Nikola Tesla Inst., Belgrade (Yugoslavia)
1996-12-31
The paper presents the results of experimental investigations of overvoltages on 6kV isolated neutral station service cable networks of thermal power plants. The overvoltages were recorded with capacitive voltage measurement systems made at the Nikola Tesla Institute. Wideband capacitive voltage measurement systems recorded a flat response from below power frequencies to 10MHz. Investigations of overvoltages were performed for appearance and interruption of metal earth faults, intermittent earth faults, switching operation of HV motors switchgear, switching operation of transformers switchgear, and transfer of the network supply from one transformer to another. On the basis of these investigations, certain measures are proposed for limiting overvoltages and for the reliability of station service of thermal power plants.
-
Development of a hardware-based AC microgrid for AC stability assessment
Science.gov (United States)
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
-
Application of RADTRAN to estimation of doses to persons in enclosed spaces
International Nuclear Information System (INIS)
Neuhauser, K.S.
1992-01-01
The RADTRAN computer code for transportation risk analysis can be used to estimate doses to persons in enclosed volumes. This application was developed in response to a need to examine consequences of a hypothetical container leak during accident-free transportation by cargo air. The original problem addressed tritium containers, but the method can be applied to any gaseous or suspended particulate material potentially released in an airplane or other enclosed area (e.g., warehouse) under accident-free conditions. Such leakage can occur during shipment of any radioactive gas or material with a gaseous phase. Atmospheric dispersion is normally modeled in RADTRAN as a series of downwind isopleths each of which is assigned a dilution factor (also known as time-integrated concentration or X/Q value). These values are located in look-up tables in RADTRAN and are normally taken from externally performed Gaussian dispersion calculations. The dilution factors are used to estimate inhalation dose to persons in the specified downwind areas
-
An 'artificial mussel' for monitoring heavy metals in marine environments
International Nuclear Information System (INIS)
Wu, Rudolf S.S.; Lau, T.C.; Fung, Wendy K.M.; Ko, P.H.; Leung, Kenneth M.Y.
2007-01-01
A new chemical sampling device, artificial mussel (AM), has been developed for monitoring metals in marine environments. This device consists of a polymer ligand suspended in artificial seawater within a Perspex tubing, and enclosed with semi-permeable gel at both ends. Laboratory and field experiments were carried out to examine the uptake of five metals (Cd, Cr, Cu, Pb and Zn) by the AM. Uptake of metals by AM was proportional to the exposure metal concentrations, and the AM was able to accumulate the ASV labile fractions of metals. Uptake and release of the metals of AM are similar to those of the mussel Perna viridis, but less affected by salinity and temperature. Field studies demonstrated that the AM can not only provide a time-integrated estimate of metals concentrations, but also allows comparisons of metal levels in different environments and geographical areas beyond the natural distribution limits of biomonitors. - A new monitoring device to provide a time-integrated estimate for monitoring metals in marine environments
-
Activation volume and interaction of metal particulate media
Energy Technology Data Exchange (ETDEWEB)
Tetsukawa, Hiroki [Sony Corporation, 6-7-35 Kitashinagawa, Shinagawa-ku, Tokyo 141-0001 (Japan)]. E-mail: tetsukaw@arc.sony.co.jp; Kondo, Hirofumi [Sony Corporation, 6-7-35 Kitashinagawa, Shinagawa-ku, Tokyo 141-0001 (Japan)
2005-09-15
We have investigated the activation volume (V{sub ac}) and magnetostatic interaction of metal particulate (MP) media. The activation volume of MP media decreases with the decrease of physical volume (V{sub phy}) of metal particles. The activation volume and the ratio of V{sub phy}/V{sub ac} of advanced metal particles are 6x10{sup -24}m{sup 3} and 1.5, respectively. It can be predicted that the physical volume of metal particle is about 3x10{sup -24}m{sup 3} when the physical volume is equal to the activation volume. This value is agreement with the practical lower limit of physical volume of metal particle predicted by Sharrock. The negative interaction (demagnetization effect) in MP media decreases with low saturation magnetization of the metal particles, a thin magnetic layer, a high orientation of MP media, and a low packing fraction of metal particles in the MP media. The activation volume of the MP media decreased as the negative interactions decreased. In advanced MP media with low M{sub r}.t (M{sub r}=remanent magnetization and t=thickness), the influence of interaction on the activation volume is reduced.
-
Activation volume and interaction of metal particulate media
International Nuclear Information System (INIS)
Tetsukawa, Hiroki; Kondo, Hirofumi
2005-01-01
We have investigated the activation volume (V ac ) and magnetostatic interaction of metal particulate (MP) media. The activation volume of MP media decreases with the decrease of physical volume (V phy ) of metal particles. The activation volume and the ratio of V phy /V ac of advanced metal particles are 6x10 -24 m 3 and 1.5, respectively. It can be predicted that the physical volume of metal particle is about 3x10 -24 m 3 when the physical volume is equal to the activation volume. This value is agreement with the practical lower limit of physical volume of metal particle predicted by Sharrock. The negative interaction (demagnetization effect) in MP media decreases with low saturation magnetization of the metal particles, a thin magnetic layer, a high orientation of MP media, and a low packing fraction of metal particles in the MP media. The activation volume of the MP media decreased as the negative interactions decreased. In advanced MP media with low M r .t (M r =remanent magnetization and t=thickness), the influence of interaction on the activation volume is reduced
-
Numerical analysis of AC tungsten inert gas welding of aluminum plate in consideration of oxide layer cleaning
Energy Technology Data Exchange (ETDEWEB)
Tashiro, Shinichi, E-mail: tashiro@jwri.osaka-u.ac.jp; Miyata, Minoru; Tanaka, Manabu
2011-08-01
A unified numerical simulation model of AC TIG welding of the aluminum plate considering energy balance among the electrode, the arc and the base metal and employing an analytical model for calculating cleaning rate of the oxide layer has been developed for investigating heat transport properties and weld pool formation process in AC TIG welding of aluminum plate. As a result of this simulation, it was shown that although the heat flux from the arc onto the base metal increases in EN (Electrode Negative) phase due to the electron condensation, that in EP (Electrode Positive) phase conversely decreases because mainly of cooling caused by the electron emission. Furthermore, the validity of the simulation model was confirmed by comparing to experimental results such as the arc voltage, the area of cleaning zone and the shape of weld pool.
-
Small drains, big problems: the impact of dry weather runoff on shoreline water quality at enclosed beaches.
Science.gov (United States)
Rippy, Megan A; Stein, Robert; Sanders, Brett F; Davis, Kristen; McLaughlin, Karen; Skinner, John F; Kappeler, John; Grant, Stanley B
2014-12-16
Enclosed beaches along urban coastlines are frequent hot spots of fecal indicator bacteria (FIB) pollution. In this paper we present field measurements and modeling studies aimed at evaluating the impact of small storm drains on FIB pollution at enclosed beaches in Newport Bay, the second largest tidal embayment in Southern California. Our results suggest that small drains have a disproportionate impact on enclosed beach water quality for five reasons: (1) dry weather surface flows (primarily from overirrigation of lawns and ornamental plants) harbor FIB at concentrations exceeding recreational water quality criteria; (2) small drains can trap dry weather runoff during high tide, and then release it in a bolus during the falling tide when drainpipe outlets are exposed; (3) nearshore turbulence is low (turbulent diffusivities approximately 10(-3) m(2) s(-1)), limiting dilution of FIB and other runoff-associated pollutants once they enter the bay; (4) once in the bay, runoff can form buoyant plumes that further limit vertical mixing and dilution; and (5) local winds can force buoyant runoff plumes back against the shoreline, where water depth is minimal and human contact likely. Outdoor water conservation and urban retrofits that minimize the volume of dry and wet weather runoff entering the local storm drain system may be the best option for improving beach water quality in Newport Bay and other urban-impacted enclosed beaches.
-
Acoustic firearm discharge detection and classification in an enclosed environment
Energy Technology Data Exchange (ETDEWEB)
Luzi, Lorenzo; Gonzalez, Eric; Bruillard, Paul; Prowant, Matthew; Skorpik, James; Hughes, Michael; Child, Scott; Kist, Duane; McCarthy, John E.
2016-05-01
Two different signal processing algorithms are described for detection and classification of acoustic signals generated by firearm discharges in small enclosed spaces. The first is based on the logarithm of the signal energy. The second is a joint entropy. The current study indicates that a system using both signal energy and joint entropy would be able to both detect weapon discharges and classify weapon type, in small spaces, with high statistical certainty.
-
Utilities respond to nuclear station blackout rule
International Nuclear Information System (INIS)
Rubin, A.M.; Beasley, B.; Tenera, L.P.
1990-01-01
The authors discuss how nuclear plants in the United States have taken actions to respond to the NRC Station Blackout Rule, 10CFR50.63. The rule requires that each light water cooled nuclear power plant licensed to operate must be able to withstand for a specified duration and recover from a station blackout. Station blackout is defined as the complete loss of a-c power to the essential and non-essential switch-gear buses in a nuclear power plant. A station blackout results from the loss of all off-site power as well as the on-site emergency a-c power system. There are two basic approaches to meeting the station blackout rule. One is to cope with a station blackout independent of a-c power. Coping, as it is called, means the ability of a plant to achieve and maintain a safe shutdown condition. The second approach is to provide an alternate a-c power source (AAC)
-
The influences of microwave irradiation and polyol precursor pH on Cu/AC catalyst and its CO oxidation performance
Science.gov (United States)
Chuang, Kui-Hao; Shih, Kaimin; Wey, Ming-Yen
2012-10-01
This study evaluated the effects of microwave irradiation parameters and the pH of the polyol precursor on the morphological features and catalytic performances of Cu/activated carbon (AC) catalysts. Experimental results of carbon monoxide (CO) oxidation indicated that the highest catalytic activity is achieved when the Cu/AC catalyst is prepared with microwave irradiation at 700 W for 60 s. Scanning electron microscopy revealed the presence of beneficial small copper aciculae on the Cu/AC catalyst under such a microwave irradiation scheme. Further investigation of operational parameters found that the performance of Cu/AC catalysts is enhanced by adopting a pH = 12 polyol precursor solution. With the observation that small cube copper ( 16 nm) aggregates form when a pH = 12 polyol precursor solution is used, this study also demonstrated the importance of controlling the morphology of metal nanoparticles on Cu/AC catalysts when using the microwave-assisted polyol method.
-
The influences of microwave irradiation and polyol precursor pH on Cu/AC catalyst and its CO oxidation performance
International Nuclear Information System (INIS)
Chuang, Kui-Hao; Shih, Kaimin; Wey, Ming-Yen
2012-01-01
This study evaluated the effects of microwave irradiation parameters and the pH of the polyol precursor on the morphological features and catalytic performances of Cu/activated carbon (AC) catalysts. Experimental results of carbon monoxide (CO) oxidation indicated that the highest catalytic activity is achieved when the Cu/AC catalyst is prepared with microwave irradiation at 700 W for 60 s. Scanning electron microscopy revealed the presence of beneficial small copper aciculae on the Cu/AC catalyst under such a microwave irradiation scheme. Further investigation of operational parameters found that the performance of Cu/AC catalysts is enhanced by adopting a pH = 12 polyol precursor solution. With the observation that small cube copper (∼16 nm) aggregates form when a pH = 12 polyol precursor solution is used, this study also demonstrated the importance of controlling the morphology of metal nanoparticles on Cu/AC catalysts when using the microwave-assisted polyol method.
-
Temperature dependence of ac response in diluted half-metallic CrO{sub 2} powder compact
Energy Technology Data Exchange (ETDEWEB)
Chen Yajie; Zhang Xiaoyu; Cai Tianyi; Li Zhenya
2004-10-06
We present a study on temperature dependence of impedance spectra of the cold-pressed chromium dioxide (CrO{sub 2})-titanic dioxide (TiO{sub 2}) composite over the temperature range of 77-300 K, and over the frequency range of 40 Hz-500 kHz. The microstructure of the sample is analyzed using transmission electron microscopy (TEM), SEM and X-ray diffraction (XRD). The impedance spectra exhibit a strong dependence upon temperature. By evaluating the ac electricity behavior of the composite, we find the experimental data are successfully described by a power-law behavior {sigma}{sub ac}=A(T){omega}{sup s}, in which the frequency exponent s shows slightly greater than a universal value (0{<=}s{<=}1), and rises approximately linearly with temperature over a broad range of low temperature.
-
Effective Peroxidase-Like Activity of Co-Aminoclay [CoAC] and Its Application for Glucose Detection
Directory of Open Access Journals (Sweden)
Han Pill Song
2018-02-01
Full Text Available In this study, we describe a novel peroxidase-like activity of Co-aminoclay [CoAC] present at pH ~5.0 and its application to fluorescent biosensor for the determination of H2O2 and glucose. It is synthesized with aminoclays (ACs entrapping cationic metals such as Fe, Cu, Al, Co., Ce, Ni, Mn, and Zn to find enzyme mimicking ACs by sol–gel ambient conditions. Through the screening of catalytic activities by the typical colorimetric reaction employing 2,2′-azino-bis(3-ethylbenzo-thiazoline-6-sulfonic aciddiammonium salt (ABTS as a substrate with or without H2O2, Fe, Cu, and CoACs are found to exhibit peroxidase-like activity, as well as oxidase-like activity was observed from Ce and MnACs. Among them, CoAC shows exceptionally high peroxidase-like activity, presumably due to its ability to induce electron transfer between substrates and H2O2. CoAC is then used to catalyze the oxidation of Amplex® UltraRed (AUR into a fluorescent end product, which enables a sensitive fluorescent detection of H2O2. Moreover, a highly sensitive and selective glucose biosensing strategy is developed, based on enzyme cascade reaction between glucose oxidase (GOx and CoAC. Using this strategy, a highly linear fluorescence enhancement is verified when the concentration of glucose is increased in a wide range from 10 μM to 1 mM with a lower detection limit of 5 μM. The practical diagnostic capability of the assay system is also verified by its use to detect glucose in human blood serum. Based on these results, it is anticipated that CoAC can serve as potent peroxidase mimetics for the detection of clinically important target molecules.
-
Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.
Science.gov (United States)
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
-
Effects of Environmental Factors and Metallic Electrodes on AC Electrical Conduction Through DNA Molecule.
Science.gov (United States)
Abdalla, S; Obaid, A; Al-Marzouki, F M
2017-12-01
Deoxyribonucleic acid (DNA) is one of the best candidate materials for various device applications such as in electrodes for rechargeable batteries, biosensors, molecular electronics, medical- and biomedical-applications etc. Hence, it is worthwhile to examine the mechanism of charge transport in the DNA molecule, however, still a question without a clear answer is DNA a molecular conducting material (wire), semiconductor, or insulator? The answer, after the published data, is still ambiguous without any confirmed and clear scientific answer. DNA is found to be always surrounded with different electric charges, ions, and dipoles. These surrounding charges and electric barrier(s) due to metallic electrodes (as environmental factors (EFs)) play a substantial role when measuring the electrical conductivity through λ-double helix (DNA) molecule suspended between metallic electrodes. We found that strong frequency dependence of AC-complex conductivity comes from the electrical conduction of EFs. This leads to superimposing serious incorrect experimental data to measured ones. At 1 MHz, we carried out a first control experiment on electrical conductivity with and without the presence of DNA molecule. If there are possible electrical conduction due to stray ions and contribution of substrate, we will detected them. This control experiment revealed that there is an important role played by the environmental-charges around DNA molecule and any experiment should consider this role. We have succeeded to measure both electrical conductivity due to EFs (σ ENV ) and electrical conductivity due to DNA molecule (σ DNA ) independently by carrying the measurements at different DNA-lengths and subtracting the data. We carried out measurements as a function of frequency (f) and temperature (T) in the ranges 0.1 Hz molecule from all EFs effects that surround the molecule, but also to present accurate values of σ DNA and the dielectric constant of the molecule ε' DNA as a
-
Numerical Simulation of Stationary AC Tungsten Inert Gas Welding of Aluminum Plate in Consideration of Oxide Layer Cleaning
Science.gov (United States)
Tashiro, Shinichi; Tanaka, Manabu
An unified numerical simulation model of AC TIG welding of the aluminum plate considering energy balance among the electrode, the arc and the base metal and employing an analytical model for calculating cleaning rate of the oxide layer has been developed for investigating heat transport properties and weld pool formation process in AC TIG welding of aluminum plate. As a result of this simulation, it was shown that although the heat flux from the arc onto the base metal increases in EN (Electrode Negative) phase due to the electron condensation, that in EP (Electrode Positive) phase conversely decreases because mainly of cooling caused by the electron emission. Furthermore, the validity of the simulation model was confirmed by comparing to experimental results such as the arc voltage, the area of cleaning zone and the shape of weld pool.
-
Arc-textured metal surfaces for high thermal emittance space radiators
International Nuclear Information System (INIS)
Banks, B.A.; Rutledge, S.K.; Mirtich, M.J.; Behrend, T.; Hotes, D.; Kussmaul, M.; Barry, J.; Stidham, C.; Stueber, T.; DiFilippo, F.
1994-01-01
Carbon arc electrical discharges struck across the surfaces of metals such as Nb-1% Zr, alter the morphology to produce a high thermal emittance surface. Metal from the surface and carbon from the arc electrode vaporize during arcing, and then condense on the metal surface to produce a microscopically rough surface having a high thermal emittance. Quantitative spectral reflectance measurements from 0.33 to 15 μm were made on metal surfaces which were carbon arc treated in an inert gas environment. The resulting spectral reflectance data were then used to calculate thermal emittance as a function of temperature for various methods of arc treatment. The results of arc treatment on various metals are presented for both ac and dc arcs. Surface characterization data, including thermal emittance as a function of temperature, scanning electron microscopy, and atomic oxygen durability, are also presented. Ac arc texturing was found to increase the thermal emittance at 800 K from 0.05. to 0.70
-
Application of RADTRAN to estimation of doses to persons in enclosed spaces
International Nuclear Information System (INIS)
Neuhauser, K.S.
1993-01-01
The RADTRAN computer code for transportation risk analysis (Neuhauser and Kanipe, 1992) can be used to estimate doses to persons in enclosed volumes. This application was developed in response to a need to examine consequences of a hypothetical container leak during accident-free transportation by cargo air. The original problem addressed tritium containers, but the method can be applied to any gaseous or suspended particulate material potentially released in an airplane or other enclosed area (e.g., warehouse ) under accident-free conditions. Such leakage can occur during shipment of any radioactive gas or material with a gaseous phase. Atmospheric dispersion is normally modeled in RADTRAN as a series of downwind isopleths each of which is assigned a dilution factor (also known as time-integrated concentration or X/Q value). These values are located in look-up tables in RADTRAN and are normally taken from externally performed Gaussian dispersion calculations. The dilution factors are used to estimate inhalation dose to persons in the specified downwind areas. (J.P.N.)
-
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
-
Treatment of fully enclosed FSI using artificial compressibility
CSIR Research Space (South Africa)
Bogaers, Alfred EJ
2013-07-01
Full Text Available artificial compressibility (AC), whereby the fluid equations are modified to allow for compressibility which internally incorporates an approximation of the system volume change as a function of pressure....
-
Calculation of AC losses in large HTS stacks and coils
DEFF Research Database (Denmark)
Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad
2012-01-01
In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting...... allowing for overcritical current densities to be considered. The method presented here allowed for a computational speedup factor of up to 2 orders of magnitude when compared to full 2-D simulations taking into account the actual structure of the stacks without compromising accuracy....
-
The AC photovoltaic module is here!
Science.gov (United States)
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
-
THE ACS FORNAX CLUSTER SURVEY. X. COLOR GRADIENTS OF GLOBULAR CLUSTER SYSTEMS IN EARLY-TYPE GALAXIES
International Nuclear Information System (INIS)
Liu Chengze; Peng, Eric W.; Jordan, Andres; Ferrarese, Laura; Blakeslee, John P.; Cote, Patrick; Mei, Simona
2011-01-01
We use the largest homogeneous sample of globular clusters (GCs), drawn from the ACS Virgo Cluster Survey (ACSVCS) and ACS Fornax Cluster Survey (ACSFCS), to investigate the color gradients of GC systems in 76 early-type galaxies. We find that most GC systems possess an obvious negative gradient in (g-z) color with radius (bluer outward), which is consistent with previous work. For GC systems displaying color bimodality, both metal-rich and metal-poor GC subpopulations present shallower but significant color gradients on average, and the mean color gradients of these two subpopulations are of roughly equal strength. The field of view of ACS mainly restricts us to measuring the inner gradients of the studied GC systems. These gradients, however, can introduce an aperture bias when measuring the mean colors of GC subpopulations from relatively narrow central pointings. Inferred corrections to previous work imply a reduced significance for the relation between the mean color of metal-poor GCs and their host galaxy luminosity. The GC color gradients also show a dependence with host galaxy mass where the gradients are weakest at the ends of the mass spectrum-in massive galaxies and dwarf galaxies-and strongest in galaxies of intermediate mass, around a stellar mass of M * ∼10 10 M sun . We also measure color gradients for field stars in the host galaxies. We find that GC color gradients are systematically steeper than field star color gradients, but the shape of the gradient-mass relation is the same for both. If gradients are caused by rapid dissipational collapse and weakened by merging, these color gradients support a picture where the inner GC systems of most intermediate-mass and massive galaxies formed early and rapidly with the most massive galaxies having experienced greater merging. The lack of strong gradients in the GC systems of dwarfs, which probably have not experienced many recent major mergers, suggests that low-mass halos were inefficient at retaining
-
Levitação acústica
OpenAIRE
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
-
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
-
Introduction to AC machine design
CERN Document Server
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
-
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
-
AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
-
High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte
Science.gov (United States)
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
-
AcEST: DK954361 [AcEST
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
-
21 CFR 886.4440 - AC-powered magnet.
Science.gov (United States)
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
-
New Developments in the Field of Materials for Electric Power Engineering. Paper presented at the ETG Conference (Energy Technology Society) 1981
Energy Technology Data Exchange (ETDEWEB)
1981-01-01
The Conference Proceedings comprise 21 papers divided into 4 theme groups: insulating materials and insulating systems; structural materials; magnetic materials; conductor and contact materials. Individual papers deal with: the search for a new insulating system for transformers; insulating oils and liquids; an insulating system for electric machines of high heat resistance: progress in insulation of exciter winding in hydroelectic generators and other large synchronous machines; insulating systems for extreme envronmental conditions; behavior of silicon elastomer, organic, and polyethylene insulating materials; development of new magnetic materials, in particular: metallic glasses; amorphous magnetic materials; pressed iron powder parts; modern permanent magnetic materials; development of new contact materials for power switchgear; alternative switchgear technologies; a new cryogenic conductor structured element based on V/sub 2/O/sub 3/ ceramic; choice of material for fuses.
-
Size-dependent electronic properties of metal nanostructures
Indian Academy of Sciences (India)
First page Back Continue Last page Overview Graphics. Size-dependent electronic properties of metal nanostructures. G.U. Kulkarni. Chemistry and Physics of Materials Unit. Jawaharlal Nehru Centre for Advanced Scientific Research. Bangalore, India. kulkarni@jncasr.ac.in.
-
A Liquid Metal Flume for Free Surface Magnetohydrodynamic Experiments
International Nuclear Information System (INIS)
Nornberg, M.D.; Ji, H.; Peterson, J.L.; Rhoads, J.R.
2008-01-01
We present an experiment designed to study magnetohydrodynamic effects in free-surface channel flow. The wide aspect ratio channel (the width to height ratio is about 15) is completely enclosed in an inert atmosphere to prevent oxidization of the liquid metal. A custom-designed pump reduces entrainment of oxygen, which was found to be a problem with standard centrifugal and gear pumps. Laser Doppler Velocimetry experiments characterize velocity profiles of the flow. Various flow constraints mitigate secondary circulation and end effects on the flow. Measurements of the wave propagation characteristics in the liquid metal demonstrate the surfactant effect of surface oxides and the damping of fluctuations by a cross-channel magnetic field
-
THE ACS SURVEY OF GALACTIC GLOBULAR CLUSTERS. IX. HORIZONTAL BRANCH MORPHOLOGY AND THE SECOND PARAMETER PHENOMENON
International Nuclear Information System (INIS)
Dotter, Aaron; Sarajedini, Ata; Anderson, Jay; Bedin, Luigi R.; Paust, Nathaniel; Reid, I. Neill; Aparicio, Antonio; MarIn-Franch, A.; Rosenberg, Alfred; Chaboyer, Brian; Majewski, Steven; Milone, Antonino; Piotto, Giampaolo; Siegel, Michael
2010-01-01
The horizontal branch (HB) morphology of globular clusters (GCs) is most strongly influenced by metallicity. The second parameter phenomenon, first described in the 1960s, acknowledges that metallicity alone is not enough to describe the HB morphology of all GCs. In particular, astronomers noticed that the outer Galactic halo contains GCs with redder HBs at a given metallicity than are found inside the solar circle. Thus, at least a second parameter was required to characterize HB morphology. While the term 'second parameter' has since come to be used in a broader context, its identity with respect to the original problem has not been conclusively determined. Here we analyze the median color difference between the HB and the red giant branch, hereafter denoted as Δ(V - I), measured from Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) photometry of 60 GCs within ∼20 kpc of the Galactic center. Analysis of this homogeneous data set reveals that, after the influence of metallicity has been removed from the data, the correlation between Δ(V - I) and age is stronger than that of any other parameter considered. Expanding the sample to include HST ACS and Wide Field Planetary Camera 2 photometry of the six most distant Galactic GCs lends additional support to the correlation between Δ(V - I) and age. This result is robust with respect to the adopted metallicity scale and the method of age determination, but must bear the caveat that high-quality, detailed abundance information is not available for a significant fraction of the sample. Furthermore, when a subset of GCs with similar metallicities and ages is considered, a correlation between Δ(V - I) and central luminosity density is exposed. With respect to the existence of GCs with anomalously red HBs at a given metallicity, we conclude that age is the second parameter and central density is most likely the third. Important problems related to HB morphology in GCs, notably multi-modal distributions
-
Electrical conductivity of activated carbon-metal oxide nanocomposites under compression: a comparison study.
Science.gov (United States)
Barroso-Bogeat, A; Alexandre-Franco, M; Fernández-González, C; Macías-García, A; Gómez-Serrano, V
2014-12-07
From a granular commercial activated carbon (AC) and six metal oxide (Al2O3, Fe2O3, SnO2, TiO2, WO3 and ZnO) precursors, two series of AC-metal oxide nanocomposites were prepared by wet impregnation, oven-drying at 120 °C, and subsequent heat treatment at 200 or 850 °C in an inert atmosphere. Here, the electrical conductivity of the resulting products was studied under moderate compression. The influence of the applied pressure, sample volume, mechanical work, and density of the hybrid materials was thoroughly investigated. The DC electrical conductivity of the compressed samples was measured at room temperature by the four-probe method. Compaction assays suggest that the mechanical properties of the nanocomposites are largely determined by the carbon matrix. Both the decrease in volume and the increase in density were relatively small and only significant at pressures lower than 100 kPa for AC and most nanocomposites. In contrast, the bulk electrical conductivity of the hybrid materials was strongly influenced by the intrinsic conductivity, mean crystallite size, content and chemical nature of the supported phases, which ultimately depend on the metal oxide precursor and heat treatment temperature. The supported nanoparticles may be considered to act as electrical switches either hindering or favouring the effective electron transport between the AC cores of neighbouring composite particles in contact under compression. Conductivity values as a rule were lower for the nanocomposites than for the raw AC, all of them falling in the range of semiconductor materials. With the increase in heat treatment temperature, the trend is toward the improvement of conductivity due to the increase in the crystallite size and, in some cases, to the formation of metals in the elemental state and even metal carbides. The patterns of variation of the electrical conductivity with pressure and mechanical work were slightly similar, thus suggesting the predominance of the pressure
-
ac Conductivity of mixed spinel NiAl0.7Cr0.7Fe0.6O4
Indian Academy of Sciences (India)
Abstract. ac Conductivity measurements are carried out across the metal to insulator transition in NiAl0.7Cr0.7Fe0.6O4. The low frequency data is analyzed using Summerfield scaling theory for hopping conductivity. The exponent of the scaling behavior has significantly different values in the conducting and insulating ...
-
Simultaneous distribution of AC and DC power
Science.gov (United States)
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
-
A self-contained fully-enclosed microfluidic cartridge for lab on a chip.
Science.gov (United States)
Yobas, Levent; Cheow, Lih Feng; Tang, Kum-Cheong; Yong, Shien-Eit; Ong, Eleana Kye-Zheng; Wong, Lionel; Teo, William Cheng-Yong; Ji, Hongmiao; Rafeah, Siti; Yu, Chen
2009-12-01
We describe a self-contained fully-enclosed cartridge for lab-on-a-chip applications where sample and reagents can be applied sequentially as is performed in a heterogeneous immunoassay, or nucleic acid extraction. Both the self-contained and fully-enclosed features of the cartridge are sought to ensure its safe use in the field by unskilled staff. Simplicity in cartridge design and operation is obtained via adopting a valveless concept whereby reagents are stored and used in the form of liquid plugs isolated by air spacers around a fluidic loop. Functional components integrated in the loop include a microfluidic chip specific to the target application, a novel peristaltic pump to displace the liquid plugs, and a pair of removable tubing segments where one is used to introduce biological sample and while the other is to collect eluant. The novel pump is fabricated through soft-lithography technique and works by pinching a planar channel under stainless-steel ball bearings that have been magnetically loaded. The utility of the cartridge is demonstrated for automated extraction and purification of nucleic acids (DNA) from a cell lysate on a battery-operated portable system. The cartridge shown here can be further extended to sample-in-answer-out diagnostic tests.
-
Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
-
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
-
Use of diesel engines in industrial trucks operated in enclosed spaces
Energy Technology Data Exchange (ETDEWEB)
Dietrich, W; Reibold, G
1981-01-01
Report on emission investigations on a fork-lifter equipped with a low-pollutant MWM-engine, tests were carried out in enclosed spaces. The aim was to clarify if the maximum MPC at a place of work listed in a table of waste gas components can be observed even under unfavourable operating conditions of the fork lifter. The test is described, results are analysed. It is proved that there are no health hazards for the staff even under the extreme conditions chosen for the test.
-
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Science.gov (United States)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
-
Caracterización de escorias metalúrgicas procedentes de yacimientos arqueológicos de Navarra (Siglos II a.C.- IV d.C.
Directory of Open Access Journals (Sweden)
Ros-Latienda, L.
2013-12-01
Full Text Available The Archaeology Section of the Government of Navarre put forward a proposal to undertake research in the characterization of a set of pieces from 2nd century B.C. to 4th century A.D. retrieved from excavations in different archaeological sites in this province, to obtain data related to the manufacturing process of the investigated artefacts and to compare the level of technical skills in different times and places, so as to achieve a better understanding of technological abilities and material culture. The finds discussed in this paper are of interest from an archaeometallurgical point of view, and they consist mainly of metallurgical slags, remains of manufactured pieces, and minerals residues used to obtain various metals. In addition to carrying out their chemical analyses by inductively coupled plasma (ICP, the study of six samples was performed by optical and scanning electron microscopy and energy-dispersive X-ray microanalysis (EDX which revealed the composition of large areas of the slags, and the study was finally completed by the determination of the phases present by X rays diffraction.Desde la Sección de Arqueología del Gobierno de Navarra llegó la propuesta de caracterizar una serie de piezas comprendidas entre el siglo II a.C. y el siglo IV d.C. procedentes de yacimientos arqueológicos de esta provincia con objeto de obtener datos relacionados con la tecnología que las produjo y poder comparar el grado de desarrollo técnico de diferentes épocas y lugares. Interesaba el estudio de estas piezas desde el punto de vista metalúrgico, habiendo entre ellas mayoritariamente escorias metalúrgicas, restos de piezas fabricadas y restos minerales utilizados en la obtención de diversos metales. Además de proceder a su análisis químico mediante técnica de plasma acoplado inductivamente (ICP, se estudiaron seis muestras mediante microscopía óptica, electrónica de barrido y microanálisis por energía dispersiva de rayos X (EDAX
-
AcMNPV
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
-
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
-
Instability of enclosed horizons
Science.gov (United States)
Kay, Bernard S.
2015-03-01
We point out that there are solutions to the scalar wave equation on dimensional Minkowski space with finite energy tails which, if they reflect off a uniformly accelerated mirror due to (say) Dirichlet boundary conditions on it, develop an infinite stress-energy tensor on the mirror's Rindler horizon. We also show that, in the presence of an image mirror in the opposite Rindler wedge, suitable compactly supported arbitrarily small initial data on a suitable initial surface will develop an arbitrarily large stress-energy scalar near where the two horizons cross. Also, while there is a regular Hartle-Hawking-Israel-like state for the quantum theory between these two mirrors, there are coherent states built on it for which there are similar singularities in the expectation value of the renormalized stress-energy tensor. We conjecture that in other situations with analogous enclosed horizons such as a (maximally extended) Schwarzschild black hole in equilibrium in a (stationary spherical) box or the (maximally extended) Schwarzschild-AdS spacetime, there will be similar stress-energy singularities and almost-singularities—leading to instability of the horizons when gravity is switched on and matter and gravity perturbations are allowed for. All this suggests it is incorrect to picture a black hole in equilibrium in a box or a Schwarzschild-AdS black hole as extending beyond the past and future horizons of a single Schwarzschild (/Schwarzschild-AdS) wedge. It would thus provide new evidence for 't Hooft's brick wall model while seeming to invalidate the picture in Maldacena's ` Eternal black holes in AdS'. It would thereby also support the validity of the author's matter-gravity entanglement hypothesis and of the paper ` Brick walls and AdS/CFT' by the author and Ortíz.
-
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
-
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
-
The influence of wind direction on natural ventilation: application to a large semi-enclosed stadium
NARCIS (Netherlands)
Hooff, van T.A.J.; Blocken, B.J.E.
2009-01-01
Natural ventilation is still a commonly applied way in building engineering to ensure a healthy and comfortable indoor climate. In this paper CFD simulations of the natural ventilation of a large semi-enclosed stadium in the Netherlands during the summer are described. Simulations are performed to
-
Evaluation of an enclosed ultraviolet-C radiation device for decontamination of mobile handheld devices.
Science.gov (United States)
Mathew, J Itty; Cadnum, Jennifer L; Sankar, Thriveen; Jencson, Annette L; Kundrapu, Sirisha; Donskey, Curtis J
2016-06-01
Mobile handheld devices used in health care settings may become contaminated with health care-associated pathogens. We demonstrated that an enclosed ultraviolet-C radiation device was effective in rapidly reducing methicillin-resistant Staphylococcus aureus, and with longer exposure times, Clostridium difficile spores, on glass slides and reducing contamination on in-use mobile handheld devices. Published by Elsevier Inc.
-
Metallicities of Emission-Line Galaxies from HST ACS PEARS and HST WFC3 ERS Grism Spectroscopy at 0.6 is less than z is less than 2.4
Science.gov (United States)
Xia, Lifang; Malhotra, Sangetta; Rhoads, James; Pirzkal, Nor; Straughn, Amber; Finkelstein, Steven; Cohen, Seth; Kuntschner, Harald; Walsh, Jeremy; Windhorst, Rogier A.; 
2012-01-01
Galaxies selected on the basis of their emission line strength. show low metallicities, regardless of their redshifts. We conclude this from a sample of faint galaxies at redshifts between 0.6 optiCa.i with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST) and in the near-infrared using Wide-Field Camera 3 (WFC3). Using a sample of 11 emission line galaxies (ELGs) at 0.6 < z < 2.4 with luminosities of -22 approx < MB approx -19 which have [OII], H-Beta, and [OIII] line flux measurements from the combination of two grism spectral surveys, we use the R23 method to derive the gas-phase oxygen abundances: 7.5 <12+log(0/H)<8.5. The galaxy stellar masses are derived using Bayesian based Markov Chain Monte Carlo (pi MC(exp 2)) fitting of their Spectral Energy Distribution (SED), and span the mass range 8.1 < log(M(stellar)/M(solar)) < 10.1. These galaxies show a mass-metal1icity (M-L) and Luminosity-Metallicity (LZ) relation, which is offset by -metal poor, being at early stages of formation, or the low metallicities may be due to gas infall and accretion due to mergers.
-
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
-
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
-
Mutual influences of rated currents, short circuit levels, fault durations and integrated protective schemes for industrial distribution MV switchgears
Energy Technology Data Exchange (ETDEWEB)
Gaidano, G. (FIAT Engineering, Torino, Italy); Lionetto, P.F.; Pelizza, C.; Tommazzolli, F.
1979-01-01
This paper deals with the problem of integrated and coordinated design of distribution systems, as regards the definition of system structure and parameters together with protection criteria and schemes. Advantages in system operation, dynamic response, heavier loads with reduced machinery rating margins and overall cost reduction, can be achieved. It must be noted that MV switchgears installed in industrial main distribution substations are the vital nodes of the distribution system. Very large amounts of power (up to 100 MW and more) are conveyed through MV busbars, coming from Utility and from in-plant generators and outgoing to subdistribution substations, to step-down transformers and to main concentrated loads (big drivers, furnaces etc.). Criteria and methods already studied and applied to public distribution are examined to assess service continuity and economics by means of the reduction of thermal stresses, minimization of disturbances and improvement of system stability. The life of network components depends on sizing, on fault energy levels and on probability of fault occurrence. Constructional measures and protection schemes, which reduce probability and duration of faults, are the most important tools to improve overall reliability. The introduction of advanced techniques, mainly based on computer application, not only allows drastic reduction of fault duration, but also permits the system to operate, under any possible contingency, in the optimal conditions, as the computer provides adaptive control. This mode of system management makes it possible to size network components with reference to the true magnitude of system quantities, avoiding expensive oversizing connected to the unflexibility of conventional protection and control schemes.
-
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
Science.gov (United States)
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
-
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Science.gov (United States)
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
-
HST/ACS DIRECT AGES OF THE DWARF ELLIPTICAL GALAXIES NGC 147 AND NGC 185
Energy Technology Data Exchange (ETDEWEB)
Geha, M. [Astronomy Department, Yale University, New Haven, CT 06520 (United States); Weisz, D. [Astronomy Department, Box 351580, University of Washington, Seattle, WA 98195 (United States); Grocholski, A. [Department of Physics and Astronomy, Louisiana State University, Baton Rouge, LA 70803 (United States); Dolphin, A. [Raytheon, 1151 E. Hermans Road, Tucson, AZ 85756 (United States); Marel, R. P. van der [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Guhathakurta, P., E-mail: marla.geha@yale.edu [UCO/Lick Observatory, University of California, Santa Cruz, 1156 High Street, Santa Cruz, CA 95064 (United States)
2015-10-01
We present the deepest optical photometry for any dwarf elliptical (dE) galaxy based on Hubble Space Telescope Advanced Camera for Surveys (ACS) observations of the Local Group dE galaxies NGC 147 and NGC 185. Our F606W and F814W color–magnitude diagrams are the first to reach below the oldest main sequence turnoff in a dE galaxy, allowing us to determine full star formation histories in these systems. The ACS fields are located roughly ∼1.5 effective radii from the galaxy center to avoid photometric crowding. While both ACS fields show unambiguous evidence for old and intermediate age stars, the mean age of NGC 147 is ∼4–5 Gyr younger as compared to NGC 185. In NGC 147, only 40% of stars were in place 12.5 Gyr ago (z ∼ 5), with the bulk of the remaining stellar population forming between 5 to 7 Gyr. In contrast, 70% of stars were formed in NGC 185 prior to 12.5 Gyr ago with the majority of the remaining population forming between 8 to 10 Gyr ago. Star formation has ceased in both ACS fields for at least 3 Gyr. Previous observations in the central regions of NGC 185 show evidence for star formation as recent as 100 Myr ago, and a strong metallicity gradient with radius. This implies a lack of radial mixing between the center of NGC 185 and our ACS field. The lack of radial gradients in NGC 147 suggests that our inferred SFHs are more representative of its global history. We interpret the inferred differences in star formation histories to imply an earlier infall time into the M31 environment for NGC 185 as compared to NGC 147.
-
Momentum distribution of non-interacting fermions enclosed in a box
International Nuclear Information System (INIS)
Krivine, H.
1985-01-01
This is a study of: the finite size effect on the momentum distribution n(/sup →/k) of an ensemble of A non-interacting fermions enclosed in a box. Analytical expressions are obtained in the two limiting cases the Fermi momentum. The result is to analyze the convergence of toward the standard step function in the infinite medium. Applying results to the nuclear case, changes are compared in n(/sup →/k) generated by the finite size of actual nuclei to those due to short range correlations. Both effects are shown to be of same order of magnitude. The next step is to take into account the short range correlations in finite systems
-
RNA interference suppression of mucin 5AC (MUC5AC reduces the adhesive and invasive capacity of human pancreatic cancer cells
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
-
Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.
Science.gov (United States)
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
-
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
-
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
-
76 FR 19476 - Exelon Generation Company, LLC, Peach Bottom Atomic Power Station, Unit Nos. 2 and 3; Exemption
Science.gov (United States)
2011-04-07
.../D Battery Room), 36 (E42 Switchgear Room), 37 (E22 Switchgear Room), 43 (E-4 Emergency Diesel... this exemption have a combustible fuel load that is considered to be low with fuel sources consisting... 3 B/D Action M....... 9--39* 60 Battery Room). Fire Area 36 (E42 Switchgear Action R....... 12--42...
-
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
-
Power supply for control and instrumentation in Fast Breeder Test Reactor
International Nuclear Information System (INIS)
Raghavan, K.; Shanmugam, T.K.
1977-01-01
The design and operation of the four 'no-break' power supplies for control and instrumentation in the Fast Breeder Test Reactor (FBTR), Kalpakkam, are described. Interruptions in the power supplies are eliminated by redundancy and battery back-up source while voltage dips and transients are taken care by automatic regulation system. The four power supplies are : (1) 24 V D.C. exclusively for neutronic and safety circuits, (2) 48 V D.C. for control logic indication lamps and solenoid valves, (3) 220 V D.C. for switchgear control, control room emergency lighting and D.C. flushing oil pump for the turbine and (4) 220 V A.C. single-phase 50 H/Z for computers and electronics of control and instrumentation. Stationary lead-acid batteries (lead antimony type) in floating mode operation with rectifier/charger are used for emergency back-up. All these power supplies are fed by 415 V, 3-phase, 50 HZ emergency supply buses which are provided with diesel generator back-up. Static energy conversion system (in preference to mechanical rotation system) is used for A.C. to D.C. and also for A.C. to A.C. conversion. (M.G.B.)
-
Dicty_cDB: FC-AC21 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
-
THERMIONIC AC GENERATION
Science.gov (United States)
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
-
21 CFR 880.6320 - AC-powered medical examination light.
Science.gov (United States)
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
-
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
-
STS 31 PAYLOAD HUBBLE SPACE TELESCOPE ENCLOSED IN AN AIR-TIGHT PLASTIC BAG FOR PROTECTION IN VERTICA
Science.gov (United States)
1989-01-01
Preparations are made to enclose the Hubble Space Telescope [HST] inside an air-tight plastic bag in the VPF. Processing of the 94- inch primary mirror telescope for launch on the Discovery in March 1990, involves working within strict controls to prevent contamination.
-
Ray tracing for optimization of compound parabolic concentrators for solar collectors of enclosed design
OpenAIRE
YURCHENKO, VLADIMIR; YURCHENKO, EDUARD; ÇİYDEM, MEHMET; TOTUK, ONAT
2015-01-01
We present our developments in computer simulations and optimization of compound parabolic concentrators (CPCs) for solar heat collectors. Issues of both the optical and thermal optimization of CPC collectors of enclosed design are discussed. Ray tracing results for a CPC with a V-shaped absorber are presented. A range of optimal values for the apex angle of a V-shaped absorber is proposed for a CPC collector of typical design.
-
Metal immobilization by sludge-derived biochar: roles of mineral oxides and carbonized organic compartment.
Science.gov (United States)
Zhang, Weihua; Huang, Xinchen; Jia, Yanming; Rees, Frederic; Tsang, Daniel C W; Qiu, Rongliang; Wang, Hong
2017-04-01
Pyrolyzing sludge into biochar is a potentially promising recycling/disposal solution for municipal wastewater sludge, and the sludge-derived biochar (SDBC) presents an excellent sorbent for metal immobilization. As SDBC is composed of both mineral oxides and carbonized organic compartment, this study therefore compared the sorption behaviour of Pb and Zn on SDBC to those of individual and mixture of activated carbon (AC) and amorphous aluminium oxide (Al 2 O 3 ). Batch experiments were conducted at 25 and 45 °C, and the metal-loaded sorbents were artificially aged in the atmosphere for 1-60 days followed by additional sorption experiments. The Pb sorption was generally higher than Zn sorption, and the co-presence of Pb reduced Zn sorption on each studied sorbent. Higher sorption capacities were observed at 45 °C than 25 °C for SDBC and AC, while the opposite was shown for Al 2 O 3 , indicating the significance of temperature-dependent diffusion processes in SDBC and AC. Nevertheless, metal sorption was more selective on Al 2 O 3 that showed a greater affinity towards Pb over Zn under competition, correlating with the reducible fraction of sequential extraction. Furthermore, significant amounts of Pb and Zn were additionally sorbed on SDBC following 30-day ageing. The X-ray diffraction revealed the formation of metal-phosphate precipitates, while the X-ray photoelectron spectroscopy showed a larger quantity of metal-oxygen bonding after 30-day ageing of metal-loaded SDBC. The results may imply favourable long-term transformation and additional sorption capacity of SDBC. In conclusion, SDBC resembles the sorption characteristics of both organic and mineral sorbents in different aspects, presenting an appropriate material for metal immobilization during soil amendment.
-
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
-
Metal-clad switchgear with large capacity vacuum circuit breaker in two-tier arrangement for nuclear power plants
International Nuclear Information System (INIS)
Yoshikawa, Isao; Watanabe, Hideo; Sugitani, Shinji
1982-01-01
Accompanying the increase of main machinery capacity in nuclear power stations, the short-circuit capacity for 6.9 kV in-house auxiliary machinery circuit has increased, and a 63 kA circuit breaker has become necessary. Although magnetic breakers have been used as large capacity breakers so far, vacuum breakers which are more suitable for the recent environmental conditions of power stations have become employed. Hitachi Ltd. has developed the metal-clad switchboard with vacuum breakers of 7.2 kV, 1,200 to 3,000 A, and breaking current of 63 kA in two-tier arrangement. The main features of this breaker are small size, light weight, long life, labour-saving in maintenance and inspection, simple construction, easy handling, high reliability and safety. In addition, in this paper, the construction of the breaker and switchboard, aseismic property, and test results are described. The tests include the withstand voltage test, elevated temperature test, short period current test, short-circuit test, low current breaking test, continuous on-off test, on-off surge combination test and short-circuit breaking test under the condition of vacuum failure in one phase. The aseismic property is guaranteed by analyzing the vibration characteristics and the strength using computer-aided finite element method so that the performance required is satisfied. (Wakatsuki, Y.)
-
Measurement of electromagnetic properties of powder and solid metal materials for additive manufacturing
Science.gov (United States)
Todorov, Evgueni Iordanov
2017-04-01
The lack of validated nondestructive evaluation (NDE) techniques for examination during and after additive manufacturing (AM) component fabrication is one of the obstacles in the way of broadening use of AM for critical applications. Knowledge of electromagnetic properties of powder (e.g. feedstock) and solid AM metal components is necessary to evaluate and deploy electromagnetic NDE modalities for examination of AM components. The objective of this research study was to develop and implement techniques for measurement of powder and solid metal electromagnetic properties. Three materials were selected - Inconel 625, duplex stainless steel 2205, and carbon steel 4140. The powder properties were measured with alternate current (AC) model based eddy current technique and direct current (DC) resistivity measurements. The solid metal properties were measured with DC resistivity measurements, DC magnetic techniques, and AC model based eddy current technique. Initial magnetic permeability and electrical conductivity were acquired for both powder and solid metal. Additional magnetic properties such as maximum permeability, coercivity, retentivity, and others were acquired for 2205 and 4140. Two groups of specimens were tested along the build length and width respectively to investigate for possible anisotropy. There was no significant difference or anisotropy when comparing measurements acquired along build length to those along the width. A trend in AC measurements might be associated with build geometry. Powder electrical conductivity was very low and difficult to estimate reliably with techniques used in the study. The agreement between various techniques was very good where adequate comparison was possible.
-
Ac conductivity and dielectric spectroscopy studies on tin oxide thin films formed by spray deposition technique
Energy Technology Data Exchange (ETDEWEB)
Barış, Behzad, E-mail: behzadbaris@gmail.com
2014-04-01
Au/tin oxide/n-Si (1 0 0) structure has been created by forming a tin oxide (SnO{sub 2}) on n-type Si by using the spray deposition technique. The ac electrical conductivity (σ{sub ac}) and dielectric properties of the structure have been investigated between 30 kHz and 1 MHz at room temperature. The values of ε', ε″, tanδ, σ{sub ac}, M' and M″ were determined as 1.404, 0.357, 0.253, 1.99×10{sup −7} S/cm, 0.665 and 0.168 for 1 MHz and 6.377, 6.411, 1.005, 1.07×10{sup −7} S/cm, 0.077 and 0.078 for 30 kHz at zero bias, respectively. These changes were attributed to variation of the charge carriers from the interface traps located between semiconductor and metal in the band gap. It is concluded that the values of the ε', ε″ and tanδ increase with decreasing frequency while a decrease is seen in σ{sub ac} and the real (M') and imaginary (M″) components of the electrical modulus. The M″ parameter of the structure has a relaxation peak as a function of frequency for each examined voltage. The relaxation time of M″(τ{sub M″}) varies from 0.053 ns to 0.018 ns with increasing voltage. The variation of Cole–Cole plots of the sample shows that there is one relaxation.
-
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
-
Permanent-magnet-less machine having an enclosed air gap
Science.gov (United States)
Hsu, John S [Oak Ridge, TN
2012-02-07
A permanent magnet-less, brushless synchronous system includes a stator that generates a magnetic rotating field when sourced by an alternating current. An uncluttered rotor disposed within the magnetic rotating field is spaced apart from the stator to form an air gap relative to an axis of rotation. A stationary excitation core spaced apart from the uncluttered rotor by an axial air gap and a radial air gap substantially encloses the stationary excitation core. Some permanent magnet-less, brushless synchronous systems include stator core gaps to reduce axial flux flow. Some permanent magnet-less, brushless synchronous systems include an uncluttered rotor coupled to outer laminations. The quadrature-axis inductance may be increased in some synchronous systems. Some synchronous systems convert energy such as mechanical energy into electrical energy (e.g., a generator); other synchronous systems may convert any form of energy into mechanical energy (e.g., a motor).
-
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
-
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
-
Bioinformatics and Astrophysics Cluster (BinAc)
Science.gov (United States)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
-
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
-
High-Speed Visualization of Evaporation Phenomena from Tungsten Based Electrode in Multi-Phase AC Arc
Science.gov (United States)
Tanaka, Manabu; Hashizume, Taro; Imatsuji, Tomoyuki; Nawata, Yushi; Watanabe, Takayuki
2015-09-01
A multi-phase AC arc has been developed for applications in various fields of engineering because it possesses unique advantages such as high energy efficiency. However, understanding of fundamental phenomena in the multi-phase AC arc is still insufficient for practical use. Purpose of this study is to investigate electrode erosion mechanism by high-speed visualization of the electrode metal vapor in the arc. Results indicated that the electrode mainly evaporated at anodic period, leading to the arc constriction. Moreover, evaporation of W electrode with 2wt% La2O3 at the anodic period was much higher than that with 2wt% ThO2. This can be explained by different properties of these oxide additives. Evaporation of the oxide additive resulted in the arc constriction, which accelerated the evaporation of W electrode. Therefore, addition of La2O3 with lower melting and boiling point than ThO2 lead to stronger arc constriction, resulting in severer evaporation of W electrode.
-
Metal accumulation in Nitellopsis obtusa cells from the laboratory solution
International Nuclear Information System (INIS)
Marciulioniene, D.; Montvydiene, D.; Ceburnis, D.
2001-01-01
The ability of Nitellopsis obtusa to accumulate heavy metals from the laboratory solution containing ions of Cd2+, Cr6+, Cu2+, Mn2+, Ni2+, Pb2+ and Zn2+ was investigated. Concentrations of heavy metals in the algae cells were determined, and the accumulation coefficient (AC) of heavy metals in the live cells (in the wall and the protoplast), in the dead cells (in the wall), and in the cells which have lost turgor were estimated. It was found that, according to the accumulation coefficient values in the cell wall of N. obtusa, the studied metals followed the order: Cr6+ < Pb2+ < Ni2+ < Cd2+ < Cu2+ < Zn2+ < Mn2+, while according to the accumulation coefficient values in the protoplast, the order was: Pb2+ < Cr6+ < Ni2+ < Zn2+ < Cd2+ < Cu2+ < Mn2+ . It was demonstrated that in both media metals were accumulated very similarly. The difference between AC in the cell walls of the live and dead cells was negligible. The obtained data allowed to conclude that all investigated metals were not only absorbed in the algae cell wall but they were intensively up taken into the cell. Data showed that among all investigated metals Cr6+ was the least absorbed in the cell wall, while Pb was predominantly absorbed in the cell wall, as well as Cd2+ and Cu2+ were more intensively up taken into the cell than other metals It was established that Mn2+ was Intensively adsorbed in the cell wall, and its uptake into the cell was intensive, too. (author)
-
Variation of boron concentration in metallic glass ribbons
International Nuclear Information System (INIS)
Nagy, A.Z.; Vasvari, B.; Duwez, P.; Bakos, L.; Seres, Z.; Bogancs, J.; Nazarov, V.M.
1979-12-01
The surface boron concentration of Fe 40 Ni 40 P 14 B 6 , Fe 32 Ni 36 Cr 14 P 12 B 6 and Fe 40 Ni 40 B 20 metallic glasses was measured by neutron activation analysis on both sides of the ribbon samples. It was found that the boron concentration is always higher at the bright side of the ribbon than that at the dull side which is in contact with the cold surface of the wheel during the rapid quenching from the melt. A possible explanation is given in terms of the solid-liquid interface moving rapidly from the cooled surface to the free surface when preparing the samples. Range values of alpha-particles for some characteristic compositions of metallic glasses are tabulated. A mathematical technique for the deconvolution of experimental data is described and the listing of the Fortran program is enclosed. (author)
-
Force-induced chemical reactions on the metal centre in a single metalloprotein molecule
Science.gov (United States)
Zheng, Peng; Arantes, Guilherme M.; Field, Martin J.; Li, Hongbin
2015-01-01
Metalloproteins play indispensable roles in biology owing to the versatile chemical reactivity of metal centres. However, studying their reactivity in many metalloproteins is challenging, as protein three-dimensional structure encloses labile metal centres, thus limiting their access to reactants and impeding direct measurements. Here we demonstrate the use of single-molecule atomic force microscopy to induce partial unfolding to expose metal centres in metalloproteins to aqueous solution, thus allowing for studying their chemical reactivity in aqueous solution for the first time. As a proof-of-principle, we demonstrate two chemical reactions for the FeS4 centre in rubredoxin: electrophilic protonation and nucleophilic ligand substitution. Our results show that protonation and ligand substitution result in mechanical destabilization of the FeS4 centre. Quantum chemical calculations corroborated experimental results and revealed detailed reaction mechanisms. We anticipate that this novel approach will provide insights into chemical reactivity of metal centres in metalloproteins under biologically more relevant conditions. PMID:26108369
-
Development of the removal technology for toxic heavy metal ions by surface-modified activated carbon
International Nuclear Information System (INIS)
Park, Geun Il; Song, Kee Chan; Kim, Kwang Wook; Kim, In Tae; Cho, Il Hoon; Kim, Joon Hyung
2001-01-01
Adsorption capacities of both radionuclides(uranium, cobalt) and toxic heavy metals (lead, cadmium and chromium) using double surface-modified activated carbon in wide pH ranges are extensively evaluated. Surface-modified activated carbons are classified as AC(as-received carbon), OAC(single surface-modified carbon with nitric acid solution) and OAC-Na(double surface-modified carbon with various alkali solutions). It is established that optimal condition for the second surface modification of OAC is to use the mixed solution of both NaOH and NaCl with total concentration of 0.1 N based on adsorption efficiencies of uranium and cobalt. Variations of adsorption efficiencies in pH ranges of 2∼10 and the adsorption capacities in batch adsorber and fixed bed for removal of both radionuclides and toxic heavy metals using OAC-Na were shown to be superior to that of the AC and OAC even in a low pH range. Capacity factors of OAC-Na for the removal of various metal ions are also excellent to that of AC or OAC. Quantitative analysis of capacity factors for each ions showed that adsorption capacity of OAC-Na increased by 30 times for uranium, 60 times for cobalt, 9 times for lead, 30 times for cadmium, 3 times for chromium compared to that of AC at pH 5, respectively. Adsorption capacity of OAC-Na is comparable to that of XAD-16-TAR used as commercial ion exchange resin
-
Progress in the Development of SERS-Active Substrates Based on Metal-Coated Porous Silicon.
Science.gov (United States)
Bandarenka, Hanna V; Girel, Kseniya V; Zavatski, Sergey A; Panarin, Andrei; Terekhov, Sergei N
2018-05-21
The present work gives an overview of the developments in surface-enhanced Raman scattering (SERS) with metal-coated porous silicon used as an active substrate. We focused this review on the research referenced to SERS-active materials based on porous silicon, beginning from the patent application in 2002 and enclosing the studies of this year. Porous silicon and metal deposition technologies are discussed. Since the earliest studies, a number of fundamentally different plasmonic nanostructures including metallic dendrites, quasi-ordered arrays of metallic nanoparticles (NPs), and metallic nanovoids have been grown on porous silicon, defined by the morphology of this host material. SERS-active substrates based on porous silicon have been found to combine a high and well-reproducible signal level, storage stability, cost-effective technology and handy use. They make it possible to identify and study many compounds including biomolecules with a detection limit varying from milli- to femtomolar concentrations. The progress reviewed here demonstrates the great prospects for the extensive use of the metal-coated porous silicon for bioanalysis by SERS-spectroscopy.
-
Progress in the Development of SERS-Active Substrates Based on Metal-Coated Porous Silicon
Directory of Open Access Journals (Sweden)
Hanna V. Bandarenka
2018-05-01
Full Text Available The present work gives an overview of the developments in surface-enhanced Raman scattering (SERS with metal-coated porous silicon used as an active substrate. We focused this review on the research referenced to SERS-active materials based on porous silicon, beginning from the patent application in 2002 and enclosing the studies of this year. Porous silicon and metal deposition technologies are discussed. Since the earliest studies, a number of fundamentally different plasmonic nanostructures including metallic dendrites, quasi-ordered arrays of metallic nanoparticles (NPs, and metallic nanovoids have been grown on porous silicon, defined by the morphology of this host material. SERS-active substrates based on porous silicon have been found to combine a high and well-reproducible signal level, storage stability, cost-effective technology and handy use. They make it possible to identify and study many compounds including biomolecules with a detection limit varying from milli- to femtomolar concentrations. The progress reviewed here demonstrates the great prospects for the extensive use of the metal-coated porous silicon for bioanalysis by SERS-spectroscopy.
-
Disulfide polymer grafted porous carbon composites for heavy metal removal from stormwater runoff
DEFF Research Database (Denmark)
Ko, Dongah; Mines, Paul D.; Jakobsen, Mogens Havsteen
2018-01-01
The emerging concern of heavy metal pollution derived from stormwater runoff has triggered a demand for effective heavy metal sorbents. To be an effective sorbent, high affinity along with rapid sorption kinetics for environmental relevant concentrations of heavy metals is important. Herein, we...... have introduced a new composite suitable for trace metal concentration removal, which consists of cheap and common granular activated carbon covered with polymers containing soft bases, thiols, through acyl chlorination (DiS-AC). Material characterization demonstrated that the polymer was successfully...
-
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
-
ACS and STEMI treatment: gender-related issues.
Science.gov (United States)
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
-
Studies on portal systemic circulation by oral administration of 201Tl enclosed enteric coated capsule
International Nuclear Information System (INIS)
Tonami, Norihisa; Nakajima, Kenichi; Watanabe, Naoto
1986-01-01
Thallium-201 enclosed enteric coated capsule was prepared and administered orally to evaluate portal systemic circulation in 11 control subjects and 31 patients with various liver diseases by investigating scintigraphic appearance and the heart-to-liver uptake ratio (H/L ratio). In 10 patients with liver cirrhosis and one with chronic hepatitis, the results of H/L ratio were compared to those obtained by 201 Tl per-rectal administration. 1. It was fundamentally confirmed that 201 Tl enclosed enteric coated capsule was not broken down in the artificial gastric juice, but nearly completely melted 15 minutes after soaking in the artificial intestinal juice. 2. Clinical study was successfully completed in 36 out of 42 cases (86 %). Unsuccessful cases were found in 2 with capsule collapse in the stomach and 4 with its poor moving to the duodenum. 3. In control subjects the liver was clearly visualized and the mean value of H/L ratio was 0.32 which is lower than that of 201 Tl per-rectal administration previously reported. H/L ratio in patients with chronic and acute hepatitis was nearly equal to that in control subjects. H/L ratio in patients with liver cirrhosis was slightly higher than that in control subjects, but there was no significant difference between them. In cases with esophageal varices, H/L ratio was not so high compared to that in control subjects. Out of 7 patients showing high H/L ratio more than 0.8 in 201 Tl per-rectal administration, only one showed similar high ratio (1.07) in oral administration of 201 Tl enclosed enteric coated capsule. In this case the shunting from superior mesenteric vein to inferior vena cava connection was confirmed. From these results, it was considered that the shunting volume of superior mesenteric vein through esophageal varices is small. 4. A possibility of a new administration of radioisotope with enteric coated capsule was emphasized. (author)
-
HST/ACS IMAGING OF OMEGA CENTAURI: OPTICAL COUNTERPARTS OF CHANDRA X-RAY SOURCES
International Nuclear Information System (INIS)
Cool, Adrienne M.; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian; Haggard, Daryl; Anderson, Jay
2013-01-01
We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel images obtained using F625W, F435W, and F658N filters; with nine pointings we cover the central ∼10' × 10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, ∼40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M 625 =10.4-12.6, making them comparable in brightness to field CVs near the period minimum discovered in the Sloan Digital Sky Survey. Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously reported quiescent low-mass X-ray binary. We also identify 3 foreground stars and 11 probable active galactic nuclei. Finally, we report the discovery of a group of seven stars whose X-ray properties are suggestive of magnetically active binaries, and whose optical counterparts lie on or very near the metal-rich anomalous giant and subgiant branches in ω Cen. If the apparent association between these seven stars and the RGB/SGB-a stars is real, then the frequency of X-ray sources in this metal-rich population is enhanced by a factor of at least five relative to the other giant and subgiant populations in the cluster. If these stars are not members of the metal-rich population, then they bring the total number of red stragglers (also known as sub-subgiants) that have been identified in ω to Cen 20, the largest number yet known in any globular cluster.
-
HST/ACS Imaging of Omega Centauri: Optical Counterparts of Chandra X-Ray Sources
Science.gov (United States)
Cool, Adrienne M.; Haggard, Daryl; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian; Anderson, Jay
2013-02-01
We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel images obtained using F625W, F435W, and F658N filters; with nine pointings we cover the central ~10' × 10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, ~40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M 625 =10.4-12.6, making them comparable in brightness to field CVs near the period minimum discovered in the Sloan Digital Sky Survey. Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously reported quiescent low-mass X-ray binary. We also identify 3 foreground stars and 11 probable active galactic nuclei. Finally, we report the discovery of a group of seven stars whose X-ray properties are suggestive of magnetically active binaries, and whose optical counterparts lie on or very near the metal-rich anomalous giant and subgiant branches in ω Cen. If the apparent association between these seven stars and the RGB/SGB-a stars is real, then the frequency of X-ray sources in this metal-rich population is enhanced by a factor of at least five relative to the other giant and subgiant populations in the cluster. If these stars are not members of the metal-rich population, then they bring the total number of red stragglers (also known as sub-subgiants) that have been identified in ω to Cen 20, the largest number yet known in any globular cluster.
-
46 CFR 108.437 - Pipe sizes and discharge rates for enclosed ventilation systems for rotating electrical equipment.
Science.gov (United States)
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Pipe sizes and discharge rates for enclosed ventilation systems for rotating electrical equipment. 108.437 Section 108.437 Shipping COAST GUARD, DEPARTMENT OF... Systems Fixed Carbon Dioxide Fire Extinguishing Systems § 108.437 Pipe sizes and discharge rates for...
-
Study of hydrogen vehicle storage in enclosed parking facilities
Energy Technology Data Exchange (ETDEWEB)
Belzile, M A [Transport Canada, Ottawa, ON (Canada). ecoTECHNOLOGY for Vehicles; Cook, S [Canadian Hydrogen and Fuel Cell Association, Vancouver, BC (Canada)
2009-07-01
This paper reported on a coordinated research program between Transport Canada and Hydrogen and Fuel Cells Canada that examines issues of hydrogen vehicle storage. The ecoTECHNOLOGY for Vehicles (eTV) program focuses on the safety issues of operating and storing hydrogen fuelled vehicles in enclosed parking facilities. The aim of the program is to review existing research, current building standards applied in Canada, standards applied to natural gas vehicles, and standards and recommended practices for the design of fuel cell vehicles. Any potential gaps in safety will be considered in the design of CFD modeling scenarios. Considerations that extend beyond previously performed studies include the effect of Canadian climate on vehicle safety and leak detection equipment, fail-safe mechanism performance, as well as analyses of the frequency of hydrogen leak occurrences and the probability of ignition. The results of the study will facilitate policy makers and authorities in making decisions regarding the storage of hydrogen fuelled vehicles as they become more popular.
-
Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys
Science.gov (United States)
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
-
Should fee-for-service be for all guideline-advocated acute coronary syndrome (ACS) care? Observations from the Snapshot ACS study.
Science.gov (United States)
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
-
AC/RF Superconductivity
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
-
AC/RF Superconductivity
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
-
Electrochemical Effect of Different Modified Glassy Carbon Electrodes on the Values of Diffusion Coefficient for Some Heavy Metal Ions
International Nuclear Information System (INIS)
Radhi, M M; Alwan, S H; Amir, Y K A; Tee, T W
2013-01-01
Glassy carbon electrode (GCE) was modified with carbon nanotubes (CNT), C 60 and activated carbon (AC) by mechanical attachment method and solution evaporation technique to preparation CNT/GCE, C 60 /GCE and AC/GCE, these electrodes were modified in Li + solution via cyclic voltammetry (CV) potential cycling to preparing CNT/Li + /GCE, C 60 /Li + /GCE and AC/Li + /GCE. The sensing characteristics of the modified film electrodes, demonstrated in the application study for different heavy metal ions such as Hg 2+ , Cd 2+ , and Mn 2+ . Cyclic voltammetric effect by chronoamperometry (CA) technique was investigated to determination the diffusion coefficient (D f ) values from Cottrell equation at these ions. Based on Cottrell equation (diffusion coefficient) of the redox current peaks of different heavy metal ions at different modified electrodes were studied to evaluate the sensing of these electrodes by the diffusion coefficient values. The modification of GCE with nano materials and Li + act an enhancement for the redox current peaks to observe that the diffusion process are high at CNT/Li + /GCE, C 60 /Li + /GCE and AC/Li+/GCE, but it has low values at unmodified GCE.
-
Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
-
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
-
THE STAR FORMATION HISTORY OF THE VERY METAL-POOR BLUE COMPACT DWARF I Zw 18 FROM HST/ACS DATA
Energy Technology Data Exchange (ETDEWEB)
Annibali, F.; Cignoni, M.; Tosi, M.; Clementini, G.; Contreras Ramos, R.; Fiorentino, G. [INAF-Osservatorio Astronomico di Bologna, Via Ranzani 1, I-40127 Bologna (Italy); Van der Marel, R. P.; Aloisi, A. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Marconi, M.; Musella, I., E-mail: francesca.annibali@oabo.inaf.it [INAF-Osservatorio Astronomico di Capodimonte, via Moiariello 16, I-80131 Napoli (Italy)
2013-12-01
We have derived the star formation history (SFH) of the blue compact dwarf galaxy I Zw 18 through comparison of deep HST/ACS data with synthetic color-magnitude diagrams (CMDs). A statistical analysis was implemented for the identification of the best-fit SFH and relative uncertainties. We confirm that I Zw 18 is not a truly young galaxy, having started forming stars earlier than ∼1 Gyr ago, and possibly at epochs as old as a Hubble time. In I Zw 18's main body we infer a lower limit of ≈2 × 10{sup 6} M {sub ☉} for the mass locked up in old stars. I Zw 18's main body has been forming stars very actively during the last ∼10 Myr, with an average star formation rate (SFR) as high as ≈1 M {sub ☉} yr{sup –1} (or ≈2 × 10{sup –5} M {sub ☉} yr{sup –1} pc{sup –2}). On the other hand, the secondary body was much less active at these epochs, in agreement with the absence of significant nebular emission. The high current SFR can explain the very blue colors and the high ionized gas content in I Zw 18, resembling primeval galaxies in the early universe. Detailed chemical evolution models are required to quantitatively check whether the SFH from the synthetic CMDs can explain the low measured element abundances, or if galactic winds with loss of metals are needed.
-
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Science.gov (United States)
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
-
Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
-
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
-
Assessment of current effect on waves in a semi-enclosed basin
Science.gov (United States)
Benetazzo, A.; Carniel, S.; Sclavo, M.; Bergamasco, A.
2012-04-01
The wave-current interaction process in the semi-enclosed Adriatic Sea is studied using the Coupled Ocean-Atmosphere-Wave-Sediment Transport (COAWST) modeling system, which is used to exchange data fields between the ocean model ROMS (Regional Ocean Modeling System) and the wave model SWAN (Simulating WAves Nearshore). The 2-way data transfer between circulation and wave models is synchronous with ROMS providing current fields, free surface elevation, and bathymetry to SWAN. In particular, the 3-D current profiles are averaged using a formulation that integrates the near-surface velocity over a depth controlled by the spectral mean wave number. This coupling procedure is carried out up to coastal areas by means of an offline grid nesting. The parent grid covers the whole Adriatic Sea and has a horizontal resolution of 2.0 km, whereas the child grid resolution increases to 0.5 km but it is limited to the northern Adriatic Sea (Gulf of Venice), where the current effect on waves is investigated. The most frequent winds blowing on the Adriatic Sea are the so-called Bora and Sirocco which cause high waves in the Adriatic Sea, although Bora waves are generally fetch-limited. In fact, Bora winds blow orthogonal to the main basin axis (approximately aligned with the NW-SE direction), while Sirocco has large spatial scale being a southeasterly wind. For the numerical simulations, the meteorological forcings are provided by the operational meteorological model COSMO-I7, which is the Italian version of the COSMO Model, a mesoscale model developed in the framework of the COSMO Consortium. During the analysis period, the simulated wind, current and wave are compared with observations at the ISMAR oceanographic tower located off the Venice littoral. Wave heights and sea surface winds are also compared with satellite-derived data. To account for the variability of sea states during a storm, the expected maximum individual wave height in a sea storm with a given history is also
-
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
-
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
-
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Science.gov (United States)
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
-
η5 and η6 - cyclic π-perimeter hydrocarbon platinum group metal ...
Indian Academy of Sciences (India)
The SMART20 software was used for data acquisition. ... were undertaken with the SAINT20 software. Structures ..... the change in electron density around the metal centre. .... request@ccdc.cam.ac.uk, or by contacting The Cambridge.
-
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Science.gov (United States)
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
-
Eddy covariance measurements with a new fast-response, enclosed-path analyzer: Spectral characteristics and cross-system comparisons
Science.gov (United States)
K. Novick; J. Walker; W.S. Chan; A. Schmidt; C. Sobek; J.M. Vose
2013-01-01
A new class of enclosed path gas analyzers suitable for eddy covariance applications combines the advantages of traditional closed-path systems (small density corrections, good performance in poor weather) and open-path systems (good spectral response, low power requirements), and permits estimates of instantaneous gas mixing ratio. Here, the extent to which these...
-
Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
-
21 CFR 880.5100 - AC-powered adjustable hospital bed.
Science.gov (United States)
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
-
Nonlinear AC susceptibility, surface and bulk shielding
Science.gov (United States)
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
-
AC BREAKDOWN IN GASES
Science.gov (United States)
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
-
Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus
Science.gov (United States)
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
-
AC electric motors control advanced design techniques and applications
CERN Document Server
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
-
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
-
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Science.gov (United States)
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
-
Evidence of metallic plating on archaeological artefacts by voltammetry of microparticles
Czech Academy of Sciences Publication Activity Database
Ottenwelter, Estelle; Costa, V.
2015-01-01
Roč. 57, č. 3 (2015), s. 497-504 ISSN 0003-813X Institutional support: RVO:67985912 Keywords : metallic plating * voltammetry of microparticles * non-invasive analysis * medieval period * archaeological artefacts Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.364, year: 2015
-
Geochemical analysis of sediments from a semi-enclosed bay (Dongshan Bay, southeast China) to determine the anthropogenic impact and source.
Science.gov (United States)
Xu, Yonghang; Sun, Qinqin; Ye, Xiang; Yin, Xijie; Li, Dongyi; Wang, Liang; Wang, Aijun; Li, Yunhai
2017-05-01
The geochemical compositions of sediments in the Dongshan Bay, a semi-enclosed bay on the southeast coast of China, were obtained to identify pollutant sources and evaluate the anthropogenic impacts over the last 100 years. The results indicated that the metal flux had been increasing since the 1980s. Enrichment factor values (Pb, Zn and Cu) suggested only slight enrichment. The proportion of anthropogenic Pb changed from 9% to 15% during 2000-2014. Coal combustion might be an important contamination source in the Dongshan Bay. The historical variation in the metal flux reflected the economic development and urbanization in the Zhangjiang drainage area in the past 30 years. According to the Landsat satellite remote sensing data, the urbanization area expanded approximately three times from 1995 to 2010. The δ 13 C values (-21‰ to -23‰) of the organic matter (OM) in the sediments indicated that the OM was primarily sourced from aquatic, terrigenous and marsh C 3 plants. Nitrogen was mainly derived from aquatic plants and terrigenous erosion before the 1980s. However, the total organic carbon (TOC) contents, total nitrogen (TN) contents and δ 15 N had been increasing since the 1980s, which suggested that the sources of nitrogen were soil erosion, fertilizer and sewage. In addition, the TOC and TN fluxes in the Dongshan Bay had significantly increased since the 1980s, which reflected the use of N fertilizer. However, the TOC and TN fluxes significantly decreased in the past decade because environmental awareness increased and environmental protection policies were implemented. Copyright © 2017 Elsevier Ltd. All rights reserved.
-
AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
-
Nuclear structure of 231Ac
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
-
FLIT: Flowing LIquid metal Torus
Science.gov (United States)
Kolemen, Egemen; Majeski, Richard; Maingi, Rajesh; Hvasta, Michael
2017-10-01
The design and construction of FLIT, Flowing LIquid Torus, at PPPL is presented. FLIT focuses on a liquid metal divertor system suitable for implementation and testing in present-day fusion systems, such as NSTX-U. It is designed as a proof-of-concept fast-flowing liquid metal divertor that can handle heat flux of 10 MW/m2 without an additional cooling system. The 72 cm wide by 107 cm tall torus system consisting of 12 rectangular coils that give 1 Tesla magnetic field in the center and it can operate for greater than 10 seconds at this field. Initially, 30 gallons Galinstan (Ga-In-Sn) will be recirculated using 6 jxB pumps and flow velocities of up to 10 m/s will be achieved on the fully annular divertor plate. FLIT is designed as a flexible machine that will allow experimental testing of various liquid metal injection techniques, study of flow instabilities, and their control in order to prove the feasibility of liquid metal divertor concept for fusion reactors. FLIT: Flowing LIquid metal Torus. This work is supported by the US DOE Contract No. DE-AC02-09CH11466.
-
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
-
Marketingová komunikace AC Sparta Praha
OpenAIRE
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
-
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
-
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
-
Studies on portal systemic circulation by oral administration of /sup 201/Tl enclosed enteric coated capsule
Energy Technology Data Exchange (ETDEWEB)
Tonami, Norihisa; Nakajima, Kenichi; Watanabe, Naoto and others
1986-03-01
Thallium-201 enclosed enteric coated capsule was prepared and administered orally to evaluate portal systemic circulation in 11 control subjects and 31 patients with various liver diseases by investigating scintigraphic appearance and the heart-to-liver uptake ratio (H/L ratio). In 10 patients with liver cirrhosis and one with chronic hepatitis, the results of H/L ratio were compared to those obtained by /sup 201/Tl per-rectal administration. 1. It was fundamentally confirmed that /sup 201/Tl enclosed enteric coated capsule was not broken down in the artificial gastric juice, but nearly completely melted 15 minutes after soaking in the artificial intestinal juice. 2. Clinical study was successfully completed in 36 out of 42 cases (86 %). Unsuccessful cases were found in 2 with capsule collapse in the stomach and 4 with its poor moving to the duodenum. 3. In control subjects the liver was clearly visualized and the mean value of H/L ratio was 0.32 which is lower than that of /sup 201/Tl per-rectal administration previously reported. H/L ratio in patients with chronic and acute hepatitis was nearly equal to that in control subjects. H/L ratio in patients with liver cirrhosis was slightly higher than that in control subjects, but there was no significant difference between them. In cases with esophageal varices, H/L ratio was not so high compared to that in control subjects. Out of 7 patients showing high H/L ratio more than 0.8 in /sup 201/Tl per-rectal administration, only one showed similar high ratio (1.07) in oral administration of /sup 201/Tl enclosed enteric coated capsule. In this case the shunting from superior mesenteric vein to inferior vena cava connection was confirmed. From these results, it was considered that the shunting volume of superior mesenteric vein through esophageal varices is small. 4. A possibility of a new administration of radioisotope with enteric coated capsule was emphasized.
-
Low Cost Fabrication of 2G Wires for AC Applications
Energy Technology Data Exchange (ETDEWEB)
Kodenkandath, T.; List, F.A., III
2005-09-15
Ink-jet printing has been demonstrated as an adaptable technology for printing YBCO filaments using a Metal Organic (MO) YBCO precursor. The technology was demonstrated using AMSC's proprietary metal organic TFA-based YBCO precursor and a commercial piezoelectric print-head on RABiTS templates. Filaments with a width of 100 um and spacing of 200 um were successfully printed, decomposed and processed to YBCO. Critical currents of {approx} 200 A/cm-w were achieved in a series of filaments with a 2 mm width. The single nozzle laboratory printer used in the Phase 1 program is capable of printing {approx} 100 um wide single filaments at a rate of 8-10 cm/sec. The electrical stabilization of filaments with a Ag ink was also evaluated using ink-jet printing. The overall objective of the Phase 1 Project was the evaluation and demonstration of inkjet-printing for depositing YBCO filaments on textured templates (RABiTS, IBAD, ISD, etc. substrates) with properties appropriate for low loss ac conductors. Goals of the Phase 1 program included development of an appropriate precursor ink, demonstration of the printing process, processing and characterization of printed YBCO filaments and evaluation of the process for further development.
-
Advanced DC/AC inverters applications in renewable energy
CERN Document Server
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
-
Preliminary experimental results for a non-intrusive scheme for the detection of flaws in metal pipelines
Science.gov (United States)
Aydin, K.; Shinde, S.; Suhail, M.; Vyas, A.; Zieher, K. W.
2002-05-01
An acoustic pulse echo scheme for non-intrusive detection of flaws in metal pipelines has been investigated in the laboratory. The primary pulse is generated by a pulsed magnetic field enclosing a short section of a free pipe. The detection is by an electrostatic detector surrounding a short section of the pipe. Reflected pulses from thin areas, with a longitudinal extension of about one pipe radius and a reduction of the wall thickness of 40%, can be detected clearly.
-
A single-phase embedded Z-source DC-AC inverter.
Science.gov (United States)
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
-
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Science.gov (United States)
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
-
Modelling of long High Voltage AC Cables in the Transmission System
DEFF Research Database (Denmark)
Gudmundsdottir, Unnur Stella
: conductor-insulation (with or without SC layers)-conductor-insulation(-conductor-insulation), whereas a transmission line single core XLPE cable will normally have the configuration: conductor-SC layerinsulation-SC layer-conductor-SC layer-conductor-insulation. Furthermore the existing cable models use......, EMTDC/PSCAD is provided. A typical HV AC underground power cable is formed by 4 main layers, namely; Conductor-Insulation-Screen-Insulation. In addition to these main layers, the cable also has semiconductive screens, swelling tapes and metal foil. For high frequency modelling in EMT-based software......-SC layer-solid hollow conductor) is implemented in the model. These improvements result in a more correct series impedance and hence a more correct damping of the simulations. Even though the series impedance is more correct, it does still not include the proximity effect and high frequency oscillations...
-
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Science.gov (United States)
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
-
Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.
Science.gov (United States)
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
-
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
-
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
-
Liquefied extinguishing agent discharge to an overpressure-sensitive enclosed volume
Directory of Open Access Journals (Sweden)
Hurda Lukáš
2018-01-01
Full Text Available The throttling of liquefied substances from high pressure vessels to an enclosed volume starting at atmospheric pressure is described in order to determine thermodynamic state of the extinguished room gaseous contents. Time dependent, 0D mathematical model is implemented describing the state inside the agent container, the isenthalpic throttling in the distribution system, agent vaporization and mixing with air. The agent is modelled as real gas. Other influences on the process including the heat transfer from selected solid parts inside the room and the gas mixture leakage out of the room are taken into account. Main outcome is an MS Excel tool for integrated fire extinguishers design optimization. The optimization balances the two contradictory requirements: Agent volumetric concentration to sustain the fire extinguishing capabilities and tolerable room overpressure. Agent fill weight and discharge time are being adjusted. The discharge time is controlled by the distribution piping and spray nozzles design. System operation is checked concerning various initial and boundary conditions.
-
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
-
The preparation and mechanical properties of Al-containing a-C : H thin films
International Nuclear Information System (INIS)
Zhang Guangan; Yan Pengxun; Wang Peng; Chen Youming; Zhang Junyan
2007-01-01
Al-containing hydrogenated amorphous carbon (Al-C : H) films were deposited on silicon substrates using a mid frequency magnetron sputtering Al target in an argon and methane gas mixture. The composition, surface morphology, hardness and friction coefficient of the films were characterized using x-ray photoelectron spectroscopy, atomic force microscopy, nanoindentation and tribological tester. The Al-C : H films deposited at low CH 4 content show high surface roughness, low hardness and high friction coefficient, similar to metallic Al films; in contrast, the Al-C : H films prepared under high CH 4 content indicate low surface roughness, high hardness and low friction coefficient, close to that of hard a-C : H films as wear-resistance films
-
7 CFR 1737.31 - Area Coverage Survey (ACS).
Science.gov (United States)
2010-01-01
... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...
-
Theoretical and Experimental Investigation of Liquid Metal MHD Power Generation
Energy Technology Data Exchange (ETDEWEB)
Elliott, D. G.; Cerini, D. J.; Hays, L. G.; Weinberg, E. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA (United States)
1966-11-15
Liquid metal magnetohydrodynamic power generation for space is studied. Closed- loop circulation of liquid metal without moving mechanical parts, and generation of electric power from the circulating metal, have been investigated analytically and experimentally, and the attainable cycle efficiencies have been calculated. Recent literature has pointed out the possibility of efficient a.c. generators with liquid metal as the working fluid, and this type of generator is under study. Analysis indicates that efficiencies up to 65% are attainable in a travelling-wave induction generator at the available liquid metal velocities of 100-200 m/sec, provided the generator has a length/gap ratio of no more than 50 for low friction loss, has an electrical length of no more than three wavelengths for low winding loss, and has end-effect compensation for cancelling finite-length effects in the power-generating region. The analysis leading to these conclusions is presented. The type of end-effect correction being studied is the ''compensating-pole'' technique in which an oscillating magnetic field is applied to the fluid entering and leaving the generator to make the flux linkages within the generator the same as those in a rotating or ''infinite'' generator. An experimental one-wavelength generator employing compensating poles has been fabricated, and empty-channel magnetic field measurements have been completed in preparation for tests with NaK. Two types of field measurements were made: d.c. measurements to determine the field profile as a function of phase angle and a.c. measurements to investigate the synchronization of the compensating poles with the travelling wave. The d.c. results showed that the flux linkages in the power generating region can be held close to those in a rotating machine, and the a.c. results showed that the compensating poles can be accurately synchronized with the travelling wave through transformer coupling. The component efficiencies from the
-
Development of 1 m HTS conductor using YBCO on textured metal substrate
International Nuclear Information System (INIS)
Yagi, M.; Sakamoto, H.; Mukoyama, S.; Yamamoto, K.; Amemiya, N.; Nagaya, S.; Kashima, N.; Shiohara, Y.
2009-01-01
We fabricated 1 m high temperature superconducting conductor (HTS conductor) using YBa 2 Cu 3 O 7-x coated conductors (YBCO tapes) on textured metal substrates, which are expected to be lower in cost than YBCO tapes using ion-beam assisted deposition. Those substrate and intermediate layers were manufactured by Furukawa Electric, and YBCO and a protective layer were applied to the intermediate layer by Chubu Electric Power. Before fabricating the conductor, a 0.1 mm thick copper tape was soldered to the YBCO tape, and 10 mm wide YBCO tape was divided into three strips by a YAG laser. To have sufficient current capacity for 1 kA, a two-layer conductor was fabricated, and its critical current (I c ) was 1976 A, but the magnetic properties of the textured metal substrates affected the increase in AC loss. In a low current region, the AC loss in this conductor was much higher than the Norris strip model, but approached the Norris strip model in the high current region because the magnetization was almost saturated. Low AC loss of 0.144 W/m at 1 kA rms was achieved even though the conductor had a small outer diameter of 20 mm and was composed of YBCO tapes with magnetic substrates.
-
How immunocontraception can contribute to elephant management in small, enclosed reserves: Munyawana population as a case study.
Science.gov (United States)
Druce, Heleen C; Mackey, Robin L; Slotow, Rob
2011-01-01
Immunocontraception has been widely used as a management tool to reduce population growth in captive as well as wild populations of various fauna. We model the use of an individual-based rotational immunocontraception plan on a wild elephant, Loxodonta africana, population and quantify the social and reproductive advantages of this method of implementation using adaptive management. The use of immunocontraception on an individual, rotational basis stretches the inter-calving interval for each individual female elephant to a management-determined interval, preventing exposing females to unlimited long-term immunocontraception use (which may have as yet undocumented negative effects). Such rotational immunocontraception can effectively lower population growth rates, age the population, and alter the age structure. Furthermore, such structured intervention can simulate natural process such as predation or episodic catastrophic events (e.g., drought), which regulates calf recruitment within an abnormally structured population. A rotational immunocontraception plan is a feasible and useful elephant population management tool, especially in a small, enclosed conservation area. Such approaches should be considered for other long-lived, social species in enclosed areas where the long-term consequences of consistent contraception may be unknown.
-
How immunocontraception can contribute to elephant management in small, enclosed reserves: Munyawana population as a case study.
Directory of Open Access Journals (Sweden)
Heleen C Druce
Full Text Available Immunocontraception has been widely used as a management tool to reduce population growth in captive as well as wild populations of various fauna. We model the use of an individual-based rotational immunocontraception plan on a wild elephant, Loxodonta africana, population and quantify the social and reproductive advantages of this method of implementation using adaptive management. The use of immunocontraception on an individual, rotational basis stretches the inter-calving interval for each individual female elephant to a management-determined interval, preventing exposing females to unlimited long-term immunocontraception use (which may have as yet undocumented negative effects. Such rotational immunocontraception can effectively lower population growth rates, age the population, and alter the age structure. Furthermore, such structured intervention can simulate natural process such as predation or episodic catastrophic events (e.g., drought, which regulates calf recruitment within an abnormally structured population. A rotational immunocontraception plan is a feasible and useful elephant population management tool, especially in a small, enclosed conservation area. Such approaches should be considered for other long-lived, social species in enclosed areas where the long-term consequences of consistent contraception may be unknown.
-
Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers
Directory of Open Access Journals (Sweden)
Abdul Sattar Larik
2011-01-01
Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.
-
Impact of metal artefacts due to EEG electrodes in brain PET/CT imaging
International Nuclear Information System (INIS)
Lemmens, Catherine; Nuyts, Johan; Dupont, Patrick; Montandon, Marie-Louise; Ratib, Osman; Zaidi, Habib
2008-01-01
The goal of this study is to investigate the impact of electroencephalogram (EEG) electrodes on the visual quality and quantification of 18 F-FDG PET images in neurological PET/CT examinations. For this purpose, the scans of 20 epilepsy patients with EEG monitoring were used. The CT data were reconstructed with filtered backprojection (FBP) and with a metal artefact reduction (MAR) algorithm. Both data sets were used for CT-based attenuation correction (AC) of the PET data. Also, a calculated AC (CALC) technique was considered. A volume of interest (VOI)-based analysis and a voxel-based quantitative analysis were performed to compare the different AC methods. Images were also evaluated visually by two observers. It was shown with simulations and phantom measurements that from the considered AC methods, the MAR-AC can be used as the reference in this setting. The visual assessment of PET images showed local hot spots outside the brain corresponding to the locations of the electrodes when using FBP-AC. In the brain, no abnormalities were observed. The quantitative analysis showed a very good correlation between PET-FBP-AC and PET-MAR-AC, with a statistically significant positive bias in the PET-FBP-AC images of about 5-7% in most brain voxels. There was also good correlation between PET-CALC-AC and PET-MAR-AC, but in the PET-CALC-AC images, regions with both a significant positive and negative bias were observed. EEG electrodes give rise to local hot spots outside the brain and a positive quantification bias in the brain. However, when diagnosis is made by mere visual assessment, the presence of EEG electrodes does not seem to alter the diagnosis. When quantification is performed, the bias becomes an issue especially when comparing brain images with and without EEG monitoring
-
Impact of metal artefacts due to EEG electrodes in brain PET/CT imaging
Energy Technology Data Exchange (ETDEWEB)
Lemmens, Catherine; Nuyts, Johan; Dupont, Patrick [Department of Nuclear Medicine and Medical Imaging Center, University Hospital Gasthuisberg and Katholieke Universiteit Leuven, Leuven (Belgium); Montandon, Marie-Louise; Ratib, Osman; Zaidi, Habib [Division of Nuclear Medicine, Geneva University Hospital, CH-1211 Geneva (Switzerland)], E-mail: catherine.lemmens@uz.kuleuven.be
2008-08-21
The goal of this study is to investigate the impact of electroencephalogram (EEG) electrodes on the visual quality and quantification of {sup 18}F-FDG PET images in neurological PET/CT examinations. For this purpose, the scans of 20 epilepsy patients with EEG monitoring were used. The CT data were reconstructed with filtered backprojection (FBP) and with a metal artefact reduction (MAR) algorithm. Both data sets were used for CT-based attenuation correction (AC) of the PET data. Also, a calculated AC (CALC) technique was considered. A volume of interest (VOI)-based analysis and a voxel-based quantitative analysis were performed to compare the different AC methods. Images were also evaluated visually by two observers. It was shown with simulations and phantom measurements that from the considered AC methods, the MAR-AC can be used as the reference in this setting. The visual assessment of PET images showed local hot spots outside the brain corresponding to the locations of the electrodes when using FBP-AC. In the brain, no abnormalities were observed. The quantitative analysis showed a very good correlation between PET-FBP-AC and PET-MAR-AC, with a statistically significant positive bias in the PET-FBP-AC images of about 5-7% in most brain voxels. There was also good correlation between PET-CALC-AC and PET-MAR-AC, but in the PET-CALC-AC images, regions with both a significant positive and negative bias were observed. EEG electrodes give rise to local hot spots outside the brain and a positive quantification bias in the brain. However, when diagnosis is made by mere visual assessment, the presence of EEG electrodes does not seem to alter the diagnosis. When quantification is performed, the bias becomes an issue especially when comparing brain images with and without EEG monitoring.
-
Wave-function analysis of dynamic cancellation of ac Stark shifts in optical lattice clocks by use of pulsed Raman and electromagnetically-induced-transparency techniques
International Nuclear Information System (INIS)
Yoon, Tai Hyun
2007-01-01
We study analytically the dynamic cancellation of ac Stark shift in the recently proposed pulsed electromagnetically-induced-transparency (EIT-)Raman optical lattice clock based on the wave-function formalism. An explicit expression for the time evolution operator corresponding to the effective two-level interaction Hamiltonian has been obtained in order to explain the atomic phase shift cancellation due to the ac Stark shift induced by the time-separated laser pulses. We present how to determine an optimum value of the common detuning of the driving fields at which the atomic phase shift cancels completely with the parameters for the practical realization of the EIT-Raman optical lattice clock with alkaline-earth-metal atoms
-
Importance of Attenuation Correction (AC) for Small Animal PET Imaging
DEFF Research Database (Denmark)
El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær
2012-01-01
was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...
-
THE ACS NEARBY GALAXY SURVEY TREASURY
International Nuclear Information System (INIS)
Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.
2009-01-01
The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.
-
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
-
Scaling and universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, Jeppe
2000-01-01
Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...
-
Tomato leaf curl Kerala virus (ToLCKeV AC3 protein forms a higher order oligomer and enhances ATPase activity of replication initiator protein (Rep/AC1
Directory of Open Access Journals (Sweden)
Mukherjee Sunil K
2010-06-01
Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.
-
Preliminary study on AC superconducting machines
International Nuclear Information System (INIS)
Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.
1988-01-01
This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed
-
The Corrosion Protection of Metals by Ion Vapor Deposited Aluminum
Science.gov (United States)
Danford, M. D.
1993-01-01
A study of the corrosion protection of substrate metals by ion vapor deposited aluminum (IVD Al) coats has been carried out. Corrosion protection by both anodized and unanodized IVD Al coats has been investigated. Base metals included in the study were 2219-T87 Al, 7075-T6 Al, Titanium-6 Al-4 Vanadium (Ti-6Al-4V), 4130 steel, D6AC steel, and 4340 steel. Results reveal that the anodized IVD Al coats provide excellent corrosion protection, but good protection is also achieved by IVD Al coats that have not been anodized.
-
Approach to Multifunctional Device Platform with Epitaxial Graphene on Transition Metal Oxide (Postprint)
Science.gov (United States)
2015-09-23
layers, respectively. 15. SUBJECT TERMS Heterostructures, two-dimensional materials, van der Waals interaction , 2D graphene, metal oxide (TiO2...sample holder with a 10.6 μ m CO2 IR laser . The laser output power was adjusted until the target temperature was reached. The temperature of the sample... Laser Deposited Transition- Metal Carbides for Field-Emission Cathode Coatings. ACS Appl. Mater. Interfaces 5, 9241–9246 (2013). 13. Swift, G. A
-
21 CFR 880.5500 - AC-powered patient lift.
Science.gov (United States)
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...
-
Cooperative Frequency Control for Autonomous AC Microgrids
DEFF Research Database (Denmark)
Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.
2015-01-01
Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....
-
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
-
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
-
AC power flow importance measures considering multi-element failures
International Nuclear Information System (INIS)
Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling
2017-01-01
Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.
-
Superconducting proximity effect in mesoscopic superconductor/normal-metal junctions
CERN Document Server
Takayanagi, H; Toyoda, E
1999-01-01
The superconducting proximity effect is discussed in mesoscopic superconductor/normal-metal junctions. The newly-developed theory shows long-range phase-coherent effect which explaines early experimental results of giant magnetoresistance oscillations in an Andreev interferometer. The theory also shows that the proximity correction to the conductance (PCC) has a reentrant behavior as a function of energy. The reentrant behavior is systematically studied in a gated superconductor-semiconductor junction. A negative PCC is observed in the case of a weak coupling between the normal metal and the external reservoir. Phase coherent ac effect is also observed when rf is irradiated to the junction.
-
Systémový pohled na klub AC Sparta
OpenAIRE
Čečák, František
2015-01-01
Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...
-
Ac system interruption analysis of an orthogonal-core type dc-ac converter. Koryu keito shadanji no chokko jishinkei dc-ac renkeiyo henkanki no dosa kaiseki
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
-
Aragonite coating solutions (ACS) based on artificial seawater
Science.gov (United States)
Tas, A. Cuneyt
2015-03-01
Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
-
Experimental Study of Structure/Behavior Relationship for a Metallized Explosive
Science.gov (United States)
Bukovsky, Eric; Reeves, Robert; Gash, Alexander; Glumac, Nick
2017-06-01
Metal powders are commonly added to explosive formulations to modify the blast behavior. Although detonation velocity is typically reduced compared to the neat explosive, the metal provides other benefits. Aluminum is a common additive to increase the overall energy output and high-density metals can be useful for enhancing momentum transfer to a target. Typically, metal powder is homogeneously distributed throughout the material; in this study, controlled distributions of metal powder in explosive formulations were investigated. The powder structures were printed using powder bed printing and the porous structures were filled with explosives to create bulk explosive composites. In all cases, the overall ratio between metal and explosive was maintained, but the powder distribution was varied. Samples utilizing uniform distributions to represent typical materials, discrete pockets of metal powder, and controlled, graded powder distributions were created. Detonation experiments were performed to evaluate the influence of metal powder design on the output pressure/time and the overall impulse. This work performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.
-
ac propulsion system for an electric vehicle
Science.gov (United States)
Geppert, S.
1980-01-01
It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.
-
Construction of microscale structures in enclosed microfluidic networks by using a magnetic beads based method.
Science.gov (United States)
Wang, Zhenyu; Zhang, Xiaojuan; Yang, Jun; Yang, Zhong; Wan, Xiaoping; Hu, Ning; Zheng, Xiaolin
2013-08-20
A large number of microscale structures have been used to elaborate flowing control or complex biological and chemical reaction on microfluidic chips. However, it is still inconvenient to fabricate microstructures with different heights (or depths) on the same substrate. These kinds of microstructures can be fabricated by using the photolithography and wet-etching method step by step, but involves time-consuming design and fabrication process, as well as complicated alignment of different masters. In addition, few existing methods can be used to perform fabrication within enclosed microfluidic networks. It is also difficult to change or remove existing microstructures within these networks. In this study, a magnetic-beads-based approach is presented to build microstructures in enclosed microfluidic networks. Electromagnetic field generated by microfabricated conducting wires (coils) is used to manipulate and trap magnetic beads on the bottom surface of a microchannel. These trapped beads are accumulated to form a microscale pile with desired shape, which can adjust liquid flow, dock cells, modify surface, and do some other things as those fabricated microstructures. Once the electromagnetic field is changed, trapped beads may form new shapes or be removed by a liquid flow. Besides being used in microfabrication, this magnetic-beads-based method can be used for novel microfluidic manipulation. It has been validated by forming microscale dam structure for cell docking and modified surface for cell patterning, as well as guiding the growth of neurons. Copyright © 2013 Elsevier B.V. All rights reserved.
-
Systémový pohled na klub AC Sparta
OpenAIRE
Čečák, František
2014-01-01
Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...
-
The system of enclosed optical cavities as a tool for laser photons storing
International Nuclear Information System (INIS)
Androsov, V.P.; Karnaukhov, I.M.; Telegin, Yu.N.
2004-01-01
The calculation of the system consisting of two optical cavities enclosed one into another is performed in the plane-wave approximation. It is shown that under definite conditions one can obtain an enhancement of the electromagnetic field in the internal cavity as compared to the case of direct excitation of the cavity with an electromagnetic wave of the same amplitude. The comparative analysis of these two approaches is carried out. We suppose to apply the proposed system with moderate-reflectivity mirrors (R=0.99) for accumulating laser photons in the optical cavity of the X-ray source LESR-N100 based on Compton scattering of the laser beam on relativistic electrons stored in the ring
-
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string
-
New Approach for Fractioning Metal Compounds Studies in Soils
Science.gov (United States)
Minkina, Tatiana; Motuzova, Galina; Mandzhieva, Saglara; Bauer, Tatiana; Burachevskaya, Marina; Sushkova, Svetlana; Nevidomskaya, Dina; Kalinitchenko, Valeriy
2016-04-01
A combined approach for fractioning metal compounds in soils on the basis of sequential (Tessier, 1979) and parallel extractions (1 N NH4Ac, pH 8; 1% EDTA in NH4Ac; and 1N HCl) is proposed. Metal compounds in sequential and parallel extracts are grouped according to the strength of their bonds with soil components. A given group includes metal compounds with similar strengths of bonds and, hence, with similar migration capacities. The groups of firmly and loosely bound metal compounds can be distinguished. This approach has been used to assess the group composition of Zn, Cu, and Pb compounds in an ordinary chernozem and its changes upon the soil contamination with metals. Contamination of an ordinary chernozem from Rostov oblast with heavy metals caused a disturbance of the natural ratios between the metal compounds. In the natural soil, firmly bound metals predominate (88-95%of the total content), which is mainly caused by the fixation of metals in lattices of silicate minerals (56-83%of the total content). The mobility of the metals in the natural soil is low (5-12%) and is mainly related to metal compounds loosely bound with the soil carbonates. Upon the soil contamination with metals (application rates of 100-300 mg/kg), the content of all the metal compounds increases, but the ratio between them shifts towards a higher portion of the potentially mobile metal compounds (up to 30-40% of the bulk contents of the metals). Organic substances and non-silicate Fe, Al, and Mn minerals become the main carriers of the firmly and loosely bound metals. The strengths of their bonds with Cu, Pb, and Zn differ. Lead in the studied chernozems is mainly fixed in a loosely bound form with organic matter, whereas copper and zinc are fixed both by the organic matter and by the non-silicate Fe, Al, and Mn compounds. Firm fixation of the applied Cu and Pb is mainly ensured by the soil organic matter and non-silicate minerals, whereas firm fixation of Zn is mainly due to non
-
Mapa acústico parcial de Benetusser
OpenAIRE
MORILLA CASTELLANOS, EMILIO
2012-01-01
Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...
-
Six switches solution for single-phase AC/DC/AC converter with capability of second-order power mitigation in DC-link capacitor
DEFF Research Database (Denmark)
Liu, Xiong; Wang, Peng; Loh, Poh Chiang
2011-01-01
This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...
-
Mass of AC Andromedae
International Nuclear Information System (INIS)
King, D.S.; Cox, A.N.; Hodson, S.W.
1975-01-01
Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)
-
ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus
International Nuclear Information System (INIS)
Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi
2007-01-01
orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae
-
AGE DETERMINATION OF SIX INTERMEDIATE-AGE SMALL MAGELLANIC CLOUD STAR CLUSTERS WITH HST/ACS
International Nuclear Information System (INIS)
Glatt, Katharina; Kayser, Andrea; Grebel, Eva K.; Sabbi, Elena; Gallagher, John S. III; Harbeck, Daniel; Nota, Antonella; Sirianni, Marco; Clementini, Gisella; Tosi, Monica; Koch, Andreas; Da Costa, Gary
2008-01-01
We present a photometric analysis of the star clusters Lindsay 1, Kron 3, NGC 339, NGC 416, Lindsay 38, and NGC 419 in the Small Magellanic Cloud (SMC), observed with the Hubble Space Telescope Advanced Camera for Surveys (ACS) in the F555W and F814W filters. Our color-magnitude diagrams (CMDs) extend ∼3.5 mag deeper than the main-sequence turnoff points, deeper than any previous data. Cluster ages were derived using three different isochrone models: Padova, Teramo, and Dartmouth, which are all available in the ACS photometric system. Fitting observed ridgelines for each cluster, we provide a homogeneous and unique set of low-metallicity, single-age fiducial isochrones. The cluster CMDs are best approximated by the Dartmouth isochrones for all clusters, except for NGC 419 where the Padova isochrones provided the best fit. Using Dartmouth isochrones we derive ages of 7.5 ± 0.5 Gyr (Lindsay 1), 6.5 ± 0.5 Gyr (Kron 3), 6 ± 0.5 Gyr (NGC 339), 6 ± 0.5 Gyr (NGC 416), and 6.5 ± 0.5 Gyr (Lindsay 38). The CMD of NGC 419 shows several main-sequence turnoffs, which belong to the cluster and to the SMC field. We thus derive an age range of 1.2-1.6 Gyr for NGC 419. We confirm that the SMC contains several intermediate-age populous star clusters with ages unlike those of the Large Magellanic Cloud and the Milky Way. Interestingly, our intermediate-age star clusters have a metallicity spread of ∼0.6 dex, which demonstrates that the SMC does not have a smooth, monotonic age-metallicity relation. We find an indication for centrally-concentrated blue straggler star candidates in NGC 416, while these are not present for the other clusters. Using the red clump magnitudes, we find that the closest cluster, NGC 419 (∼50 kpc), and the farthest cluster, Lindsay 38 (∼67 kpc), have a relative distance of ∼17 kpc, which confirms the large depth of the SMC. The three oldest SMC clusters (NGC 121, Lindsay 1, and Kron 3) lie in the northwestern part of the SMC, while the youngest
-
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
-
Detection of Genetic Modification 'ac2' in Potato Foodstuffs
Directory of Open Access Journals (Sweden)
Petr Kralik
2009-01-01
Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.
-
Arthroscopically Assisted Reconstruction of Acute Acromioclavicular Joint Dislocations: Anatomic AC Ligament Reconstruction With Protective Internal Bracing—The “AC-RecoBridge” Technique
Science.gov (United States)
Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk
2015-01-01
An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493
-
Drastic Effect of the Peptide Sequence on the Copper-Binding Properties of Tripeptides and the Electrochemical Behaviour of Their Copper(II) Complexes.
Science.gov (United States)
Mena, Silvia; Mirats, Andrea; Caballero, Ana B; Guirado, Gonzalo; Barrios, Leoní A; Teat, Simon J; Rodriguez-Santiago, Luis; Sodupe, Mariona; Gamez, Patrick
2018-04-06
The binding and electrochemical properties of the complexes Cu II -HAH, Cu II -HWH, Cu II -Ac-HWH, Cu II -HHW, and Cu II -WHH have been studied by using NMR and UV/Vis spectroscopies, CV, and density functional calculations. The results obtained highlight the importance of the peptidic sequence on the coordination properties and, consequently, on the redox properties of their Cu II complexes. For Cu II -HAH and Cu II -HWH, no cathodic processes are observed up to -1.2 V; that is, the complexes exhibit very high stability towards copper reduction. This behaviour is associated with the formation of very stable square-planar (5,5,6)-membered chelate rings (ATCUN motif), which enclose two deprotonated amides. In contrast, for non-ATCUN Cu II -Ac-HWH, Cu II -HHW complexes, simulations seem to indicate that only one deprotonated amide is enclosed in the coordination sphere. In these cases, the main electrochemical feature is a reductive irreversible one electron-transfer process from Cu II to Cu I , accompanied with structural changes of the metal coordination sphere and reprotonation of the amide. Finally, for Cu II -WHH, two major species have been detected: one at low pH (10) with an ATCUN motif, both species coexisting at intermediate pH. The present study shows that the use of CV, using glassy carbon as a working electrode, is an ideal and rapid tool for the determination of the redox properties of Cu II metallopeptides. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
-
Ammonia treated Mo/AC catalysts for CO hydrogenation with ...
Indian Academy of Sciences (India)
SHARIF F ZAMAN
the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.
-
Estimation of the Thurstonian model for the 2-AC protocol
DEFF Research Database (Denmark)
Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.
2012-01-01
. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...
-
Effect of metal cation ratio on chemical properties of ZnFe2O4/AC composite and adsorption of organic contaminant
Science.gov (United States)
Meilia, Demara; Misbah Khunur, Mochamad; Setianingsih, Tutik
2018-01-01
Porous woody char is biochar prepared through pyrolisis. The biochar can be used as adsorbent. In this research, ZnFe2O4/AC composite was synthesized through imregnation of the woody biochar with ZnFe2O4 to study effect of mol ratio of Fe(III) and Zn(II) toward their physicochemistry and adsorption of drug wastewater. Paracetamol was used as adsorbate model. This research was conducted in several steps, including activation of the woody biochar using KOH activator at temperatur 500 °C for 15 min to produce the activated carbon, fungsionalization of the carbon using H2SO4 oxidator (6M) at temperature of 80 °C for 3 h, impregnation of the oxidized activated carbon with Zn-Fe-LDH (Layered Double Hydroxide) at various mol ratio of Fe(III) and Zn(III), including 1:2, 1:3 and 1:4 using NaOH solution (5M) for coprecipitation, and calcination of Zn-Fe-LDH/AC at 950 °C for 5 min to produce ZnFe2O4/AC. FTIR diffraction characterization indicated existence of M-O (M = Zn(II), Fe(III)) and OH functional groups. FTIR spectra showed increasing of bands connected to -OH by increasing of the ratio till the ratio was achieved at 1:4, then decreased again. The ratio mol showed effect on the adsorption of paracetamol. Profile of adsorption value was fit with changing of functional groups. The highest adsorption was achieved at the ratio of 1:4. After calcination it gave the adsorption value of 17,66 mg/g.
-
System and method for determining stator winding resistance in an AC motor
Science.gov (United States)
Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI
2011-05-31
A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.
-
Coupling of bio-PRB and enclosed in-well aeration system for remediation of nitrobenzene and aniline in groundwater.
Science.gov (United States)
Liu, Na; Ding, Feng; Wang, Liu; Liu, Peng; Yu, Xiaolong; Ye, Kang
2016-05-01
A laboratory-scale bio-permeable reactive barrier (bio-PRB) was constructed and combined with enclosed in-well aeration system to treat nitrobenzene (NB) and aniline (AN) in groundwater. Batch-style experiments were first conducted to evaluate the effectiveness of NB and AN degradation, using suspension (free cells) of degrading consortium and immobilized consortium by a mixture of perlite and peat. The NB and AN were completely degraded in 4 mg L(-1) when the aeration system was applied into the bio-PRB system. The NB and AN were effectively removed when the aeration system was functional in the bio-PRB. The removal efficiency decreased when the aeration system malfunctioned for 20 days, thus indicating that DO was an important factor for the degradation of NB and AN. The regain of NB and AN removal after the malfunction indicates the robustness of degradation consortium. No original organics and new formed by-products were observed in the effluent. The results indicate that NB and AN in groundwater can be completely mineralized in a bio-PRB equipped with enclosed in-well aeration system and filled with perlite and peat attached with degrading consortium.
-
Lamin A/C might be involved in the EMT signalling pathway.
Science.gov (United States)
Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu
2018-07-15
We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.
-
The equivalent doses of indoor radon in some dwellings and enclosed areas in Morocco
International Nuclear Information System (INIS)
Hakam, O.; Choukri, J.; Reyss, L.
2008-01-01
Full text: The principal source of exposure to radiation for public in built-up areas is known to be the inhalation for radon its short-lived daughters.Most of this exposure occurs inside homes,where many hours are spent each day and where the volumic activity of radon is usually higher than outdoors. The compelling effects of radon and its short-lived decay products spread slowly but surely through a wide range of biological problems encountered in such areas as the mortality rates and lung cancer in uranium mines,the results of experimental work with animals, and the discovery of unsually high levels of radon in the living environments of the general population. As a way of prevention, we have measured the volumic activities of indoor radon-222 and we have calculated their effective equivalent dose in some dwellings and enclosed areas in Morocco. The obtained results show that the effective equivalent dose of activities measured indoor dwellings are inferior to the admissible annual limit fixed by ICRP for population, except in two twons situated in regions rich in phosphate deposits where the calculated doses are slightly upper than this limit. The results obtained for enclosed areas are inferior to the admissible annual limit fixed by ICRP for workers, except in the cave of geophysical observatory situated at depth of-12 meters where the obtained value don't present in risk for workers health because workers pass only a few minutes by day in this cave. The risks related to the volumic activities for indoor radon could be avoided by simple precautions such the continuous ventilation
-
Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids
DEFF Research Database (Denmark)
Chiang Loh, Poh; Li, Ding; Kang Chai, Yi
2013-01-01
sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...
-
The effect of the T6 heat treatment on hardness and microstructure of the en AC-AlSi12CuNiMg alloy
Directory of Open Access Journals (Sweden)
J. Pezda
2014-01-01
Full Text Available Presented work discusses research results concerning the effect of the T6 heat treatment process, including soaking of the alloy near the solidus temperature, holding in this temperature and next cooling in cold water (20 oC, as well as exposing to the artificial ageing to check the change in HB hardness and microstructure of the EN AC-AlSi12Cu-NiMg (EN AC-48000 alloy modified with strontium and cast into metal moulds. The temperature range of solutioning and ageing treatments was selected on the basis of crystallization curves recorded with the use of thermal-derivative method. Performed investigations enabled to determine the optimal parameters (temperature and time of solutioning and ageing heat treatments and their effect on the change in alloy’s hardness.
-
The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology
Directory of Open Access Journals (Sweden)
Anja Pahor
2018-01-01
Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.
-
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
-
Nuclear structure of {sup 231}Ac
Energy Technology Data Exchange (ETDEWEB)
Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)
2008-10-15
The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.
-
Statistical time lags in ac discharges
International Nuclear Information System (INIS)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F
2011-01-01
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
-
Statistical time lags in ac discharges
Energy Technology Data Exchange (ETDEWEB)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)
2011-04-06
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
-
Assessing pollution in a Mediterranean lagoon using acid volatile sulfides and estimations of simultaneously extracted metals.
Science.gov (United States)
Zaaboub, Noureddine; Helali, Mohamed Amine; Martins, Maria Virgínia Alves; Ennouri, Rym; Béjaoui, Béchir; da Silva, Eduardo Ferreira; El Bour, Monia; Aleya, Lotfi
2016-11-01
Bizerte Lagoon is a southern Mediterranean semi-enclosed lagoon with a maximum depth of 12 m. After assessing sediment quality, the authors report on the physicochemical characteristics of the lagoon's surface sediment using SEM (simultaneously extracted metals) and AVS (acid volatile sulfides) as proxies. Biogeochemical tools are used to investigate the environmental disturbance at the water-sediment interface by means of SEM and AVS to seek conclusions concerning the study area's pollution status. Results confirm accumulation of trace elements in sediment. The use of the SEM-AVS model with organic matter in sediment (ƒOC) confirms possible bioavailability of accumulated trace elements, especially Zn, in the southern part of the lagoon, with organic matter playing an important role in SEM excess correction to affirm a nontoxic total metal sediment state. Individual trace element toxicity is dependent on the bioavailable fraction of SEM Metal on sediment, as is the influence of lagoon inflow from southern water sources on element bioavailability. Appropriate management strategies are highly recommended to mitigate any potential harmful effects on health from this heavy-metal-based pollution.
-
Sídliště ze starší doby železné v Loděnici u Opavy
Czech Academy of Sciences Publication Activity Database
Juchelka, Jiří
2015-01-01
Roč. 100, č. 1 (2015), s. 97-123 ISSN 0323-0570 Institutional support: RVO:68081758 Keywords : Lusatian culture * Hallstatt Age * Platěnice period * settlement * enclosed village Subject RIV: AC - Archeology, Anthropology, Ethnology
-
Carbon monoxide poisoning and death in a large enclosed ventilated area.
Science.gov (United States)
Huston, Butch; Froloff, Victor; Mills, Kelly; McGee, Michael
2013-11-01
A 55-year-old man with a medical history of tobacco use suddenly collapsed while power washing an empty indoor pool in a hotel. The decedent was transported to the local hospital where he was pronounced. A postmortem examination revealed atherosclerotic heart disease and bilateral pulmonary edema and congestion. A postmortem blood carbon monoxide (CO) level was 27% saturation, and a CO performed on hospital admission blood was 49% saturation. CO poisoning is a common cause of toxicological morbidity and mortality in the United States. The circumstances most often occur in an enclosed environment and may be intentional or unintentional. CO poisoning has been reported in open, well-ventilated spaces, but rarely results in death. A warning label was present on the engine clearly stating the dangers of CO emission. However, there was a false sense of security due to the large size of the pool room and the presence of industrial blowers that were being used for ventilation. © 2013 American Academy of Forensic Sciences.
-
Nuclear reactor installation with outer shell enclosing a primary pressure vessel
International Nuclear Information System (INIS)
1975-01-01
The high temperature nuclear reactor installation described includes a fluid cooled nuclear heat source, a primary pressure vessel containing the heat source, an outer shell enclosing the primary pressure vessel and acting as a secondary means of containment for this vessel against outside projectiles. Multiple auxiliary equipment points are arranged outside the outer shell which comprises a part of a lower wall around the primary pressure vessel, an annular part integrated in the lower wall and extending outwards as from this wall and an upper part integrated in the annular part and extending above this annular part and above the primary pressure vessel. The annular part and the primary pressure vessel are formed with vertical penetrations which can be closed communicating respectively with the auxiliary equipment points and with inside the pressure vessel whilst handling gear is provided in the upper part for vertically raising reactor components through these penetrations and for transporting them over the annular part and over the primary pressure vessel [fr
-
Study on AC loss measurements of HTS power cable for standardizing
Science.gov (United States)
Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi
2017-09-01
High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..
-
a.c. conductance study of polycrystal C60
International Nuclear Information System (INIS)
Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin
1995-01-01
The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))
-
The relevance of accounting information enclosed in performance indicators
Directory of Open Access Journals (Sweden)
Mihaela-Cristina Onica
2012-12-01
Full Text Available This research study is analyzing the relevance of accounting information reflected through the elaboration of firm performance variables and administration because of the necessity of performance to be administrated. The subject of the theme is enclosed in current development of accounting norms at national , european, (Directives and international levels (IAS/IFRS. The analyised topic is based upon the capabilty of accounting to generate information , throug synthesis calculus being settled the nature , the characteristics and the informational valences of financial performance of an organization. The accounting infromation is base for performing the decison process. The rol of accounting in insurring the relevance and comparability of information increased significantly, being already indispensable. A real solution for communication misunderstanig elimination emerged, as result of diputes in perception and interpretation of economic information, as results for the national speciffic norms.The economic communication is demanding for firm not only in its expression but in thinking and in the process of method conceptualization of organization and administration. A detailed financial situation analysis, which are employing annual financial analysis procedures, underling the performance and risks influencing factors, are considering one starting point for addressing the issue. The introduced variables are insuring a whole vision of firm activity and an appropriate strategy for results significance.
-
Vapor phase carbonylation of dimethyl ether and methyl acetate with supported transition metal catalysts
International Nuclear Information System (INIS)
Shikada, T.; Fujimoto, K.; Tominaga, H.O.
1986-01-01
The synthesis of acetic acid (AcOH) from methanol (MeOH) and carbon monoxide has been performed industrially in the liquid phase using a rhodium complex catalyst and an iodide promoter. The selectivity to AcOH is more than 99% under mild conditions (175 0 C, 28 atm). The homogeneous rhodium catalyst has been also effective for the synthesis of acetic anhydride (Ac 2 O) by carbonylation of dimethyl ether (DME) or methyl acetate (AcOMe). However, rhodium is one of the most expensive metals and its proved reserves are quite limited. It is highly desired, therefore, to develop a new catalyst as a substitute for rhodium. The authors have already reported that nickel supported on active carbon exhibits an excellent activity for the vapor phase carbonylation of MeOh in the presence of iodide promoter and under moderately pressurized conditions. In addition, corrosive attack on reactors by iodide compounds is expected to be negligible in the vapor phase system. In the present work, vapor phase carbonylation of DME and AcOMe on nickel-active carbon (Ni/A.C.) and molybdenum-active carbon (Mo/A.C.) catalysts was studied
-
Control of Power Converters in AC Microgrids
DEFF Research Database (Denmark)
Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede
2012-01-01
The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...
-
Droop-free Distributed Control for AC Microgrids
DEFF Research Database (Denmark)
Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.
2016-01-01
A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...
-
Effect of AC electric fields on the stabilization of premixed bunsen flames
KAUST Repository
Kim, Minkuk
2011-01-01
The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.
-
Power generation using an activated carbon and metal mesh cathode in a microbial fuel cell
KAUST Repository
Zhang, Fang
2009-11-01
An inexpensive activated carbon (AC) air cathode was developed as an alternative to a platinum-catalyzed electrode for oxygen reduction in a microbial fuel cell (MFC). AC was cold-pressed with a polytetrafluoroethylene (PTFE) binder to form the cathode around a Ni mesh current collector. This cathode construction avoided the need for carbon cloth or a metal catalyst, and produced a cathode with high activity for oxygen reduction at typical MFC current densities. Tests with the AC cathode produced a maximum power density of 1220 mW/m2 (normalized to cathode projected surface area; 36 W/m3 based on liquid volume) compared to 1060 mW/m2 obtained by Pt catalyzed carbon cloth cathode. The Coulombic efficiency ranged from 15% to 55%. These findings show that AC is a cost-effective material for achieving useful rates of oxygen reduction in air cathode MFCs. © 2009 Elsevier B.V. All rights reserved.
-
The stability of DOTA-chelated radiopharmaceuticals within 225Ac decay pathway studied with density functional theory.
Science.gov (United States)
Karolak, Aleksandra; Khabibullin, Artem; Budzevich, Mikalai; Martinez, M.; Doliganski, Michael; McLaughlin, Mark; Woods, Lilia; Morse, David
Ligand structures encapsulating metal ions play a central role as contrast agents in Magnetic Resonance Imaging (MRI) or as agents delivering toxic cargo directly to tumor cells in targeted cancer therapy. The structural stability and interaction with solutions of such complexes are the key elements in understanding the foundation of delivery process. We present a comparative study for the 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA) chelated to radioactive isotopes of 225Ac, 221Fr, 217At, 213Bi and a control 68Gd. Using density functional theory methods we investigate the structural stability of complexes for cancer therapy including binding energies, charge transfer, electron densities. The van der Waals interactions are included in the simulations to take into account weak dispersion forces present in such structures. Our results reveal that Ac-DOTA, Bi-DOTA and Gd-DOTA are the most stable complexes in the group. We also show that the water environment is a key ingredient for the structural coordination of the DOTA structures. Support from the US Department of Energy under Grant No. DE-FG02-06ER46297 is acknowledged.
-
Assembling a supercapacitor electrode with dual metal oxides and activated carbon using a liquid phase plasma.
Science.gov (United States)
Ki, Seo Jin; Jeon, Ki-Joon; Park, Young-Kwon; Park, Hyunwoong; Jeong, Sangmin; Lee, Heon; Jung, Sang-Chul
2017-12-01
Developing supercapacitor electrodes at an affordable cost while improving their energy and/or power density values is still a challenging task. This study introduced a recipe which assembled a novel electrode composite using a liquid phase plasma that was applied to a reactant solution containing an activated carbon (AC) powder with dual metal precursors of iron and manganese. A comparison was made between the composites doped with single and dual metal components as well as among those synthesized under different precursor concentrations and plasma durations. The results showed that increasing the precursor concentration and plasma duration raised the content of both metal oxides in the composites, whereas the deposition conditions were more favorable to iron oxide than manganese oxide, due to its higher standard potential. The composite treated with the longest plasma duration and highest manganese concentration was superior to the others in terms of cyclic stability and equivalent series resistance. In addition, the new composite selected out of them showed better electrochemical performance than the raw AC material only and even two types of single metal-based composites, owing largely to the synergistic effect of the two metal oxides. Therefore, the proposed methodology can be used to modify existing and future composite electrodes to improve their performance with relatively cheap host and guest materials. Copyright © 2017 Elsevier Ltd. All rights reserved.
-
Objectives and status of development of AC600
International Nuclear Information System (INIS)
Zhao Chengkun
1997-01-01
AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600
-
Introduction of hvdc transmission into a predominantly ac network
Energy Technology Data Exchange (ETDEWEB)
Casson, W; Last, F H; Huddart, K W
1966-02-01
Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.
-
21 CFR 880.5510 - Non-AC-powered patient lift.
Science.gov (United States)
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...
-
Effect of temperature on the AC impedance of protein
Indian Academy of Sciences (India)
The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...
-
Air pollutant dispersion from a large semi-enclosed stadium in an urban area: high-resolution CFD modeling versus full-scale measurements
NARCIS (Netherlands)
Hooff, van T.A.J.; Blocken, B.J.E.; Seppelt, R.; Voinov, A.A.; Lange, S.; Bankamp, D.
2012-01-01
Abstract: High-resolution CFD simulations and full-scale measurements have been performed to assess the dispersion of air pollutants (CO2) from the large semi-enclosed Amsterdam ArenA football stadium. The dispersion process is driven by natural ventilation by the urban wind flow and by buoyancy,
-
Elastic moduli and elastic anisotropy of cold sprayed metallic coatings
Czech Academy of Sciences Publication Activity Database
Seiner, Hanuš; Cizek, J.; Sedlák, Petr; Huang, R.; Cupera, J.; Dlouhý, I.; Landa, Michal
2016-01-01
Roč. 291, April (2016), s. 342-347 ISSN 0257-8972 R&D Projects: GA ČR GA13-13616S; GA ČR(CZ) GA13-35890S Grant - others:NETME Centre Plus - národní program udržitelnosti(CZ) LO1202 Institutional support: RVO:61388998 Keywords : kinetic spray * CGDS * elastic properties * metals and alloys * deposition * resonant ultrasound spectroscopy Subject RIV: JG - Metallurgy Impact factor: 2.589, year: 2016 http://ac.els-cdn.com/S0257897216301165/1-s2.0-S0257897216301165-main.pdf?_tid=1083617a-017f-11e6-92e7-00000aacb361&acdnat=1460555773_2e80d3df20843f3af649bf3ac71c8844
-
Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome
Directory of Open Access Journals (Sweden)
Vinod Kumar Singh
2016-09-01
Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.
-
Steam Gasification of Sawdust Biochar Influenced by Chemical Speciation of Alkali and Alkaline Earth Metallic Species
Directory of Open Access Journals (Sweden)
Dongdong Feng
2018-01-01
Full Text Available The effect of chemical speciation (H2O/NH4Ac/HCl-soluble and insoluble of alkali and alkaline earth metallic species on the steam gasification of sawdust biochar was investigated in a lab-scale, fixed-bed reactor, with the method of chemical fractionation analysis. The changes in biochar structures and the evolution of biochar reactivity are discussed, with a focus on the contributions of the chemical speciation of alkali and alkaline earth metallic species (AAEMs on the steam gasification of biochar. The results indicate that H2O/NH4Ac/HCl-soluble AAEMs have a significant effect on biochar gasification rates. The release of K occurs mainly in the form of inorganic salts and hydrated ions, while that of Ca occurs mainly as organic ones. The sp3-rich or sp2-sp3 structures and different chemical-speciation AAEMs function together as the preferred active sites during steam gasification. H2O/HCl-soluble AAEMs could promote the transformation of biochar surface functional groups, from ether/alkene C-O-C to carboxylate COO− in biochar, while they may both be improved by NH4Ac-soluble AAEMs. H2O-soluble AAEMs play a crucial catalytic role in biochar reactivity. The effect of NH4Ac-soluble AAEMs is mainly concentrated in the high-conversion stage (biochar conversion >30%, while that of HCl-soluble AAEMs is reflected in the whole activity-testing stage.
-
Heavy metal contaminant remediation study of western Xiamen Bay sediment, China: laboratory bench scale testing results.
Science.gov (United States)
Zhang, Luoping; Feng, Huan; Li, Xiaoxia; Ye, Xin; Jing, Youhai; Ouyang, Tong; Yu, Xingtian; Liang, Rongyuan; Chen, Weiqi
2009-12-15
A surface sediment sample (metal removal, whereas agitation, aeration and rotation of the samples in chemical complexation solutions yield much better metal removal efficiency (up to 90%). A low pH condition (e.g., pHliquid ratio (e.g., S:L=1:50) could increase metal removal efficiency. The experimental results suggest that 0.20 M (NH4)2C2O4+0.025 M EDTA combination with solid:liquid ratio=1:50 and 0.50 M ammonium acetate (NH4Ac)+0.025 M EDTA combination with solid:liquid ratio=1:50 are the most effective methods for metal removal from the contaminated sediments. This research provides additional useful information for sediment metal remediation technology development.
-
Extending the robustness and efficiency of artificial compressibility for partitioned fluid-structure interactions
CSIR Research Space (South Africa)
Bogaers, Alfred EJ
2015-01-01
Full Text Available In this paper we introduce the idea of combining artificial compressibility (AC) with quasi-Newton (QN) methods to solve strongly coupled, fully/quasi-enclosed fluid-structure interaction (FSI) problems. Partitioned, incompressible, FSI based...
-
Effect of the valence electron concentration on the bulk modulus and chemical bonding in Ta2AC and Zr2AC (A=Al, Si, and P)
International Nuclear Information System (INIS)
Schneider, Jochen M.; Music, Denis; Sun Zhimei
2005-01-01
We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion
-
Low ac loss geometries in YBCO coated conductors and impact on conductor stability
Energy Technology Data Exchange (ETDEWEB)
Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.
-
Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven
International Nuclear Information System (INIS)
Smedley, K.
1992-04-01
The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab
-
Flame spread over inclined electrical wires with AC electric fields
KAUST Repository
Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho
2017-01-01
Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field
-
DC and AC biasing of a transition edge sensor microcalorimeter
International Nuclear Information System (INIS)
Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.
2002-01-01
We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions
-
Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2016-06-01
Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.
-
Aragonite coating solutions (ACS) based on artificial seawater
International Nuclear Information System (INIS)
Tas, A. Cuneyt
2015-01-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry
-
Aragonite coating solutions (ACS) based on artificial seawater
Energy Technology Data Exchange (ETDEWEB)
Tas, A. Cuneyt, E-mail: c_tas@hotmail.com
2015-03-01
Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
-
The Metal-Enriched Environments of Galaxies Near Reionization
Science.gov (United States)
Becker, George
2016-10-01
The relationship between galaxies and extended metal-enriched gas offers a powerful diagnostic of the feedback processes that shape galaxy growth. Over 0 6; to date, however, little work on the galaxy-absorber connection at these redshifts has been done due to the high cost of identifying the galaxies. To overcome this obstacle, we propose to obtain deep ACS and WFC3 imaging-building on archival data-in the field of a single z=7 quasar whose spectrum contains an unusually high number of intervening absorbers over 5.5 systems systems simultaneously, offering a high multiplexing advantage for follow-up spectroscopy. The extent to which z 6 galaxies are (or are not) associated with these metal lines, and the relationship between absorber and galaxy properties will deliver much needed insights into the mechanisms that drive galaxy growth and metal enrichment during the reionization epoch.
-
Abscisic Acid Antagonizes Ethylene Production through the ABI4-Mediated Transcriptional Repression of ACS4 and ACS8 in Arabidopsis.
Science.gov (United States)
Dong, Zhijun; Yu, Yanwen; Li, Shenghui; Wang, Juan; Tang, Saijun; Huang, Rongfeng
2016-01-04
Increasing evidence has revealed that abscisic acid (ABA) negatively modulates ethylene biosynthesis, although the underlying mechanism remains unclear. To identify the factors involved, we conducted a screen for ABA-insensitive mutants with altered ethylene production in Arabidopsis. A dominant allele of ABI4, abi4-152, which produces a putative protein with a 16-amino-acid truncation at the C-terminus of ABI4, reduces ethylene production. By contrast, two recessive knockout alleles of ABI4, abi4-102 and abi4-103, result in increased ethylene evolution, indicating that ABI4 negatively regulates ethylene production. Further analyses showed that expression of the ethylene biosynthesis genes ACS4, ACS8, and ACO2 was significantly decreased in abi4-152 but increased in the knockout mutants, with partial dependence on ABA. Chromatin immunoprecipitation-quantitative PCR assays showed that ABI4 directly binds the promoters of these ethylene biosynthesis genes and that ABA enhances this interaction. A fusion protein containing the truncated ABI4-152 peptide accumulated to higher levels than its full-length counterpart in transgenic plants, suggesting that ABI4 is destabilized by its C terminus. Therefore, our results demonstrate that ABA negatively regulates ethylene production through ABI4-mediated transcriptional repression of the ethylene biosynthesis genes ACS4 and ACS8 in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.
-
Sequential extraction of uranium metal contamination
International Nuclear Information System (INIS)
Murry, M.M.; Spitz, H.B.; Connick, W.B.
2016-01-01
Samples of uranium contaminated dirt collected from the dirt floor of an abandoned metal rolling mill were analyzed for uranium using a sequential extraction protocol involving a series of five increasingly aggressive solvents. The quantity of uranium extracted from the contaminated dirt by each reagent can aid in predicting the fate and transport of the uranium contamination in the environment. Uranium was separated from each fraction using anion exchange, electrodeposition and analyzed by alpha spectroscopy analysis. Results demonstrate that approximately 77 % of the uranium was extracted using NH 4 Ac in 25 % acetic acid. (author)
-
The Cryogenic Anti-Coincidence detector for ATHENA X-IFU: pulse analysis of the AC-S7 single pixel prototype
Science.gov (United States)
D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.
2016-07-01
The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC particle rejection efficiency.
-
Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies
Science.gov (United States)
Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.
2016-11-01
We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.
-
Sodium-Metal-Halide Battery Energy Storage for DoD Installations
Science.gov (United States)
2017-10-24
electrical equipment for AC interface PDE Pacific Data Electric V&F Voltage and Frequency, power quality measurements VA Volt-Amp, units for apparent...Metal-Halide technology could operate at extreme ambient temperatures, but the early prototypes did struggle with managing sand ingress. The...peak power Not tested 3. PV smoothing Measure improvement in power quality Power meter measurements Power quality improvements 15-min
-
Development of low AC loss windings for superconducting traction transformer
International Nuclear Information System (INIS)
Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K
2010-01-01
We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.
-
Hybrid AC-High Voltage DC Grid Stability and Controls
Science.gov (United States)
Yu, Jicheng
The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient
-
AC Calorimetric Design for Dynamic of Biological Materials
OpenAIRE
Shigeo Imaizumi
2006-01-01
We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...
-
Study of dielectric relaxation and AC conductivity of InP:S single crystal
Science.gov (United States)
El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.
2012-07-01
The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.
-
Self-field AC losses in Bi-2223 superconducting tapes
International Nuclear Information System (INIS)
Mueller, K. H.; Leslie, K.E.
1996-01-01
Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed
-
AC susceptibility of thin Pb films in intermediate and mixed state
Energy Technology Data Exchange (ETDEWEB)
Janu, Zdenek, E-mail: janu@fzu.cz [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Svindrych, Zdenek [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Trunecek, Otakar [Charles University in Prague, Faculty of Mathematics and Physics, Ke Karlovu 3, CZ-121 16 Prague 2 (Czech Republic); Kus, Peter; Plecenik, Andrej [Komenius University in Bratislava, Faculty of Mathematics, Physics, and Informatics, Mlynska dolina, 842 48 Bratislava 4 (Slovakia)
2011-12-15
Thickness dependent transition in AC susceptibility between intermediate and mixed state in type-I superconducting films. The temperature induced crossover between reversible and irreversible behavior was observed in the thicker film. The temperature dependence of the AC susceptibility in mixed state follows prediction of model based on Bean critical state. The temperature dependence of the harmonics of the complex AC susceptibility in the intermediate state is explained. Thin films of type I superconductors of a thickness comparable or less than a flux penetration length behave like type II superconductors in a mixed state. With decreasing film thickness normal domains carrying a magnetic flux get smaller with smaller number of flux quanta per domain and finally transform into single quantum flux lines, i.e. quantum vortices similar to those found in type II superconductors. We give an evidence of this behavior from the measurements of the nonlinear response of a total magnetic moment to an applied AC magnetic field, directly from the temperature dependence of an AC susceptibility.
-
Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field
Science.gov (United States)
Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.
2010-11-01
AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.
-
Activity of aminotransferases in organs of rats during hypoxia of enclosed space of the action of thiamine bromide
Directory of Open Access Journals (Sweden)
Сніжана Сергіївна Чернадчук
2015-05-01
Full Text Available It is studied an aminotransferase activity during injection of thiamin bromide in rat tissues in normal and hypoxic enclosed space. After injection of thiamine bromide we have set reduction of AST and ALT activity, relative to control, except by the brain tissue, where there was an increase of investigated indicators. The decrease of activity of the investigated elements is occurred in animals which before hypoxia were injection of thiamine bromide
-
Flexible AC transmission systems: the state of the art
Energy Technology Data Exchange (ETDEWEB)
Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division
1994-12-31
Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.
-
Operation of AC Adapters Visualized Using Light-Emitting Diodes
Science.gov (United States)
Regester, Jeffrey
2016-01-01
A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…
-
A.C. losses in current-carrying superconductors
International Nuclear Information System (INIS)
Reuver, J.L. de.
1985-01-01
The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)
-
Logistics Reduction: Advanced Clothing System (ACS)
Data.gov (United States)
National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...
-
Early function of the Abutilon mosaic virus AC2 gene as a replication brake.
Science.gov (United States)
Krenz, Björn; Deuschle, Kathrin; Deigner, Tobias; Unseld, Sigrid; Kepp, Gabi; Wege, Christina; Kleinow, Tatjana; Jeske, Holger
2015-04-01
The C2/AC2 genes of monopartite/bipartite geminiviruses of the genera Begomovirus and Curtovirus encode important pathogenicity factors with multiple functions described so far. A novel function of Abutilon mosaic virus (AbMV) AC2 as a replication brake is described, utilizing transgenic plants with dimeric inserts of DNA B or with a reporter construct to express green fluorescent protein (GFP). Their replicational release upon AbMV superinfection or the individual and combined expression of epitope-tagged AbMV AC1, AC2, and AC3 was studied. In addition, the effects were compared in the presence and in the absence of an unrelated tombusvirus suppressor of silencing (P19). The results show that AC2 suppresses replication reproducibly in all assays and that AC3 counteracts this effect. Examination of the topoisomer distribution of supercoiled DNA, which indicates changes in the viral minichromosome structure, did not support any influence of AC2 on transcriptional gene silencing and DNA methylation. The geminiviral AC2 protein has been detected here for the first time in plants. The experiments revealed an extremely low level of AC2, which was slightly increased if constructs with an intron and a hemagglutinin (HA) tag in addition to P19 expression were used. AbMV AC2 properties are discussed with reference to those of other geminiviruses with respect to charge, modification, and size in order to delimit possible reasons for the different behaviors. The (A)C2 genes encode a key pathogenicity factor of begomoviruses and curtoviruses in the plant virus family Geminiviridae. This factor has been implicated in the resistance breaking observed in agricultural cotton production. AC2 is a multifunctional protein involved in transcriptional control, gene silencing, and regulation of basal biosynthesis. Here, a new function of Abutilon mosaic virus AC2 in replication control is added as a feature of this protein in viral multiplication, providing a novel finding on
-
Monolithic blue LED series arrays for high-voltage AC operation
Energy Technology Data Exchange (ETDEWEB)
Ao, Jin-Ping [Satellite Venture Business Laboratory, University of Tokushima, Tokushima 770-8506 (Japan); Sato, Hisao; Mizobuchi, Takashi; Morioka, Kenji; Kawano, Shunsuke; Muramoto, Yoshihiko; Sato, Daisuke; Sakai, Shiro [Nitride Semiconductor Co. Ltd., Naruto, Tokushima 771-0360 (Japan); Lee, Young-Bae; Ohno, Yasuo [Department of Electrical and Electronic Engineering, University of Tokushima, Tokushima 770-8506 (Japan)
2002-12-16
Design and fabrication of monolithic blue LED series arrays that can be operated under high ac voltage are described. Several LEDs, such as 3, 7, and 20, are connected in series and in parallel to meet ac operation. The chip size of a single device is 150 {mu}m x 120 {mu}m and the total size is 1.1 mm x 1 mm for a 40(20+20) LED array. Deep dry etching was performed as device isolation. Two-layer interconnection and air bridge are utilized to connect the devices in an array. The monolithic series array exhibit the expected operation function under dc and ac bias. The output power and forward voltage are almost proportional to LED numbers connected in series. On-wafer measurement shows that the output power is 40 mW for 40(20+20) LED array under ac 72 V. (Abstract Copyright [2002], Wiley Periodicals, Inc.)
-
pH sensing via bicarbonate-regulated ‘soluble’ adenylyl cyclase (sAC
Directory of Open Access Journals (Sweden)
Nawreen eRahman
2013-11-01
Full Text Available Soluble adenylyl cyclase (sAC is a source of the second messenger cyclic adenosine 3',5' monophosphate (cAMP. sAC is directly regulated by bicarbonate (HCO3- ions. In living cells, HCO3- ions are in nearly instantaneous equilibrium with carbon dioxide (CO2 and pH due to the ubiquitous presence of carbonic anhydrases. Numerous biological processes are regulated by CO2, HCO3-, and/or pH, and in a number of these, sAC has been shown to function as a physiological CO2/HCO3/pH sensor. In this review, we detail the known pH sensing functions of sAC, and we discuss two highly-studied, pH-dependent pathways in which sAC might play a role.
-
Transfer functions of laminar premixed flames subjected to forcing by acoustic waves, AC electric fields, and non-thermal plasma discharges
KAUST Repository
Lacoste, Deanna
2016-06-23
The responses of laminar methane-air flames to forcing by acoustic waves, AC electric fields, and nanosecond repetitively pulsed (NRP) glow discharges are reported here. The experimental setup consists of an axisymmetric burner with a nozzle made from a quartz tube. Three different flame geometries have been studied: conical, M-shaped and V-shaped flames. A central stainless steel rod is used as a cathode for the electric field and plasma excitations. The acoustic forcing is obtained with a loudspeaker located at the bottom part of the burner. For forcing by AC electric fields, a metallic grid is placed above the rod and connected to an AC power supply. Plasma forcing is obtained by applying high-voltage pulses of 10-ns duration applied at 10 kHz, between the rod and an annular stainless steel ring, placed at the outlet of the quartz tube. The chemiluminescence of CH is used to determine the heat release rate fluctuations. For forcing by acoustic waves and plasma, the geometry of the flame plays a key role in the response of the combustion, while the flame shape does not affect the response of the combustion to electric field forcing. The flame response to acoustic forcing of about 10% of the incoming flow is similar to those obtained in the literature. The flames are found to be responsive to an AC electric field across the whole range of frequencies studied. A forcing mechanism, based on the generation of ionic wind, is proposed. The gain of the transfer function obtained for plasma forcing is found to be up to 5 times higher than for acoustic forcing. A possible mechanism of plasma forcing is introduced.
-
Transfer functions of laminar premixed flames subjected to forcing by acoustic waves, AC electric fields, and non-thermal plasma discharges
KAUST Repository
Lacoste, Deanna; Xiong, Yuan; Moeck, Jonas P.; Chung, Suk-Ho; Roberts, William L.; Cha, Min
2016-01-01
The responses of laminar methane-air flames to forcing by acoustic waves, AC electric fields, and nanosecond repetitively pulsed (NRP) glow discharges are reported here. The experimental setup consists of an axisymmetric burner with a nozzle made from a quartz tube. Three different flame geometries have been studied: conical, M-shaped and V-shaped flames. A central stainless steel rod is used as a cathode for the electric field and plasma excitations. The acoustic forcing is obtained with a loudspeaker located at the bottom part of the burner. For forcing by AC electric fields, a metallic grid is placed above the rod and connected to an AC power supply. Plasma forcing is obtained by applying high-voltage pulses of 10-ns duration applied at 10 kHz, between the rod and an annular stainless steel ring, placed at the outlet of the quartz tube. The chemiluminescence of CH is used to determine the heat release rate fluctuations. For forcing by acoustic waves and plasma, the geometry of the flame plays a key role in the response of the combustion, while the flame shape does not affect the response of the combustion to electric field forcing. The flame response to acoustic forcing of about 10% of the incoming flow is similar to those obtained in the literature. The flames are found to be responsive to an AC electric field across the whole range of frequencies studied. A forcing mechanism, based on the generation of ionic wind, is proposed. The gain of the transfer function obtained for plasma forcing is found to be up to 5 times higher than for acoustic forcing. A possible mechanism of plasma forcing is introduced.
-
Normal form of particle motion under the influence of an ac dipole
Directory of Open Access Journals (Sweden)
R. Tomás
2002-05-01
Full Text Available ac dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the ac dipole is adiabatically turned on and off. Therefore the ac dipole seems to be an adequate tool for nonlinear diagnostics provided the particle motion is well described in the presence of the ac dipole and nonlinearities. Normal forms and Lie algebra are powerful tools to study the nonlinear content of an accelerator lattice. In this article a way to obtain the normal form of the Hamiltonian of an accelerator with an ac dipole is described. The particle motion to first order in the nonlinearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the ac dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn motion and the Hamiltonian terms.
-
Improved transistorized AC motor controller for battery powered urban electric passenger vehicles
Science.gov (United States)
Peak, S. C.
1982-01-01
An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.
-
Analysis of Input and Output Ripples of PWM AC Choppers
Directory of Open Access Journals (Sweden)
Pekik Argo Dahono
2008-11-01
Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.
-
Cosmic shear analysis of archival HST/ACS data. I. Comparison of early ACS pure parallel data to the HST/GEMS survey
Science.gov (United States)
Schrabback, T.; Erben, T.; Simon, P.; Miralles, J.-M.; Schneider, P.; Heymans, C.; Eifler, T.; Fosbury, R. A. E.; Freudling, W.; Hetterscheidt, M.; Hildebrandt, H.; Pirzkal, N.
2007-06-01
Context: This is the first paper of a series describing our measurement of weak lensing by large-scale structure, also termed “cosmic shear”, using archival observations from the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope (HST). Aims: In this work we present results from a pilot study testing the capabilities of the ACS for cosmic shear measurements with early parallel observations and presenting a re-analysis of HST/ACS data from the GEMS survey and the GOODS observations of the Chandra Deep Field South (CDFS). Methods: We describe the data reduction and, in particular, a new correction scheme for the time-dependent ACS point-spread-function (PSF) based on observations of stellar fields. This is currently the only technique which takes the full time variation of the PSF between individual ACS exposures into account. We estimate that our PSF correction scheme reduces the systematic contribution to the shear correlation functions due to PSF distortions to MUSIC sample, we determine a local single field estimate for the mass power spectrum normalisation σ8, CDFS=0.52+0.11-0.15 (stat) ± 0.07(sys) (68% confidence assuming Gaussian cosmic variance) at a fixed matter density Ω_m=0.3 for a ΛCDM cosmology marginalising over the uncertainty of the Hubble parameter and the redshift distribution. We interpret this exceptionally low estimate to be due to a local under-density of the foreground structures in the CDFS. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archives at the Space Telescope European Coordinating Facility and the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.
-
Can multiple fish farms be integrated within a semi-enclosed bay without causing acute ecosystem degradation?
Directory of Open Access Journals (Sweden)
Kristian Puhr
2017-07-01
Full Text Available The current study explores the possibility that multiple fish farms (FFs containing sea bass (Dicentrarchus labrax and sea bream (Sparus aurata can be successfully integrated within a semi-enclosed bay in the Croatian Adriatic. The research focuses on determining principal environmental factors (EFs that control the integration and attempts to estimate their individual and synergic ability to influence deposition and removal of organic matter (OM and trace elements (TE from the system. The complexity of the designated tasks demanded a comprehensive number of various datasets and samples to be used in the analysis. The ADCP data revealed strong wind induced currents forming within the research domain resulting in high system flushing efficiency (3.5–6 days. The sediment samples from all stations contained relatively inert minerals which contributed to overall low OM and TE concentrations and very limited variability found across the entire bathymetric range. The thermal advection effect recorded at two stations was attributed to specific seabed topography and the hydrodynamic response formed during Maestral wind episodes. The results indicate that a successful integration of four FFs has taken place within the research site (semi enclosed bay, and that the key EFs responsible for its success are strong wind induced hydrodynamics, favorable seabed topography and sediment mineral composition. The synergy of the principal EFs that formed within the system was found to have an attenuating effect regarding FFs chemical influence (OM and TE and an amplifying one regarding spatial footprint which extended to ≈2000 m distance.
-
Pantallas acústicas submarinas de material compuesto multilaminar con matriz metálica
OpenAIRE
Gallego, V.; Laguna, M.; Vázquez, A. J.
1999-01-01
7 pp.-- PACS nr.: 43.30.Ky.-- Comunicación presentada en los siguientes congresos: XXX Jornadas Nacionales de Acústica – TecniAcústica 1999. Encuentro Ibérico de Acústica (Ávila, 20-22 Octubre 1999).
-
ac superconducting articles
International Nuclear Information System (INIS)
Meyerhoff, R.W.
1977-01-01
A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface
-
Autonomous Operation of Hybrid Microgrid with AC and DC Sub-Grids
DEFF Research Database (Denmark)
Loh, Poh Chiang; Blaabjerg, Frede
2011-01-01
the power flow among all the sources distributed throughout the two types of sub-grids, which certainly is tougher than previous efforts developed for only either ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc...... sources, ac sources and interlinking converters. Suitable control and normalization schemes are therefore developed for controlling them with results presented for showing the overall performance of the hybrid microgrid.......This paper investigates on the active and reactive power sharing of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac sub-grids, interconnected by power electronic interfaces. The main challenge here is to manage...
-
A Floquet-Green's function approach to mesoscopic transport under ac bias
International Nuclear Information System (INIS)
Wu, B H; Cao, J C
2008-01-01
The current response of a mesoscopic system under a periodic ac bias is investigated by combining the Floquet theorem and the nonequilibrium Green's function method. The band structure of the lead under ac bias is fully taken into account by using appropriate self-energies in an enlarged Floquet space. Both the retarded and lesser Green's functions are obtained in the Floquet basis to account for the interference and interaction effects. In addition to the external ac bias, the time-varying Coulomb interaction, which is treated at the self-consistent Hartree-Fock level, provides another internal ac field. The numerical results show that the time-varying Coulomb field yields decoherence and reduces the ringing behavior of the current response to a harmonic bias
-
An experimental investigation of glare and restructured fiber metal laminates
Science.gov (United States)
Benedict, Adelina Vanessa
Fiber Metal Laminates (FMLs) are a group of materials fabricated by bonding glass/epoxy layers within metal layers. This class of materials can provide good mechanical properties, as well as weight savings. An FML known as Glass Laminate Aluminum Reinforced Epoxy (GLARE) was studied. An experimental investigation comprising of microscopy and tensile testing was carried out using different grades of GLARE. Microscopy revealed the construction details of GLARE, while tensile testing provided means of measuring and analyzing its stress-strain responses. Next, different metal surface pretreatment methods were explored. These included sandblasting, Phosphoric Acid Anodizing (PAA), and AC-130 Sol-Gel treatment. Woven S-2 glass, an epoxy adhesive, and aluminum alloy sheet metal were used to fabricate restructured FMLs using time and cost effective procedures. Additional microscopy and tensile testing allowed for comparisons with GLARE and aircraft grade aluminum alloys. The restructured FMLs showed similar behaviors to GLARE with potential significant improvements in fabrication efficiency.
-
Optimal football strategies: AC Milan versus FC Barcelona
OpenAIRE
Papahristodoulou, Christos
2012-01-01
In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.
-
Preliminary design of reactor coolant pump canned motor for AC600
International Nuclear Information System (INIS)
Deng Shaowen
1998-01-01
The reactor coolant pump canned motor of AC600 PWR is the kind of shielded motors with high moment of inertia, high reliability, high efficiency and nice starting performance. The author briefly presents the main feature, design criterion and technical requirements, preliminary design, computation results and analysis of performance of AC600 reactor coolant pump canned motor, and proposes some problems to be solved for study and design of AC600 reactor coolant pump canned motor
-
Experimental measurements of static pressure and pressure drop in a duct enclosing a seven wire-wrapped rod bundle
International Nuclear Information System (INIS)
Graca, M.C.; Ballve, H.; Fernandez y Fernandez, E.; Carajilescov, P.
1981-01-01
The friction factor and the static pressure distributions, in the axial and transversal directions, in the wall of the hexagonal duct, enclosing a seven wire-wrapped rod bundle, were experimentally measured, using an air opened loop. The Reynolds numbers are the range 10 3 - 5x10 4 . The friction factors are compared to existing correlations. The static pressure distributions show that the static pressure is not hydrostatic in the cross section of the flow. (Author) [pt
-
The Hubble Legacy Archive ACS grism data
Science.gov (United States)
Kümmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.
2011-06-01
A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 μm, with a dispersion of 40 Å/pixel and a resolution of ~80 Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47 919 datasets (65% of the total number of extracted spectra) for 32 149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2 - 4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects
-
Alpha decay 225 Ac → 221Fr
International Nuclear Information System (INIS)
Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.
2004-01-01
Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the
-
Reducing AC-Winding Losses in High-Current High-Power Inductors
DEFF Research Database (Denmark)
Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.
2009-01-01
Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...
-
Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2017-11-01
Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.
-
On-Chip AC self-test controller
Science.gov (United States)
Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY
2009-09-29
A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.
-
Ac-driven vortex-antivortex dynamics in nanostructured superconductor-ferromagnetic hybrids
Energy Technology Data Exchange (ETDEWEB)
Lima, Clessio L.S., E-mail: clsl@df.ufpe.br [Nucleo de Tecnologia, Centro Academico do Agreste, Universidade Federal de Pernambuco, 55002-970 Caruaru-PE (Brazil); Souza Silva, Clecio C. de; Aguiar, J. Albino [Departamento de Fisica, Universidade Federal de Pernambuco, 50670-901 Recife-PE (Brazil)
2012-09-15
The dynamics of ac-driven vortices and antivortices in a superconducting film interacting with an array of magnetic dipoles on top is investigated via hybrid molecular dynamics-Monte Carlo simulations. The dipole array considered in this study is capable to stabilize in equilibrium vortex-antivortex pairs. The appearance of a net electric field out of the ac excitation demonstrates that this system behaves as a voltage rectifier. Because of the asymmetric nature of the effective pinning potential generated by the dipole array, the ac-driven vortices and antivortices are ratcheted in opposite directions, thereby contributing additively to the observed net voltage. In addition, for high frequency values, the dc electric field-ac amplitude curves present a series of steps. A careful analysis of the time series of the electric field and number of vortex-antivortex (v-av) pairs reveals that these steps are related to mode-locking between the drive frequency and the number of v-av creation-annihilation events.
-
The Use of AC-DC-AC Methods in Assessing Corrosion Resistance Performance of Coating Systems for Magnesium Alloys
Science.gov (United States)
McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante
The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.
-
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
Science.gov (United States)
Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.
2008-02-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.
-
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
International Nuclear Information System (INIS)
Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C
2008-01-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability
-
Application of remote source lighting system in different layouts of enclosed lift lobbies in highrise residential building of central core design
Energy Technology Data Exchange (ETDEWEB)
Wong, I.; Yang, H.X. [Hong Kong Polytechnic Univ., Hung Hom, Hong Kong (China). Dept. of Building Services, Renewable Energy Research Group
2010-07-01
This paper reported on a simulation study that explored a new building philosophy that optimizes solar energy to minimize reliance on fossil fuels and to design energy conscious buildings that minimize the energy needed for lighting and cooling. The viability of applying a remote source lighting (RSL) system to transmit daylight into central core lobbies in high-rise residential buildings in Hong Kong was demonstrated. These lobbies are usually enclosed without any windows, thus requiring electric lighting to be switched on 24 hours continuously, consuming non-renewable energy in most cases. In this study, the RSL system was composed of small diameter light pipes and optic fibers. The system transports daylight from the exterior to illuminate the enclosed lobbies. The simulation was conducted to analyze and compare the light transmission efficiency when applying the RSL system to different layouts of the lift lobbies. It was concluded that the efficiency of the RSL system is governed by the length and number of turns in the lobby. 13 refs., 12 figs.
-
AC conductivity for a holographic Weyl semimetal
Energy Technology Data Exchange (ETDEWEB)
Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)
2017-03-23
We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.
-
Adsorption properties of technetium and rhenium for hybrid microcapsules enclosing Toa extractant
Energy Technology Data Exchange (ETDEWEB)
Wu, Y.; Mimura, H.; Niibori, Y. [Tohoku University, Graduate School of Engineering, Department of Quantum Science and Energy Engineering, Aramaki-Aza-Aoba 6-6-01-2, Aoba-ku, Sendai-shi, Miyagi-ken, 980-8579 Japan (Japan); Koyama, S.; Ohnishi, T., E-mail: yanwu@cyric.tohoku.ac.j [Japan Atomic Energy Agency, O-arai Research and Development Center, Fuels and Materials Department, Alpha-Gamma Section, Narita-cho 4002, O-arai-machi, Ibaraki, 311-1393 Japan (Japan)
2010-10-15
Special attention has been given to the separation and recovery of the VII-group elements Tc and Re, in relation to the partitioning of high-level liquid waste (HLLW) generated from the nuclear fuel reprocessing process. In this study, a tertiary amine (tri-n-octylamine Toa), which is effective for the extraction of oxo anions, was encapsulated in a calcium alginate gel polymer (CaALG), and the adsorption behaviours of TcO{sub 4} and ReO{sub 4}{sup -} in the presence of nitric acid and hydrochloric acid were examined by using calcium alginate microcapsules (M Cs) enclosing Toa extractant (Toa-CaALG M Cs). The order of the distribution coefficient K{sub d} for different oxo anions at 0.1 M HNO{sub 3} was ReO{sub 4}{sup -}> WO{sub 4}{sup 2-}> CrO{sub 4}{sup 2-} {approx} MoO{sub 4}{sup 2-}>> SeO{sub 3}{sup 2-}. Toa-CaALG still exhibited high uptake ability for ReO{sub 4}{sup -} even after irradiation with {sup 60}Co {gamma}-rays (dose: 17.6 kGy). Uptake of TcO{sub 4}{sup -} in the presence of 1 M HNO{sub 3} was readily attained within 3 h. Relatively large K{sub d} values above 10{sup 2} cm{sup 3}/g were obtained for Toa-CaALG in the presence of 0.01 {approx} 1 M HNO{sub 3}. All of the TcO{sub 4}{sup -} was successfully adsorbed by Toa-CaALG from the simulated HLLW. The adsorbed TcO{sub 4}{sup -} was then effectively eluted with 5 M or 7 M HNO{sub 3} solution. Further, the selective uptake of ReO{sub 4}{sup -} (a chemical analogue of TcO{sub 4}{sup -}) was confirmed by using actual HLLW (Fbr, Joyo, JAEA), and uptake (%) above 99% was obtained. Toa-CaALG was thus effective for the selective separation and recovery of TcO{sub 4}{sup -} and ReO{sub 4}{sup -} from waste solutions containing highly concentrated HNO{sub 3} and NaNO{sub 3}. Microencapsulation techniques with alginate gel polymer can be applied to other ion exchangers and extractants, and the M Cs immobilizing these adsorbents are effective for the advanced separation of various radionuclides, rare metals and
-
Development of resistance welding process. 4. Preparation of pressuring enclosed creep test specimen of 7A material
International Nuclear Information System (INIS)
Endo, Hideo; Seki, Masayuki; Ishibashi, Fujio; Hirako, Kazuhito; Tsukada, Tatsuya
2001-02-01
Mechanical strength in the position welded by resistance welding system was examined in 1999. The test specimens were destroyed in the welding position in a shorter time than expected in the creep test. Therefore, test specimens were prepared to evaluate the cause of destruction. Inner-pressure enclosed creep test specimens were prepared by resistance welding method. Cladding material with low deviation of thickness and high re-crystallization rate was used. Heat treatment after resistance welding was performed to remove the influence of residual stress and the precipitation of carbides. (1) Before preparation of specimens, the welding condition was fixed. Three test specimens were prepared. Two specimens without heat treatment were transported to MMS in Oarai Engineering Center on Aug. 4, 2000. One specimen with heat treatment was transported to MMS after evaluating the residual stress to get optimum heat treatment condition. (2) Specimens were prepared with welding end plugs to both ends of ferritic ODS cladding. Enclosing sides were welded with highly strong Ferritic/Martensitic steel end plugs. The other sides were welded with ferritic ODS end plugs. (3) Some kinds of electrical wave data were obtained during performing welding. Welding position was evaluated with supersonic detector after performing welding. (4) Mechanical strength of welding position in high temperature 800degC was confirmed to be equal to or larger than that of cladding material. The highly qualified specimens in the present were successfully prepared. (author)
-
Novel synthesis and applications of Thiomer solidification for heavy metals immobilization in hazardous ASR/ISW thermal residue.
Science.gov (United States)
Baek, Jin Woong; Mallampati, Srinivasa Reddy; Park, Hung Suck
2016-03-01
The present paper reports the novel synthesis and application of Thiomer solidification for heavy metal immobilization in hazardous automobile shredder residues and industrial solid waste (ASR/ISW) thermal residues. The word Thiomer is a combination of the prefix of a sulfur-containing compound "Thio" and the suffix of "Polymer" meaning a large molecule compound of many repeated subunits. To immobilize heavy metals, either ASR/ISW thermal residues (including bottom and fly ash) was mixed well with Thiomer and heated at 140°C. After Thiomer solidification, approximately 91-100% heavy metal immobilization was achieved. The morphology and mineral phases of the Thiomer-solidified ASR/ISW thermal residue were characterized by field emission-scanning electron microscopy, energy dispersive X-ray spectroscopy and X-ray diffraction (XRD), which indicated that the amounts of heavy metals detectable on the ASR/ISW thermal residue surface decreased and the sulfur mass percent increased. XRD indicated that the main fraction of the enclosed/bound materials on the ASR/ISW residue contained sulfur associated crystalline complexes. The Thiomer solidified process could convert the heavy metal compounds into highly insoluble metal sulfides and simultaneously encapsulate the ASR/ISW thermal residue. These results show that the proposed method can be applied to the immobilization of ASR/ISW hazardous ash involving heavy metals. Copyright © 2015 Elsevier Ltd. All rights reserved.
-
Comparative single-cell genomics reveals potential ecological niches for the freshwater acI Actinobacteria lineage.
Science.gov (United States)
Ghylin, Trevor W; Garcia, Sarahi L; Moya, Francisco; Oyserman, Ben O; Schwientek, Patrick; Forest, Katrina T; Mutschler, James; Dwulit-Smith, Jeffrey; Chan, Leong-Keat; Martinez-Garcia, Manuel; Sczyrba, Alexander; Stepanauskas, Ramunas; Grossart, Hans-Peter; Woyke, Tanja; Warnecke, Falk; Malmstrom, Rex; Bertilsson, Stefan; McMahon, Katherine D
2014-12-01
Members of the acI lineage of Actinobacteria are the most abundant microorganisms in most freshwater lakes; however, our understanding of the keys to their success and their role in carbon and nutrient cycling in freshwater systems has been hampered by the lack of pure cultures and genomes. We obtained draft genome assemblies from 11 single cells representing three acI tribes (acI-A1, acI-A7, acI-B1) from four temperate lakes in the United States and Europe. Comparative analysis of acI SAGs and other available freshwater bacterial genomes showed that acI has more gene content directed toward carbohydrate acquisition as compared to Polynucleobacter and LD12 Alphaproteobacteria, which seem to specialize more on carboxylic acids. The acI genomes contain actinorhodopsin as well as some genes involved in anaplerotic carbon fixation indicating the capacity to supplement their known heterotrophic lifestyle. Genome-level differences between the acI-A and acI-B clades suggest specialization at the clade level for carbon substrate acquisition. Overall, the acI genomes appear to be highly streamlined versions of Actinobacteria that include some genes allowing it to take advantage of sunlight and N-rich organic compounds such as polyamines, di- and oligopeptides, branched-chain amino acids and cyanophycin. This work significantly expands the known metabolic potential of the cosmopolitan freshwater acI lineage and its ecological and genetic traits.
-
Effect of temperature on the AC impedance of protein and ...
Indian Academy of Sciences (India)
2016-08-26
Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...
-
Study of a Station Blackout Event in the PWR Plant
International Nuclear Information System (INIS)
Ching-Hui Wu; Tsu-Jen Lin; Tsu-Mu Kao
2002-01-01
On March 18, 2001, a PWR nuclear power plant located in the Southern Taiwan occurred a Station Blackout (SBO) event. Monsoon seawater mist caused the instability of offsite power grids. High salt-contained mist caused offsite power supply to the nuclear power plant very unstable, and forced the plant to be shutdown. Around 24 hours later, when both units in the plant were shutdown, several inadequate high cycles of bus transfer between 345 kV and 161 kV startup transformers degraded the emergency 4.16 kV switchgears. Then, in the Train-A switchgear room of Unit 1 occurred a fire explosion, when the degraded switchgear was hot shorted at the in-coming 345 kV breaker. Inadequate configuration arrangement of the offsite power supply to the emergency 4.16 kV switchgears led to loss of offsite power (LOOP) events to both units in the plant. Both emergency diesel generators (EDG) of Unit 1 could not be in service in time, but those of Unit 2 were running well. The SBO event of Unit 1 lasted for about two hours till the fifth EDG (DG-5) was lined-up to the Train-B switchgear. This study investigated the scenario of the SBO event and evaluated a risk profile for the SBO period. Guidelines in the SBO event, suggested by probabilistic risk assessment (PRA) procedures were also reviewed. Many related topics such as the re-configuration of offsite power supply, the addition of isolation breakers of the emergency 4.16 kV switchgears, the betterment of DG-5 lineup design, and enhancement of the reliability of offsite power supply to the PWR plant, etc., will be in further studies. (authors)
-
Calculation of single phase AC and monopolar DC hybrid corona effects
International Nuclear Information System (INIS)
Zhao, T.; Sebo, S.A.; Kasten, D.G.
1996-01-01
Operating a hybrid HVac and HVdc line is an option for increasing the efficiency of power transmission and overcoming the difficulties in obtaining a new right-of-way. This paper proposes a new calculation method for the study of hybrid line corona. The proposed method can be used to calculate dc corona losses and corona currents in dc or ac conductors for single phase ac and monopolar dc hybrid lines. Profiles of electric field strength and ion current density at ground level can be estimated. The effects of the presence of an energized ac conductor on dc conductor corona and dc voltage on ac conductor corona are included in the method. Full-scale and reduced-scale experiments were utilized to investigate the hybrid line corona effects. Verification of the proposed calculation method is given
-
Nondestructive characterization of metal-matrix-composites by ultrasonic technique
International Nuclear Information System (INIS)
Lee, Joon Hyun
1992-01-01
Nondestructive characterizations using ultrasonic technique were conducted systematically on Al 2 O 3 short fiber reinforced pure Al and AC8A aluminium metal-matrix composites. In order to determine the elastic moduli of metal-matrix composites(MMCs), Al 2 O 3 /AC8A composites with volume fraction of Al 2 O 3 short fiber varying up to 30% were fabricated by squeeze casting technique. Pure Al and AC8A reinforced with Al 2 O 3 short fiber were also fabricated by changing the fabrication parameters such as the applied pressure, the volume fraction of fiber. The Influences of texture change associated with change of fabrication parameters were investigated using the sophisticated LFB acoustic microscope with the frequency of 225 MHz. Ultrasonic velocities of longitudinal, shear and Rayleigh waves of the composites were measured by pulse-echo method and line-focus-beam(LBF) acoustic microscope. Ultrasonic velocities of the longitudinal, the shear and Rayleigh waves were found to correlate primarily with the volume fraction of Al 2 O 3 . The elastic constants of composites including Young's Modulus, Shear Modulus, Bulk Modulus and Poisson's ratio were determined on the basis of the longitudinal and the shear wave velocities measured by an ultrasonic pulse-echo method. The Young's Modulus of the composites obtained by ultrasonic technique were slightly lower than those measured by 4-point-bend test and also showed relatively good agreements with the calculated results derived from the equal stress condition. The applicability of LFB acoustic microscope on material characterization of the MMCs was discussed on the basis of the relationships between Rayleigh wave velocity as a function of rotated angle of specimen and fabrication parameters of the MMCs.
-
Power Controllability of Three-phase Converter with Unbalanced AC Source
DEFF Research Database (Denmark)
Ma, Ke; Chen, Wenjie; Liserre, Marco
2015-01-01
Three-phase DC-AC power converters suffer from power oscillation and overcurrent problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zerosequence components are proposed to enhance the power control ability under this adverse condition. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC voltage....
-
A direct power conversion topology for grid integrations of hybrid AC/DC resources
DEFF Research Database (Denmark)
Liu, Xiong; Loh, Poh Chiang; Wang, Peng
2012-01-01
and modulation schemes are proposed to extract the commanded current from the input ac/dc sources to the grid and guarantee high quality ac/dc inputs and ac output current waveforms with unity power factors. The proposed modulation scheme for sinusoidal outputs of the VMC is mathematically proved...
-
Low frequency ac conduction and dielectric relaxation in poly(N ...
Indian Academy of Sciences (India)
The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.
-
Productos «Celotex» para acondicionamientos Acústicos
Directory of Open Access Journals (Sweden)
Editorial, Equipo
1958-02-01
Full Text Available Not availableBajo la denominación general «Celotex», que es un nombre registrado, la Casa Americana The Celotex Corporation, cuyo domicilio social es 120 South, La Salle Street, Chicago J. lllinois, fabrica diversos materiales para fines de acondicionamiento acústico elaborados, según los tipos de que se trate, con fibra de caña de azúcar, lanas minerales, acero, amianto, etc., perforados o no y de acuerdo con el efecto estético y acústico que se desee obtener.
-
CTE Corrections for WFPC2 and ACS
Science.gov (United States)
Dolphin, Andrew
2003-07-01
The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.
-
Superconducting ac cable
Science.gov (United States)
Schmidt, F.
1980-11-01
The components of a superconducting 110 kV ac cable for power ratings or = 2000 MVA were developed. The cable design is of the semiflexible type, with a rigid cryogenic envelope containing a flexible hollow coaxial cable core. The cable core consists of spirally wound Nb-A1 composite wires electrically insulated by high pressure polyethylene tape wrappings. A 35 m long single phase test cable with full load terminals rated at 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of this cable design.
-
Superconducting ac cable
International Nuclear Information System (INIS)
Schmidt, F.
1980-01-01
The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de
-
Diode-rectified multiphase AC arc for the improvement of electrode erosion characteristics
Science.gov (United States)
Tanaka, Manabu; Hashizume, Taro; Saga, Koki; Matsuura, Tsugio; Watanabe, Takayuki
2017-11-01
An innovative multiphase AC arc (MPA) system was developed on the basis of a diode-rectification technique to improve electrode erosion characteristics. Conventionally, electrode erosion in AC arc is severer than that in DC arc. This originated from the fact that the required properties for the cathode and anode are different, although an AC electrode works as the cathode and the anode periodically. To solve this problem, a separation of AC electrodes into pairs of thoriated tungsten cathode and copper anode by diode-rectification was attempted. A diode-rectified multiphase AC arc (DRMPA) system was then successfully established, resulting in a drastic improvement of the erosion characteristics. The electrode erosion rate in the DRMPA was less than one-third of that in the conventional MPA without the diode rectification. In order to clarify its erosion mechanism, electrode phenomena during discharge were visualized by a high-speed camera system with appropriate band-pass filters. Fluctuation characteristics of the electrode temperature in the DRMPA were revealed.
-
Complex study of transport AC loss in various 2G HTS racetrack coils
Energy Technology Data Exchange (ETDEWEB)
Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)
2013-04-15
Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.
-
Pioneering SUPER - Small Unit Passively-safe Enclosed Reactor - 15559
International Nuclear Information System (INIS)
Bhownik, P.K.; Gairola, A.; Shamim, J.A.; Suh, K.Y.; Suh, K.S.
2015-01-01
This paper presents the basic features of the Small Unit Passively-safe Enclosed Reactor abbreviated as SUPER, a new reactor system that has been designed and proposed at the Seoul National University's Department of Energy Systems Engineering. SUPER is a small modular reactor system or SMR that is cooled by sub-cooled as well as supercritical water. As a new member of SMRs, SUPER is a small-scale nuclear plant that is designed to be factory-manufactured and shipped as modules to be assembled at a site. The concept offers promising answers to many questions about nuclear power including proliferation resistance, waste management, safety, and startup costs. SUPER is a customized paradigm of a supercritical water reactor or SCWR, a type sharing commonalities with the current fleet of light water reactors, or LWRs. SUPER has evolved from the System-integrated Modular Advance Reactor, or SMART, being developed at the Korea Atomic Energy Research Institute, or KAERI. SUPER enhanced the safety features for robustness, design/equipment simplification for natural convection, multi-purpose application for co-generation flexibilities, suitable for isolated or small electrical grids, just-in-time capacity addition, short construction time, and last, but not least, lower capital cost per unit. The primary objectives of SUPER is to develop the conceptual design for a safe and economic small, natural circulation SCWR, to address the economic and safety attributes of the concept, and to demonstrate its technical feasibilities. (authors)
-
a.c. conductance study of polycrystal C{sub 60}
Energy Technology Data Exchange (ETDEWEB)
Yan Feng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Wang Yening [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Huang Yineng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Gu Min [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Zhang Qingming [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Shen Huimin [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure
1995-06-05
The a.c. (1a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law {sigma} similar {omega}{sup s} (s{approx}0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C{sub 60}. ((orig.)).
-
Faradaic AC Electrokinetic Flow and Particle Traps
Science.gov (United States)
Ben, Yuxing; Chang, Hsueh-Chia
2004-11-01
Faradaic reaction at higher voltages can produce co-ion polarization at AC electrodes instead of counter-ion polarization due to capacitive charging from the bulk. The Faradaic co-ion polarization also does not screen the external field and hence can produce large net electro-kinetic flows at frequencies lower than the inverse RC time of the double layer. Due to the opposite polarization of capacitve and Faradaic charging, we can reverse the direction of AC flows on electrodes by changing the voltage and frequency. Particles and bacteria are trapped and then dispersed at stagnation lines, at locations predicted by our theory, by using these two flows sequentially. This technique offers a good way to concentrate and detect bacteria.
-
AC application of second generation HTS wire
Science.gov (United States)
Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.
2008-02-01
For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.
-
AC Losses and Their Thermal Effect in High Temperature Superconducting Machines
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan
2015-01-01
In transient operations or fault conditions, high temperature superconducting (HTS) machines suffer AC losses which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate AC losses and their thermal effect in HTS machines is presented....... The method consists of three sub-models that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an AC loss model which has...
-
AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan
2016-01-01
In transient operations or fault conditions, hightemperature superconducting (HTS) machines suffer ac losses, which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate ac losses and their thermal effect in HTS machines is presented....... The method consists of three submodels that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an ac loss model that has a homogeneous...
-
ELECTRONIC SYSTEM FOR EXPERIMENTATION IN AC ELECTROGRAVIMETRY I: TECHNIQUE FUNDAMENTALS
Directory of Open Access Journals (Sweden)
Róbinson Torres
Full Text Available Basic fundamentals of AC electrogravimetry are introduced. Their main requirements and characteristics are detailed to establish the design of an electronic system that allows the appropriate extraction of data needed to determine the electrogravimetric transfer function (EGTF and electrochemical impedance (EI, in an experimental set-up for the AC electrogravimetry technique.
-
AC Conductivity Studies of Lithium Based Phospho Vanadate Glasses
International Nuclear Information System (INIS)
Nagendra, K.; Babu, G. Satish; Gowda, Veeranna; Reddy, C. Narayana
2011-01-01
Glasses in the system xLi 2 SO 4 -20Li 2 O-(80-x) [80P 2 O 5 -20V 2 O 5 ](5≥x≥20 mol%) has been prepared by melt quenching method. Dc and ac conductivity has been studied over a wide range of frequency (10 Hz to 10 MHz) and temperature (298 K-523 K). The dc conductivity found to increase with increase of Li 2 SO 4 concentration. The ac conductivities have been fitted to the Almond-West type single power law equation σ(ω) = σ(0)+Aω s where 's' is the power law exponent. The ac conductivity found to increase with increase of Li 2 SO 4 concentration. An attempt is made to elucidate the enhancement of lithium ion conduction in phosphor-vanadate glasses by considering the expansion of network structure.
-
Non-Federal participation in AC Intertie: Final environmental impact statement
International Nuclear Information System (INIS)
1994-01-01
Bonneville Power Administration (BPA) is considering action in two areas: (1) non-Federal access to the AC Intertie, and, (2) BPA Intertie marketing. BPA's preferred alternative for non-Federal access is the Capacity Ownership alternative combined with the Increased Assured Delivery -- Access for Non-Scheduling Utilities alternative; the preferred alternative for BPA Intertie marketing is the Federal Marketing and Joint Ventures alternative. BPA considered these two areas previously in its Intertie Development and Use EIS of April 1988. The EIS resulted in BPA decisions to participate in the construction of the Third AC Intertie, to allow non-Federal access to BPA's share of the Pacific Northwest-Pacific Southwest (PNW-PSW) Intertie (AC and DC lines) pursuant to a Long-Term Intertie Access Policy (LTIAP), and to pursue BPA's export marketing alternative. The decision on allowing direct financial non-Federal participation in the Third AC line was deferred to a later, separate process, examined here. Also, BPA's export marketing objectives must now be examined in view of changed operations of Columbia River hydro facilities for improved fish survival
-
AC-loss considerations of a pulse SMES for an accelerator
International Nuclear Information System (INIS)
Lyly, M; Hiltunen, I; Jaervelae, J; Korpela, A; Lehti, L; Stenvall, A; Mikkonen, R
2010-01-01
In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.
-
A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation
Directory of Open Access Journals (Sweden)
Cuidong Xu
2015-09-01
Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.
-
Lamin A/C mutations with lipodystrophy, cardiac abnormalities, and muscular dystrophy
NARCIS (Netherlands)
van der Kooi, A. J.; Bonne, G.; Eymard, B.; Duboc, D.; Talim, B.; van der Valk, M.; Reiss, P.; Richard, P.; Demay, L.; Merlini, L.; Schwartz, K.; Busch, H. F. M.; de Visser, M.
2002-01-01
Mutations in the lamin A/C gene are found in Emery-Dreifuss muscular dystrophy, limb girdle muscular dystrophy with cardiac conduction disturbances, dilated cardiomyopathy with conduction system disease, and familial partial lipodystrophy. Cases with lamin A/C mutations presenting with lipodystrophy
-
Power Controllability of Three-phase Converter with Unbalanced AC Source
DEFF Research Database (Denmark)
Ma, Ke; Liserre, Marco; Blaabjerg, Frede
2013-01-01
Three-phase DC-AC power converters suffer from power oscillation and overcurrentt problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zero-sequence components are proposed to enhance the power control ability under this adverse conditions. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC sources....
-
AC Application of HTS Conductors in Highly Dynamic Electric Motors
International Nuclear Information System (INIS)
Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K
2006-01-01
Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit
-
Low-temperature metal-oxide thin-film transistors formed by directly photopatternable and combustible solution synthesis.
Science.gov (United States)
Rim, You Seung; Lim, Hyun Soo; Kim, Hyun Jae
2013-05-01
We investigated the formation of ultraviolet (UV)-assisted directly patternable solution-processed oxide semiconductor films and successfully fabricated thin-film transistors (TFTs) based on these films. An InGaZnO (IGZO) solution that was modified chemically with benzoylacetone (BzAc), whose chelate rings decomposed via a π-π* transition as result of UV irradiation, was used for the direct patterning. A TFT was fabricated using the directly patterned IGZO film, and it had better electrical characteristics than those of conventional photoresist (PR)-patterned TFTs. In addition, the nitric acid (HNO3) and acetylacetone (AcAc) modified In2O3 (NAc-In2O3) solution exhibited both strong UV absorption and high exothermic reaction. This method not only resulted in the formation of a low-energy path because of the combustion of the chemically modified metal-oxide solution but also allowed for photoreaction-induced direct patterning at low temperatures.
-
AC ignition of HID lamps
NARCIS (Netherlands)
Sobota, A.; Kanters, J.H.M.; Manders, F.; Veldhuizen, van E.M.; Haverlag, M.
2010-01-01
Our aim was to examine the starting behaviour of mid-pressure argon discharges in pin-pin (point-to-point) geometry, typically used in HID lamps. We focused our work on AC ignition of 300 and 700 mbar Ar discharges in Philips 70W standard burners. Frequency was varied between 200 kHz and 1 MHz. In
-
AC-Induced Bias Potential Effect on Corrosion of Steels
Science.gov (United States)
2009-02-05
induction, variable conduction Experimental Setup Super- martensitic stainless steel composition Analysis: C Mn Si Cr Ni Mo Cu N Typical 13 Cr ɘ.01 0.6... stainless steel used in pipelines. •Low carbon (ɘ.01): allows the formation of a “soft” martensite that is more resistant than standard martensitic ...Proposed AC Corrosion Models AC Simulated Corrosion testing Stainless steel pipe and coating Cathodic protection Experimental Setup Preliminary
-
AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications
Science.gov (United States)
Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.
2017-12-01
This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.
-
The effect of ac magnetic fields on the lifting power of levitating superconductors
International Nuclear Information System (INIS)
Smolyak, B M; Ermakov, G V; Chubraeva, L I
2007-01-01
This study deals with the decrease in the levitation force under the action of an ac field up to the frequency at which oscillations of the superconducting suspension are limited by inertia. The lifting force was measured as a function of the ac field amplitude and the exposure time. It was shown that the force quickly decreased at the moment the ac field was applied and then continued diminishing, but at a lower rate. A qualitative model was proposed, taking into account two effects of the ac field on the magnetization of the levitating superconductor: a complete destruction of the critical state in some section of the superconductor (to a depth λ ac ) and the initiation of a faster magnetic relaxation in the region where the induction gradient is preserved
-
AC Electric Field Communication for Human-Area Networking
Science.gov (United States)
Kado, Yuichi; Shinagawa, Mitsuru
We have proposed a human-area networking technology that uses the surface of the human body as a data transmission path and uses an AC electric field signal below the resonant frequency of the human body. This technology aims to achieve a “touch and connect” intuitive form of communication by using the electric field signal that propagates along the surface of the human body, while suppressing both the electric field radiating from the human body and mutual interference. To suppress the radiation field, the frequency of the AC signal that excites the transmitter electrode must be lowered, and the sensitivity of the receiver must be raised while reducing transmission power to its minimally required level. We describe how we are developing AC electric field communication technologies to promote the further evolution of a human-area network in support of ubiquitous services, focusing on three main characteristics, enabling-transceiver technique, application-scenario modeling, and communications quality evaluation. Special attention is paid to the relationship between electro-magnetic compatibility evaluation and regulations for extremely low-power radio stations based on Japan's Radio Law.
-
AC Conductivity and Dielectric Properties of Borotellurite Glass
Science.gov (United States)
Taha, T. A.; Azab, A. A.
2016-10-01
Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.
-
Trees as metal scavengers
International Nuclear Information System (INIS)
Hallman, N.
2000-01-01
Full text: Tree roots extract metal ions form wet soils in two different ways. At the soil/root hair interface soluble ions in contact with the cellulose wall move through it and enter the cell through the plasmalemma; the semi permeable membrane that encloses every living cell. Some ions, especially those that are part of cellular metabolic processes eg. Na, K, Fe, Mg, S move into the cytoplasm, are bound into organic complexes and travel from cell to cell within the cytoplasm. This requires energy, and the amount of any of these metabolically active ions taken in tends to be regulated by the plant. The movement of the ions from cell to cell is slow, selective, and regulated by requirements of synthesis of for example Mg in the chlorophyll molecule. This means that more Mg is transported to cells of leaves than of cells of roots. This movement of ions is simplistic, or within the cytoplasm. Other ions are swept along in the transpiration stream and enter the complex plumbing system that brings water to the leaves for metabolism and cooling. Water in this apoplastic pathway travels within the pipes (xylem) of the wood and in the cellulose of the walls. It travels along essentially non-living parts of the plant. Ions such as As, Pb, Ni, Cr accumulate in sites such as leaves and bark. Analysis of plant parts can indicate the presence of heavy metals and can give an indication of ore bodies within the root zone
-
Space Charge Modulated Electrical Breakdown of Oil Impregnated Paper Insulation Subjected to AC-DC Combined Voltages
Directory of Open Access Journals (Sweden)
Yuanwei Zhu
2018-06-01
Full Text Available Based on the existing acknowledgment that space charge modulates AC and DC breakdown of insulating materials, this investigation promotes the related investigation into the situations of more complex electrical stress, i.e., AC-DC combined voltages. Experimentally, the AC-DC breakdown characteristics of oil impregnated paper insulation were systematically investigated. The effects of pre-applied voltage waveform, AC component ratio, and sample thickness on AC-DC breakdown characteristics were analyzed. After that, based on an improved bipolar charge transport model, the space charge profiles and the space charge induced electric field distortion during AC-DC breakdown were numerically simulated to explain the differences in breakdown characteristics between the pre-applied AC and pre-applied DC methods under AC-DC combined voltages. It is concluded that large amounts of homo-charges are accumulated during AC-DC breakdown, which results in significantly distorted inner electric field, leading to variations of breakdown characteristics of oil impregnated paper insulation. Therefore, space charges under AC-DC combined voltages must be considered in the design of converter transformers. In addition, this investigation could provide supporting breakdown data for insulation design of converter transformers and could promote better understanding on the breakdown mechanism of insulating materials subjected to AC-DC combined voltages.
-
Induced AC voltages on pipelines may present a serious hazard
International Nuclear Information System (INIS)
Kirkpatrick, E.L.
1997-01-01
The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP
-
System and Battery Charge Control for PV-Powered AC Lighting Systems
Energy Technology Data Exchange (ETDEWEB)
Kern, G.
1999-04-01
This report reviews a number of issues specific to stand-alone AC lighting systems. A review of AC lighting technology is presented, which discusses the advantages and disadvantages of various lamps. The best lamps for small lighting systems are compact fluorescent. The best lamps for intermediate-size systems are high- or low-pressure sodium. Specifications for battery charging and load control are provided with the goal of achieving lamp lifetimes on the order of 16,000 to 24,000 hours and battery lifetimes of 4 to 5 years. A rough estimate of the potential domestic and global markets for stand-alone AC lighting systems is presented. DC current injection tests were performed on high-pressure sodium lamps and the test results are presented. Finally, a prototype system was designed and a prototype system controller (with battery charger and DC/AC inverter) was developed and built.
-
Photovoltaic system with improved AC connections and method of making same
Energy Technology Data Exchange (ETDEWEB)
Cioffi, Philip Michael; Todorovic, Maja Harfman; Herzog, Michael Scott; Korman, Charles Steven; Doherty, Donald M.; Johnson, Neil Anthony
2018-02-13
An alternating current (AC) harness for a photovoltaic (PV) system includes a wire assembly having a first end and a second end, the wire assembly having a plurality of lead wires, and at least one AC connection module positioned at a location along a length of the wire assembly between the first end and the second end. Further, the at least one AC connection module includes a first connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a first PV module of the PV system. The at least one AC connection module also includes a second connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a second PV module of the PV system.
-
Manipulation of Dirac cones in metal-intercalated epitaxial graphene
Science.gov (United States)
Wang, Cai-Zhuang; Kim, Minsung; Tringides, Michael; Ho, Kai-Ming
Graphene is one of the most attractive materials from both fundamental and practical points of view due to its characteristic Dirac cones. The electronic property of graphene can be modified through the interaction with substrate or another graphene layer as illustrated in few-layer epitaxial graphene. Recently, metal intercalation became an effective method to manipulate the electronic structure of graphene by modifying the coupling between the constituent layers. In this work, we show that the Dirac cones of epitaxial graphene can be manipulated by intercalating rare-earth metals. We demonstrate that rare-earth metal intercalated epitaxial graphene has tunable band structures and the energy levels of Dirac cones as well as the linear or quadratic band dispersion can be controlled depending on the location of the intercalation layer and density. Our results could be important for applications and characterizations of the intercalated epitaxial graphene. Supported by the U.S. DOE-BES under Contract No. DE-AC02-07CH11358.
-
A decomposition method for network-constrained unit commitment with AC power flow constraints
International Nuclear Information System (INIS)
Bai, Yang; Zhong, Haiwang; Xia, Qing; Kang, Chongqing; Xie, Le
2015-01-01
To meet the increasingly high requirement of smart grid operations, considering AC power flow constraints in the NCUC (network-constrained unit commitment) is of great significance in terms of both security and economy. This paper proposes a decomposition method to solve NCUC with AC power flow constraints. With conic approximations of the AC power flow equations, the master problem is formulated as a MISOCP (mixed integer second-order cone programming) model. The key advantage of this model is that the active power and reactive power are co-optimised, and the transmission losses are considered. With the AC optimal power flow model, the AC feasibility of the UC result of the master problem is checked in subproblems. If infeasibility is detected, feedback constraints are generated based on the sensitivity of bus voltages to a change in the unit reactive power generation. They are then introduced into the master problem in the next iteration until all AC violations are eliminated. A 6-bus system, a modified IEEE 30-bus system and the IEEE 118-bus system are used to validate the performance of the proposed method, which provides a satisfactory solution with approximately 44-fold greater computational efficiency. - Highlights: • A decomposition method is proposed to solve the NCUC with AC power flow constraints • The master problem considers active power, reactive power and transmission losses. • OPF-based subproblems check the AC feasibility using parallel computing techniques. • An effective feedback constraint interacts between the master problem and subproblem. • Computational efficiency is significantly improved with satisfactory accuracy
-
Electrical actuation of electrically conducting and insulating droplets using ac and dc voltages
International Nuclear Information System (INIS)
Kumari, N; Bahadur, V; Garimella, S V
2008-01-01
Electrical actuation of liquid droplets at the microscale offers promising applications in the fields of microfluidics and lab-on-chip devices. Much prior research has targeted the electrical actuation of electrically conducting liquid droplets using dc voltages (classical electrowetting). Electrical actuation of conducting droplets using ac voltages and the actuation of insulating droplets (using dc or ac voltages) has remained relatively unexplored. This paper utilizes an energy-minimization-based analytical framework to study the electrical actuation of a liquid droplet (electrically conducting or insulating) under ac actuation. It is shown that the electromechanical regimes of classical electrowetting, electrowetting under ac actuation and insulating droplet actuation can be extracted from the generic electromechanical actuation framework, depending on the electrical properties of the droplet, the underlying dielectric layer and the frequency of the actuation voltage. This paper also presents experiments which quantify the influence of the ac frequency and the electrical properties of the droplet on its velocity under electrical actuation. The velocities of droplets moving between two parallel plates under ac actuation are experimentally measured; these velocities are then related to the actuation force on the droplet which is predicted by the electromechanical model developed in this work. It is seen that the droplet velocities are strongly dependent on the frequency of the ac actuation voltage; the cut-off ac frequency, above which the droplet fails to actuate, is experimentally determined and related to the electrical conductivity of the liquid. This paper then analyzes and directly compares the various electromechanical regimes for the actuation of droplets in microfluidic applications
-
Flow reversal at low voltage and low frequency in a microfabricated ac electrokinetic pump
DEFF Research Database (Denmark)
Gregersen, Misha Marie; Olesen, Laurits Højgaard; Brask, Anders
2007-01-01
measured in a regime, where both the applied voltage and the frequency are low, Vrms1.5 V and f20 kHz, compared to previously investigated parameter ranges. The impedance spectrum has been thoroughly measured and analyzed in terms of an equivalent circuit diagram to rule out trivial circuit explanations......Microfluidic chips have been fabricated in Pyrex glass to study electrokinetic pumping generated by a low-voltage ac bias applied to an in-channel asymmetric metallic electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility...... of the measurements over several days. A large coverage fraction of the electrode array in the microfluidic channels has led to an increased sensitivity allowing for pumping measurements at low bias voltages. Depending on the ionic concentration a hitherto unobserved reversal of the pumping direction has been...
-
Calorimetric method of ac loss measurement in a rotating magnetic field
Energy Technology Data Exchange (ETDEWEB)
Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)
2010-07-15
A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.
-
Adsorptive Removal of Artificial Sweeteners from Water Using Metal-Organic Frameworks Functionalized with Urea or Melamine.
Science.gov (United States)
Seo, Pill Won; Khan, Nazmul Abedin; Hasan, Zubair; Jhung, Sung Hwa
2016-11-02
A highly porous metal-organic framework (MOF), MIL-101, was modified to introduce urea or melamine via grafting on open metal sites of the MOF. Adsorptive removal of three artificial sweeteners (ASWs) was studied using the MOFs, with or without modifications (including nitration), and activated carbon (AC). The adsorbed quantities (based on the weight of the adsorbent) of saccharin (SAC) under various conditions decreased in the order urea-MIL-101 > melamine-MIL-101 > MIL-101 > AC > O 2 N-MIL-101; however, the quantities based on unit surface area are in the order melamine-MIL-101 > urea-MIL-101 > MIL-101 > O 2 N-MIL-101. Similar ASWs [acesulfame (ACE) and cyclamate (CYC)] showed the same tendency. The mechanism for very favorable adsorption of SAC, ACE, and CYC over urea- and melamine-MIL-101 could be explained by H-bonding on the basis of the contents of -NH 2 groups on the MOFs and the adsorption results under a wide range of pH values. Moreover, the direction of H-bonding could be clearly defined (H acceptor: ASWs; H donor: MOFs). Urea-MIL-101 and melamine-MIL-101 could be suggested as competitive adsorbents for organic contaminants (such as ASWs) with electronegative atoms, considering their high adsorption capacity (for example, urea-MIL-101 had 2.3 times the SAC adsorption of AC) and ready regeneration.
-
Antifriction coatings based on a-C for biomedicine applications
International Nuclear Information System (INIS)
Yurjev, Y N; Kiseleva, D V; Zaitcev, D A; Sidelev, D V; Korneva, O S
2016-01-01
This article reports on the investigation of mechanical properties of carbon films deposited by dual magnetron sputtering system with closed and mirror magnetic field. There is shown that a-C films with predominantly sp 2 -phase have relatively high hardness (up to 20 GPa) and low friction index (∼0.01). The influence of magnetic field on friction index is determined. The analysis of experimental data shows the obtained a-C samples can be used for biomedicine applications. (paper)
-
AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios
Energy Technology Data Exchange (ETDEWEB)
Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z
2004-10-01
AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger.
-
AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios
International Nuclear Information System (INIS)
Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z.
2004-01-01
AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger
-
Study of the electric Held in HTS tape caused by perpendicular AC magnetic field
International Nuclear Information System (INIS)
Roiberg, V; Kopansky, F.
2004-01-01
Full Text: In a previous work we studied the influence of AC magnetic fields on voltage-currents (V-I) characteristics of high temperature superconducting (HTS) multi filament BSCC0-2223 tapes. It was found that AC magnetic fields perpendicular to the ab plane (the wide surface of the tape) cause a linear decrease of the critical current (IC) with amplitude of the AC magnetic field. The degradation of IC in .AC field was explained by the geometrical model according to which the transport current floe: is confined to the central zone of the tape where .AC field does not penetrate. For deeper understanding of the observed phenomena we carried out a study of the time dependence of the electric field during the cycle of AC field. At the same time we expanded the frequency range to low frequencies down to 1 Hz. The main results of the work are as following. 1. The time modulation of the electric field E in the HTS tape carrying transport DC current has the double frequency relating to AC magnetic field. 2. In field amplitudes less than 70 G the electric field modulation decreases with increasing frequency in opposite to its well-pronounced increase in higher AC field amplitudes. Alcove 70 G, the electric field increases with increasing the frequency of the external magnetic field. The wave forms of the electric field are different in both amplitudes ranges. 3. E-I curves of the tape in low amplitudes are frequency independent and coincide with E-l curves in AC field with intensity equal to the AC field amplitude. 4. In high AC field amplitudes, a strong dependence of the E-I curves on frequency is observed in the frequency range of 1-40 Hz and no dependence is observed in higher frequencies. Our results suggest that a combination of the geometrical model with flux creep concepts is necessary for a better understanding of the electric field behavior in our measurement conditions
-
Modelling and measurement of ac loss in BSCCO/Ag-tape windings
International Nuclear Information System (INIS)
Oomen, M P; Nanke, R; Leghissa, M
2003-01-01
High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications
-
Catalytic properties of lanthanide amide, imide and nitride formed by thermal degradation of liquid ammonia solutions of Eu and Yb metal
International Nuclear Information System (INIS)
Imamura, H.; Mizuno, K.; Ohishi, K.; Suda, E.; Kanda, K.; Sakata, Y.; Tsuchiya, S.
1998-01-01
The catalytic properties of lanthanide amide, imide and nitride prepared by the use of liquid ammonia solutions of lanthanide metals (Ln=Eu and Yb) were studied for catalytic hydrogenation. The reaction of Eu or Yb metal solutions in liquid ammonia with silica yielded SiO 2 -grafted lanthanide amide in the divalent state. The divalent amide showed catalytic activity for the selective hydrogenation of dienes and benzene. It was found that partial hydrogenation of benzene occurred with a very high selectivity for cyclohexene. Amides of calcium, strontium and barium were examined similarly in connection with catalytic studies on divalent amides. Imide and nitride, into which the lanthanide (Ln/AC) deposited by impregnation of active carbon (AC) with liquid ammonia solutions of lanthanide metals were converted thermally, were studied catalytically. It was concluded that imide or imide-like species generated during the thermal degradation of lanthanide amide to nitride were very active in the hydrogenation of ethene. Lanthanide nitride was virtually inactive, but the nitride highly dispersed on active carbon was activated when subjected to evacuation treatment above about 1000 K. (orig.)
-
Transport ac losses in Bi-2223 multifilamentary tapes - conductor materials aspect
Energy Technology Data Exchange (ETDEWEB)
Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge BC2 3QZ (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Institute of Electrical Engineering, SAS, Bratislava (Slovakia)
2000-05-01
Transport ac losses in technical superconductors based on Bi-2223 tape material are influenced by many parameters. The major factors that define the ac performance of such conductors are the following: the size and number of filaments, their geometrical arrangement in the cross-section of the conductor, the twist pitch length, the resistivity of the matrix, the presence of oxide barriers around the filaments and deformation procedures such as sequential pressing or rolling followed by appropriate thermal treatment. In the present paper the above aspects are addressed from the viewpoint of the materials science of technical conductor design. Transport ac losses at power frequencies in different types of Bi-2223 conductor are presented and analysed. The results of conductor design analysis with respect to the coexistence of the superconductor with other materials in the conductor structure are presented. New concepts for minimization of the transport ac losses are discussed in detail. (author)
-
Facility for the storage of spent, heat-emitting and container-enclosed nuclear reactor fuel assemblies
International Nuclear Information System (INIS)
Hennings, U.
1987-01-01
Patent for facility for the storage of spent, heat-emitting and container-enclosed nuclear reactor fuel assemblies, which are arranged within a building in a horizontal position and are cooled by a gas stream, whereby the building has a storage and a loading zone, characterized by the fact that pallet trucks arranged one above the other in a row and such that an interspace is left for the receiving positions for the containers, the the pallet trucks can be moved along rails that extend between two side walls arranged opposite to one another in the storage zone, that the storage zone can be loaded and unloaded by opening located in these two side walls, and that the gas stream only circulates within the building
-
Apparatus and method for transient thermal infrared spectrometry of flowable enclosed materials
Science.gov (United States)
McClelland, John F.; Jones, Roger W.
1993-03-02
A method and apparatus for enabling analysis of a flowable material enclosed in a transport system having an infrared transparent wall portion. A temperature differential is transiently generated between a thin surface layer portion of the material and a lower or deeper portion of the material sufficient to alter the thermal infrared emission spectrum of the material from the black-body thermal infrared emission spectrum of the material, and the altered thermal infrared emission spectrum is detected through the infrared transparent portion of the transport system while the altered thermal infrared emission spectrum is sufficiently free of self-absorption by the material of emitted infrared radiation. The detection is effected prior to the temperature differential propagating into the lower or deeper portion of the material to an extent such that the altered thermal infrared emission spectrum is no longer sufficiently free of self-absorption by the material of emitted infrared radiation. By such detection, the detected altered thermal infrared emission spectrum is indicative of characteristics relating to molecular composition of the material.
-
The peculiarities of structurizing enclosing rock massif while developing a coal seam
Science.gov (United States)
Kozyreva, E. N.; Shinkevich, M. V.
2017-09-01
Different concepts of the development of geo-mechanical processes during longwall mining of a seam which are fundamentally different from the conventional ones are introduced in the article. Fundamental principles of the model for structurizing enclosing rock mass while longwall mining along the strike are described. The model was developed on the bases of non-linear geomechanical laws. According to the model, rock mass in the area of mining operation is organized as rock geomechanical layers with shifting arches. And the formation period of shifting arches in disintegrated rock mass is divisible by the length of the stope. Undulate characteristic of a massif as a peculiarity of man-made structurization of a massif is defined. It is shown that structuring the broken massif causes the formation of block-structured system and it can be detected while monitoring the ground pressure in powered support props. The results of the research allow decreasing the negative influence of a ground pressure and can be applied to specify parameters for controlling the roof, defining geometrical dimensions of a mining section and positioning of holing chute (face entry).
-
Numerical analysis of steady and transient natural convection in an enclosed cavity
Science.gov (United States)
Mehedi, Tanveer Hassan; Tahzeeb, Rahat Bin; Islam, A. K. M. Sadrul
2017-06-01
The paper presents the numerical simulation of natural convection heat transfer of air inside an enclosed cavity which can be helpful to find out the critical width of insulation in air insulated walls seen in residential buildings and industrial furnaces. Natural convection between two walls having different temperatures have been simulated using ANSYS FLUENT 12.0 in both steady and transient conditions. To simulate different heat transfer and fluid flow conditions, Rayleigh number ranging from 103 to 105 has been maintained (i.e. Laminar flow.) In case of steady state analysis, the CFD predictions were in very good agreement with the reviewed literature. Transient simulation process has been performed by using User Defined Functions, where the temperature of the hot wall varies with time linearly. To obtain and compare the heat transfer properties, Nusselt number has been calculated at the hot wall at different conditions. The buoyancy driven flow characteristics have been investigated by observing the flow pattern in a graphical manner. The characteristics of the system at different temperature differences between the wall has been observed and documented.
-
AC electric field assisted orientational photorefractive effect in C60-doped nematic liquid crystal
International Nuclear Information System (INIS)
Sun Xiudong; Pei Yanbo; Yao Fengfeng; Zhang Jianlong; Hou Chunfeng
2007-01-01
Photorefractive gratings were produced in a C 60 -doped nematic liquid crystal cell under the application of two coherent beams and a nonbiased sinusoidal ac electric field. The beam coupling and diffraction of the ac electric field assisted gratings were studied systematically. A stable asymmetric energy transference was obtained. Diffraction was observed when the angle (between the normal of the cell and the bisector of the writing beams) was 0 0 , and the dependence of diffraction efficiency on the peak-to-peak value of the ac voltage was similar to that at an incidence angle of 45 0 , suggesting that the role of the ac field was to facilitate the charge separation, and the space-charge field (SCF) originated predominantly from the diffusion of the ac electric field assisted photo-induced carriers under the application of nonuniform illumination and an applied ac field. The grating was produced by director reorientation induced by the cooperation of the SCF and the applied ac electric field. A self-erasing phenomenon was observed in this cell. An explanation in terms of the movement of two kinds of carriers with opposite signs was proposed
-
Bacillus thuringiensis delta-endotoxin Cry1Ac domain III enhances activity against Heliothis virescens in some, but not all Cry1-Cry1Ac hybrids
NARCIS (Netherlands)
Karlova, R.B.; Weemen, W.M.J.; Naimov, S.; Ceron, J.; Dukiandjiev, S.; Maagd, de R.A.
2005-01-01
We investigated the role of domain III of Bacillus thuringiensis d-endotoxin Cry1Ac in determining toxicity against Heliothis virescens. Hybrid toxins, containing domain III of Cry1Ac with domains I and II of Cry1Ba, Cry1Ca, Cry1Da, Cry1Ea, and Cry1Fb, respectively, were created. In this way Cry1Ca,
-
Update History of This Database - AcEST | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us AcEST Update History of This Database Date Update contents 2013/01/10 Errors found on AcEST ...s Database Database Description Download License Update History of This Data...base Site Policy | Contact Us Update History of This Database - AcEST | LSDB Archive ... ...Conting data have been correceted. For details, please refer to the following page. Data correction 2010/03/29 AcEST English archi
-
Design and implementation of co-operative control strategy for hybrid AC/DC microgrids
Science.gov (United States)
Mahmud, Rasel
This thesis is mainly divided in two major sections: 1) Modeling and control of AC microgrid, DC microgrid, Hybrid AC/DC microgrid using distributed co-operative control, and 2) Development of a four bus laboratory prototype of an AC microgrid system. At first, a distributed cooperative control (DCC) for a DC microgrid considering the state-of-charge (SoC) of the batteries in a typical plug-in-electric-vehicle (PEV) is developed. In DC microgrids, this methodology is developed to assist the load sharing amongst the distributed generation units (DGs), according to their ratings with improved voltage regulation. Subsequently, a DCC based control algorithm for AC microgrid is also investigated to improve the performance of AC microgrid in terms of power sharing among the DGs, voltage regulation and frequency deviation. The results validate the advantages of the proposed methodology as compared to traditional droop control of AC microgrid. The DCC-based control methodology for AC microgrid and DC microgrid are further expanded to develop a DCC-based power management algorithm for hybrid AC/DC microgrid. The developed algorithm for hybrid microgrid controls the power flow through the interfacing converter (IC) between the AC and DC microgrids. This will facilitate the power sharing between the DGs according to their power ratings. Moreover, it enables the fixed scheduled power delivery at different operating conditions, while maintaining good voltage regulation and improved frequency profile. The second section provides a detailed explanation and step-by-step design and development of an AC/DC microgrid testbed. Controllers for the three-phase inverters are designed and tested on different generation units along with their corresponding inductor-capacitor-inductor (LCL) filters to eliminate the switching frequency harmonics. Electric power distribution line models are developed to form the microgrid network topology. Voltage and current sensors are placed in the proper
-
Stretched exponential relaxation and ac universality in disordered dielectrics
DEFF Research Database (Denmark)
Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens
2007-01-01
This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...
-
Phosphorus mass balance in a highly eutrophic semi-enclosed inlet near a big metropolis: a small inlet can contribute towards particulate organic matter production.
Science.gov (United States)
Asaoka, Satoshi; Yamamoto, Tamiji
2011-01-01
Terrigenous loading into enclosed water bodies has been blamed for eutrophic conditions marked by massive algal growth and subsequent hypoxia due to decomposition of dead algal cells. This study aims to describe the eutrophication and hypoxia processes in a semi-enclosed water body lying near a big metropolis. Phosphorus mass balance in a small inlet, Ohko Inlet, located at the head of Hiroshima Bay, Japan, was quantified using a numerical model. Dissolved inorganic phosphorous inflow from Kaita Bay next to the inlet was five times higher than that from terrigenous load, which may cause an enhancement of primary production. Therefore, it was concluded that not only the reduction of material load from the land and the suppression of benthic flux are needed, but also reducing the inflow of high phosphorus and oxygen depleted water from Kaita Bay will form a collective alternative measure to remediate the environmental condition of the inlet. Copyright © 2011 Elsevier Ltd. All rights reserved.
-
Measuring Gravitational Flexion in ACS Clusters
Science.gov (United States)
Goldberg, David
2005-07-01
We propose measurement of the gravitational "Flexion" signal in ACS cluster images. The flexion, or "arciness" of a lensed background galaxy arises from variations in the lensing field. As a result, it is extremely sensitive to small scale perturbations in the field, and thus, to substructure in clusters. Moreover, because flexion represents gravitationally induced asymmetries in the lensed image, it is completely separable from traditional measurements of shear, which focus on the induced ellipticity of the image, and thus, the two signals may be extracted simultaneously. Since typical galaxies are roughly symmetric upon 180 degree rotation, even a small induced flexion can potentially produce a noticeable effect {Goldberg & Bacon, 2005}. We propose the measurement of substructure within approximately 4 clusters with high-quality ACS data, and will further apply a test of a new tomographic technique whereby comparisons of lensed arcs at different redshifts may be used to estimate the background cosmology, and thus place constraints on the equation of state of dark energy.
-
Influences of Cry1Ac broccoli on larval survival and oviposition of diamondback moth.
Science.gov (United States)
Yi, Dengxia; Cui, Shusong; Yang, Limei; Fang, Zhiyuan; Liu, Yumei; Zhuang, Mu; Zhang, Yangyong
2015-01-01
Larval survival and oviposition behavior of three genotypes of diamondback moth, Plutella xylostella L. (Lepidoptera: Plutellidae), (homozygous Cry1Ac-susceptibile, Cry1Ac-resistant, and their F1 hybrids), on transgenic Bacillus thuringiensis (Bt) broccoli expressing different levels of Cry1Ac protein were evaluated in laboratory. These Bt broccoli lines were designated as relative low, medium, and high, respectively, according to the Cry1Ac content. Untransformed brocccoli plants were used as control. Larval survival of diamondback moth on non-Bt leaves was not significantly different among the three genotypes. The Cry1Ac-resistant larvae could survive on the low level of Bt broccoli plants, while Cry1Ac-susceptible and F1 larvae could not survive on them. The three genotypes of P. xylostella larvae could not survive on medium and high levels of Bt broccoli. In oviposition choice tests, there was no significant difference in the number of eggs laid by the three P. xylostella genotypes among different Bt broccoli plants. The development of Cry1Ac-susceptible and Cry1Ac-resistant P. xylostella on intact Bt plants was also tested in greenhouse. All susceptible P. xylostella larvae died on all Bt plants, while resistant larvae could survive on broccoli, which expresses low Cry1Ac protein under greenhouse conditions. The results of the greenhouse trials were similar to that of laboratory tests. This study indicated that high dose of Bt toxins in broccoli cultivars or germplasm lines is required for effective resistance management. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.
-
Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing
Energy Technology Data Exchange (ETDEWEB)
Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory
2009-10-01
The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.
-
The ACS-NUCL Division 50th Anniversary: Introduction
Energy Technology Data Exchange (ETDEWEB)
Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2016-01-10
The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.
-
Estudio por emisión acústica del comportamiento a flexión de recubrimientos WC-Co obtenidos por plasma atmosférico
Directory of Open Access Journals (Sweden)
Segovia, F.
2007-12-01
Full Text Available Plasma sprayed cermet coatings WC-Co are used in a wide range of industrial applications, mainly due to their wear resistance even in corrosive environments. The objective of this work is to analyze mechanical response of hard metal coatings by means of three- and four-points bend tests applying acoustic emission technique to determine failure critical strength. It has been observed the effect of supported charge level in structural damage by means of optical microscopy and scanning electron microscopy. Acoustic emission has allowed us to relate damage level to stresses level and then to understand coatings failure mechanism.
Los recubrimientos de cermet WC-Co proyectados por plasma se utilizan en un amplio rango de aplicaciones industriales, principalmente por su resistencia al desgaste, incluso en medio corrosivo. El objetivo de este trabajo es analizar la respuesta mecánica de los recubrimientos de metal duro mediante ensayos de flexión a 3 y 4 puntos aplicando el método de emisión acústica para determinar las tensiones críticas de fallo. Se ha observado el efecto del nivel de carga soportado en el dañado estructural mediante microscopia óptica y electrónica de barrido. La emisión acústica ha permitido relacionar el grado de dañado con el nivel de tensiones y, así, entender el mecanismo de fallo de los recubrimientos.
|