WorldWideScience

Sample records for ac losses

  1. Transport AC losses in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  2. Ac losses of transposed superconductors

    International Nuclear Information System (INIS)

    Eckert, D.; Enderlein, G.; Lange, F.

    1975-01-01

    Eastham and Rhodes published results of loss measurements on transposed superconducting NbTi cables and concluded basing on an extrapolation to very large numbers of wires that transposed superconductors could be used favorably in cables for power transmission. There are some reasons to question the correctness of their extrapolation. Losses were calculated for transposed superconductors in self field and got results different from those of Eastham and Rhodes. Loss measurements were performed the results of which give evidence for the correctness of our calculations. The results lead to the conclusion that the use of transposed cables of irreversible type 2 superconductors for power transmission is not advantageous

  3. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, M.P.

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers

  4. Predicting AC loss in practical superconductors

    International Nuclear Information System (INIS)

    Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P

    2006-01-01

    Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time

  5. Study on ac losses of HTS coil carrying ac transport current

    International Nuclear Information System (INIS)

    Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

    2005-01-01

    Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

  6. AC losses in high Tc superconductors

    International Nuclear Information System (INIS)

    Campbell, A.M.

    1998-01-01

    Full text: Although in principle the AC losses in high Tc superconductors can be calculated from the critical current density, a number of complications make this difficult. The Jc is very field dependent, there are intergranular and intragranular critical currents, the material is anisotropic and there is usually a large demagnetising factor. Care must be taken in interpreting electrical measurements since the voltage depends on the position of the contacts. In spite of these complications the simple theory of Norris has proved surprisingly successful and arguments will be presented as to why this is the case. Results on a range of tapes will be compared with theory and numerical methods for predicting losses discussed. Finally a theory for coupling losses will be given for a composite conductor with high resistance barriers round the filaments

  7. Ac loss measurement of SSC dipole magnets

    International Nuclear Information System (INIS)

    Delchamps, S.; Hanft, R.; Jaffery, T.; Kinney, W.; Koska, W.; Lamm, M.J.; Mazur, P.O.; Orris, D.; Ozelis, J.P.; Strait, J.; Wake, M.

    1992-09-01

    AC losses in full length and 1.5 m model SSC collider dipoles were successfully measured by the direct observation of energy flow into and out of magnets during a ramp cycle. The measurement was performed by using two double-integrating type digital volt meters (DVM's) for current and voltage measurement. Measurements were performed for six is m long ASST magnets and five 1.5 m long model magnets, inducting one 40 mm diameter magnet. There were large variations in the eddy current losses. Since these magnets use conductors with slight deviations in their internal structures and processing of the copper surface depending on the manufacturer, it is likely that there are differences in the contact resistance between strands. Correlation between the ramp rate dependence of the,quench current and the eddy current loss was evident

  8. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  9. Extension to AC Loss Minimisation in High Temperature Superconductors

    National Research Council Canada - National Science Library

    Campbell, Archie

    2004-01-01

    ...: (a) Measure the AC losses of appropriate Yttrium Barium Copper Oxide (YBCO) samples with strong potential for minimizing losses at high frequencies and magnetic fields with the existing equipment. (b...

  10. Low ac loss geometries in YBCO coated conductors

    International Nuclear Information System (INIS)

    Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

  11. Low ac loss geometries in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

    2007-10-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

  12. A.C. losses in current-carrying superconductors

    International Nuclear Information System (INIS)

    Reuver, J.L. de.

    1985-01-01

    The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

  13. Development of low AC loss windings for superconducting traction transformer

    International Nuclear Information System (INIS)

    Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K

    2010-01-01

    We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.

  14. Self-field AC losses in Bi-2223 superconducting tapes

    International Nuclear Information System (INIS)

    Mueller, K. H.; Leslie, K.E.

    1996-01-01

    Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed

  15. AC power losses in Bi-2223/Ag HTS tapes

    International Nuclear Information System (INIS)

    Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.

    1998-01-01

    Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

  16. Design and AC loss analysis of a superconducting synchronous motor

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Q [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Majoros, M [Department of Materials Science and Engineering, Ohio State University (United States); Hong, Z [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Campbell, A M [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Coombs, T A [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)

    2006-11-15

    This paper gives a conceptual design of a superconducting synchronous motor consisting of both high-temperature superconducting rotating field winding and armature winding. The AC losses of the armature winding of the motor have been investigated experimentally and numerically, by considering the self-field of the superconducting coils and the rotating magnetic field exposed on the armature winding. The recent developments of YBCO-coated conductors present the possibility of achieving a wholly superconducting machine of significantly smaller size and weight than a conventional machine. Both the rotating field winding and the armature winding are composed of YBCO high-temperature superconducting (HTS) coils. A low AC loss armature winding design has been developed for this superconducting synchronous motor. The performance of the machine was investigated by modelling with the finite-element method. The machine's torque is calculated from first principles by considering the angle between the field and the armature main flux lines.

  17. Low ac loss geometries in YBCO coated conductors and impact on conductor stability

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.

  18. Methods to reduce AC losses in HTS coated conductors with magnetic substrates

    Energy Technology Data Exchange (ETDEWEB)

    Tsukamoto, O. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)], E-mail: osami-t@ynu.ac.jp; Sekizawa, S.; Alamgir, A.K.M. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan); Miyagi, D. [Okayama University, 1-1, Tsushima-Naka, 1-Chome, Okayama 700-8530 (Japan)

    2007-10-01

    HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates.

  19. Methods to reduce AC losses in HTS coated conductors with magnetic substrates

    International Nuclear Information System (INIS)

    Tsukamoto, O.; Sekizawa, S.; Alamgir, A.K.M.; Miyagi, D.

    2007-01-01

    HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates

  20. Measuring ac-loss in high temperature superconducting cable-conductors using four probe methods

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Olsen, Søren Krüger

    1999-01-01

    Measuring the ac-loss of superconducting cable conductors have many aspects in common with measuring the ac-loss of single superconducting tapes. In a cable conductor all tapes are connected to each other and to the test circuit through normal metal joints in each end. This makes such measurement...

  1. Complex study of transport AC loss in various 2G HTS racetrack coils

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)

    2013-04-15

    Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.

  2. Measurement of AC losses in a racetrack superconducting coil made from YBCO coated conductor

    DEFF Research Database (Denmark)

    Seiler, Eugen; Abrahamsen, Asger Bech; Kovac, Jan

    2012-01-01

    to reinforce it. The AC loss is measured versus the transport current Ia with the coil immersed in liquid nitrogen. Measurements at frequencies 21 Hz, 36 Hz and 72 Hz are compared. The AC losses follow I2 a dependence at low current amplitudes and I3 a at high amplitudes. After cutting the inner steel frame...

  3. Reducing AC-Winding Losses in High-Current High-Power Inductors

    DEFF Research Database (Denmark)

    Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.

    2009-01-01

    Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...

  4. n value and Jc distribution dependence of AC transport current losses in HTS conductors

    International Nuclear Information System (INIS)

    Ogawa, Jun; Sawai, Yusuke; Nakayama, Haruki; Tsukamoto, Osami; Miyagi, Daisuke

    2004-01-01

    Compared with LTS materials, HTS materials have some peculiarities affecting AC loss characteristics of the conductors. We measured the AC transport current losses in YBCO thin film coated conductors and a Bi2223/Ag sheathed tape. Comparing the measured data with analytical calculations, the dependence of the AC transport current losses on the n value and critical current density distributions are studied. It is shown that, considering the n values and J c distributions, the peculiarities in the HTS materials can be taken into consideration and the transport current losses in HTS conductors can be calculated by the same analytical method used for LTS

  5. AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications

    Science.gov (United States)

    Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.

    2017-12-01

    This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.

  6. Calorimetric method of ac loss measurement in a rotating magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)

    2010-07-15

    A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  7. Study on AC loss measurements of HTS power cable for standardizing

    Science.gov (United States)

    Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi

    2017-09-01

    High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..

  8. AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios

    Energy Technology Data Exchange (ETDEWEB)

    Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z

    2004-10-01

    AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger.

  9. AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios

    International Nuclear Information System (INIS)

    Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z.

    2004-01-01

    AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger

  10. AC Losses and Their Thermal Effect in High Temperature Superconducting Machines

    DEFF Research Database (Denmark)

    Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan

    2015-01-01

    In transient operations or fault conditions, high temperature superconducting (HTS) machines suffer AC losses which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate AC losses and their thermal effect in HTS machines is presented....... The method consists of three sub-models that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an AC loss model which has...

  11. AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines

    DEFF Research Database (Denmark)

    Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan

    2016-01-01

    In transient operations or fault conditions, hightemperature superconducting (HTS) machines suffer ac losses, which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate ac losses and their thermal effect in HTS machines is presented....... The method consists of three submodels that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an ac loss model that has a homogeneous...

  12. AC losses of single-core MgB{sub 2} wires with different metallic sheaths

    Energy Technology Data Exchange (ETDEWEB)

    Kováč, J., E-mail: elekjkov@savba.sk; Šouc, J.; Kováč, P.; Hušek, I.

    2015-12-15

    Highlights: • AC losses in single-core MgB{sub 2} wires with different metallic sheaths have been measured. • It has been shown that metallic sheath can affect the measured AC loss considerably. • GlidCop and Stainless Steel have negligible effect to the overall loss. • Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. • Due to Monel sheath AC loss of MgB{sub 2} core is not visible. - Abstract: AC losses of single-core MgB{sub 2} superconductors with different metallic sheaths (Cu, GlidCop, stainless steel and Monel) have been measured and analyzed. These wires were exposed to external magnetic field with frequencies 72 and 144 Hz and amplitudes up to 0.1 T at temperatures ranged from 18 to 40 K. The obtained results have shown that applied metallic sheath can affect the measured AC loss considerably. In the case of GlidCop and Stainless Steel a negligible small effect of metallic sheath was observed. Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. In the case of Monel sheath, the hysteresis loss of magnetic sheath is dominated and AC loss of MgB{sub 2} core is practically not visible.

  13. AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2011-01-01

    While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.

  14. Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

    Science.gov (United States)

    Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.

    2008-02-01

    Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.

  15. Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

    International Nuclear Information System (INIS)

    Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C

    2008-01-01

    Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability

  16. A method for decreasing transport ac losses in multifilamentary and multistrip superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom)

    2000-07-01

    A new method is proposed for decreasing transport ac losses in multifilamentary superconductors by the decoupling of the filaments using a magnetic material in the form of thin layers surrounding the individual filaments. For a superconductor with an elliptical cross section, the magnetic material surrounding the filaments affects the local magnetic field distribution that both reduces the critical current of the filaments and induces the transport ac losses in the magnetic material. Even by taking into account any detrimental influences of the presence of the magnetic material around the filaments, the analysis of the experimental data supported by computer modelling confirmed that for a Bi2223 tape with 100 filaments individually covered by magnetic material, such as iron powder, the transport ac losses should be 65 times lower than for the same multifilamentary conductor without the magnetic coating on the filaments. With an increasing number of filaments, the ac loss decrease would be even larger. (author)

  17. AC Transport Current Loss in a Coated Superconductor in the Bean Model

    National Research Council Canada - National Science Library

    Carr, Jr, W. J

    2004-01-01

    A new and straightforward calculation is made of the loss in a very thin superconducting strip of rectangular cross section carrying ac transport current in zero applied magnetic field, with a similar...

  18. Low AC-Loss Superconducting Cable Technology for Electric Aircraft Propulsion, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — The availability of low AC loss magnesium diboride (MgB2) superconducting wires enables much lighter weight superconducting stator coils than with any other metal or...

  19. Calculation of AC losses in large HTS stacks and coils

    DEFF Research Database (Denmark)

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad

    2012-01-01

    In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting...... allowing for overcritical current densities to be considered. The method presented here allowed for a computational speedup factor of up to 2 orders of magnitude when compared to full 2-D simulations taking into account the actual structure of the stacks without compromising accuracy....

  20. Fast-ion losses induced by ACs and TAEs in the ASDEX Upgrade tokamak

    International Nuclear Information System (INIS)

    GarcIa-Munoz, M.; Hicks, N.; Classen, I.G.J.; Bilato, R.; Bobkov, V.; Brambilla, M.; Bruedgam, M.; Fahrbach, H.-U.; Igochine, V.; Maraschek, M.; Sassenberg, K.; Van Voornveld, R.; Jaemsae, S.

    2010-01-01

    The phase-space of convective and diffusive fast-ion losses induced by shear Alfven eigenmodes has been characterized in the ASDEX Upgrade tokamak. Time-resolved energy and pitch-angle measurements of fast-ion losses correlated in frequency and phase with toroidal Alfven eigenmodes (TAEs) and Alfven cascades (ACs) have allowed to identify both loss mechanisms. While single ACs and TAEs eject resonant fast-ions in a convective process, the overlapping of AC and TAE spatial structures leads to a large fast-ion diffusion and loss. The threshold for diffusive fast-ion losses depends on the ion energy (gyroradius). Diffusive fast-ion losses with gyroradius ∼70 mm have been observed with a single TAE for local radial displacements of the magnetic field lines larger than ∼2 mm. Multiple frequency chirping ACs cause an enhancement of the diffusive losses. The ACs and TAEs radial structures have been reconstructed by means of cross-correlation techniques between the fast-ion loss detector and the electron cyclotron emission radiometer.

  1. Transport ac losses in Bi-2223 multifilamentary tapes - conductor materials aspect

    Energy Technology Data Exchange (ETDEWEB)

    Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge BC2 3QZ (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Institute of Electrical Engineering, SAS, Bratislava (Slovakia)

    2000-05-01

    Transport ac losses in technical superconductors based on Bi-2223 tape material are influenced by many parameters. The major factors that define the ac performance of such conductors are the following: the size and number of filaments, their geometrical arrangement in the cross-section of the conductor, the twist pitch length, the resistivity of the matrix, the presence of oxide barriers around the filaments and deformation procedures such as sequential pressing or rolling followed by appropriate thermal treatment. In the present paper the above aspects are addressed from the viewpoint of the materials science of technical conductor design. Transport ac losses at power frequencies in different types of Bi-2223 conductor are presented and analysed. The results of conductor design analysis with respect to the coexistence of the superconductor with other materials in the conductor structure are presented. New concepts for minimization of the transport ac losses are discussed in detail. (author)

  2. AC magnetization loss characteristics of HTS coated-conductors with magnetic substrates

    International Nuclear Information System (INIS)

    Tsukamoto, O.; Liu, M.; Odaka, S.; Miyagi, D.; Ohmatsu, K.

    2007-01-01

    AC magnetization loss characteristics of an HTS coated tape conductor with magnetic substrate subjected to an external AC magnetic field were investigated. The external magnetic field was perpendicular or parallel to the wide face of the tape conductor. Magnetization losses in the conductor and in the magnetic substrate itself without the superconductor layer, were measured by electric and calorimetric methods. The influence of the magnetic property of the substrate was strongly dependent on the direction of the external magnetic field. When the external magnetic field was perpendicular, magnetic property of the substrate did not affect the magnetization loss characteristics. This result suggests that the magnetization losses can be reduced by subdivisions of the superconducting layers even in the case of magnetic substrate conductors. When the external magnetic field was parallel, the magnetization losses were dominated by the losses in the magnetic substrate. Therefore, to reduce the magnetization losses in this case, reduction of magnetization losses in the substrate is necessary

  3. AC losses for the various voltage-leads in a semi-triple layer BSCCO conductor

    International Nuclear Information System (INIS)

    Li, Z.; Ryu, K.; Hwang, S.D.; Cha, G.; Song, H.J.

    2011-01-01

    Two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer. Voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The loss from the total-lead significantly differs from the sum of the wire losses. In order to investigate the AC loss of the multilayer conductor in a high temperature superconductor cable, a voltage-lead was generally attached to the outermost layer of the conductor. But the conductor's AC loss has not been completely cleared due to the various contact positions and arrangements of the voltage-lead. In this paper, we prepared a semi-triple layer conductor consisting of an inner layer and an outer layer with double layer structure. To measure the AC loss of the conductor, two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer and arranged along their surfaces, as well as another voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The results show that the AC losses for each layer measured from the inner-lead and the outer-lead, respectively, are identical to the sum of the wire losses. The AC losses in the semi-triple layer conductor measured from the total-lead and the outer-lead are identical for the uniform layer current density, and similar to the sum of the wire losses in both layers. However, the losses measured for the non-uniform layer current density from three voltage-leads are unequal to each other, and the loss from the total-lead significantly differs from the sum of the wire losses.

  4. Measurement of AC losses in different former materials

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa

    1998-01-01

    candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible...

  5. Distribution of AC loss in a HTS magnet for SMES with different operating conditions

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Y., E-mail: xuyinghust@163.com [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Tang, Y.; Ren, L.; Jiao, F. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Song, M.; Cao, K.; Wang, D. [Yunnan Electric Power Research Institute, Kunming City 650217 (China); Wang, L.; Dong, H. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China)

    2013-11-15

    Highlights: •We present a model to calculate the distribution of AC loss for a storage magnet. •Comparative analysis of AC loss with different operating conditions has done. •The nonuniform distribution factor “d” is proposed to estimate the inhomogeneity of a storage magnet. •The model predicts the loss distribution and crucial areas which are suffering from the high AC loss. This is significant for the conduction-cooled structure design. -- Abstract: The AC loss induced in superconducting tape may affect the performance of a superconducting device applied to power system, such as transformer, cable, motor and even Superconducting Magnetic Energy Storage (SMES). The operating condition of SMES is changeable due to the need of compensation to the active or reactive power according to the demand of a power grid. In this paper, it is investigated that the distribution of AC loss for a storage magnet on different operating conditions, which is based on finite element method (FEM) and measured properties of BSCCO/Ag tapes. This analytical method can be used to optimize the SMES magnet.

  6. Ac loss measurements on a superconducting transformer for a 25 kA superconducting rectifier

    NARCIS (Netherlands)

    ten Kate, Herman H.J.; Mulders, J.M.; de Reuver, J.L.; van de Klundert, L.J.M.

    1984-01-01

    Ac loss measurements have been performed on a superconducting transformer. The transformer is a part of a 25 kA thermally switched superconducting rectifier operating at a frequency of 0.1 Hz. The loss measurements have been automatized by means of a microcomputer sampling four relevant signals and

  7. AC magnetization loss characteristics of HTS striated coated conductors with magnetic substrates

    International Nuclear Information System (INIS)

    Tsukamoto, O; Alamgir, A K M; Sekizawa, S; Miyagi, D

    2008-01-01

    AC magnetization losses in subdivided CC (Coated Conductor) with magnetic substrate were experimentally investigated comparing with those in subdivided CC with non-magnetic substrate for an AC external magnetic field perpendicular to the wide face of the CC. It is well known that the subdivision is effective to reduce magnetization losses in CC with non-magnetic substrate. The experimental results show that the subdivision is also effective for the CC with magnetic substrate and that the level of reduction of the losses by the subdivisions is almost the same as that of non-magnetic substrate CCs. It is concluded from the experimental results that the magnetic property of the substrate does not affect the magnetization losses in the subdivided conductor in the range of the experiment where the amplitude of the AC external magnetic field is 0 ∼ 0.1 T and the frequency is 16 ∼ 86 Hz

  8. AC magnetization loss characteristics of HTS striated coated conductors with magnetic substrates

    Energy Technology Data Exchange (ETDEWEB)

    Tsukamoto, O; Alamgir, A K M; Sekizawa, S [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama, Kanagawa, 240-8501 (Japan); Miyagi, D [Okayama University, 1-1, Tsushima-Naka, 1-Chome, Okayama 700-8530 (Japan)], E-mail: Osami-t@ynu.ac.jp

    2008-02-01

    AC magnetization losses in subdivided CC (Coated Conductor) with magnetic substrate were experimentally investigated comparing with those in subdivided CC with non-magnetic substrate for an AC external magnetic field perpendicular to the wide face of the CC. It is well known that the subdivision is effective to reduce magnetization losses in CC with non-magnetic substrate. The experimental results show that the subdivision is also effective for the CC with magnetic substrate and that the level of reduction of the losses by the subdivisions is almost the same as that of non-magnetic substrate CCs. It is concluded from the experimental results that the magnetic property of the substrate does not affect the magnetization losses in the subdivided conductor in the range of the experiment where the amplitude of the AC external magnetic field is 0 {approx} 0.1 T and the frequency is 16 {approx} 86 Hz.

  9. AC losses and stability on large cable-in-conduit superconductors

    Science.gov (United States)

    Bruzzone, Pierluigi

    1998-12-01

    The cable-in-conduit superconductors are preferred for applications where the AC losses and stability are a major concern, e.g., fusion magnets and SMES. A review of coupling currents loss results for both NbTi and Nb 3Sn cable-in-conduit conductors (CICC) is presented and the AC loss relevant features are listed, with special emphasis for the role of the interstrand resistance and strand coating. The transient stability approach for CICCs is discussed and the analytical models are quoted as well as the relevant experimental database. The likely spectrum of transient disturbance in CICC is reviewed and the need to account for interstrand current sharing in the design is outlined. Eventually a practical criterion for the interstrand resistance is proposed to link the stability and AC loss design.

  10. Modelling and measurement of ac loss in BSCCO/Ag-tape windings

    International Nuclear Information System (INIS)

    Oomen, M P; Nanke, R; Leghissa, M

    2003-01-01

    High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications

  11. A numerical method to estimate AC loss in superconducting coated conductors by finite element modelling

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Z; Jiang, Q; Pei, R; Campbell, A M; Coombs, T A [Engineering Department, University of Cambridge, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)

    2007-04-15

    A finite element method code based on the critical state model is proposed to solve the AC loss problem in YBCO coated conductors. This numerical method is based on a set of partial differential equations (PDEs) in which the magnetic field is used as the state variable. The AC loss problems have been investigated both in self-field condition and external field condition. Two numerical approaches have been introduced: the first model is configured on the cross-section plane of the YBCO tape to simulate an infinitely long superconducting tape. The second model represents the plane of the critical current flowing and is able to simulate the YBCO tape with finite length where the end effect is accounted. An AC loss measurement has been done to verify the numerical results and shows a good agreement with the numerical solution.

  12. Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing

    Energy Technology Data Exchange (ETDEWEB)

    Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory

    2009-10-01

    The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.

  13. AC loss measurement of superconducting dipole magnets by the calorimetric method

    International Nuclear Information System (INIS)

    Morita, Y.; Hara, K.; Higashi, N.; Kabe, A.

    1996-01-01

    AC losses of superconducting dipole magnets were measured by the calorimetric method. The magnets were model dipole magnets designed for the SSC. These were fabricated at KEK with 50-mm aperture and 1.3-m overall length. The magnet was set in a helium cryostat and cooled down to 1.8 K with 130 L of pressurized superfluid helium. Heat dissipated by the magnet during ramp cycles was measured by temperature rise of the superfluid helium. Heat leakage into the helium cryostat was 1.6 W and was subtracted from the measured heat to obtain AC loss of the magnet. An electrical measurement was carried out for calibration. Results of the two methods agreed within the experimental accuracy. The authors present the helium cryostat and measurement system in detail, and discuss the results of AC loss measurement

  14. Measurement of AC losses in superconducting tapes by reproduction of thermometric dynamic response

    Energy Technology Data Exchange (ETDEWEB)

    Ligneris, Benoit des; Aubin, Marcel; Cave, Julian

    2003-04-15

    We have developed a dynamic response thermometric method for the measurement of AC losses in high T{sub c} superconductors. This method is based on the comparison of a temperature response caused by a known dissipation in the sample with that produced by the AC losses. By passing a DC current and measuring the DC voltage and corresponding temperature response the sample can be used as its own power dissipation reference. The advantages of this method are the short measurement duration time and the possibility to vary many experimental conditions: for example, AC and DC transport currents and AC, DC and rotating applied magnetic fields. In this article we present the basic method using variable short pulses of constant DC current for calibration and similarly of constant amplitude AC current to create the losses. The losses are obtained by numerical modelling and comparison of the thermometric dynamic response in the two above conditions. Finally, we present some experimental results for a Bi2223 superconducting tape at 50 Hz and 77 K.

  15. Transport ac loss studies of YBCO coated conductors with nickel alloy substrates

    International Nuclear Information System (INIS)

    Duckworth, R C; Thompson, J R; Gouge, M J; Lue, J W; Ijaduola, A O; Yu, D; Verebelyi, D T

    2003-01-01

    Transport alternating current (ac) loss measurements were performed on a series of rolling-assisted biaxially textured substrate (RABiTS) processed YBa 2 Cu 3 O x (YBCO) coated conductors at 77 K. While each sample possessed a 1 μm layer of YBCO and a 3 μm silver cap layer, two different nickel alloy substrates were used and their impact on the ac loss was examined. Both substrates possessed a 75 μm Ni-5 at%W base, but one substrate also had a 2 μm nickel overlayer as part of the buffer layer architecture. The ac losses, which were determined by thermal and electrical measurements, contained two dominant contributions: superconductive hysteresis in the YBCO and ferromagnetic hysteresis in the substrates. The superconductive component followed the Norris elliptic model for the substrate with the nickel overlayer and the Norris thin strip model for the substrate without the nickel overlayer. The substrates' ferromagnetic loss was determined separately through magnetization measurements, which showed that this loss contribution was independent of the presence of the nickel overlayer for effective ac currents less than 50 A. While the overall loss was lower for the thin-strip-like conductor with no nickel overlayer, further research is necessary to strengthen this connection

  16. AC Loss Analysis of MgB2-Based Fully Superconducting Machines

    Science.gov (United States)

    Feddersen, M.; Haran, K. S.; Berg, F.

    2017-12-01

    Superconducting electric machines have shown potential for significant increase in power density, making them attractive for size and weight sensitive applications such as offshore wind generation, marine propulsion, and hybrid-electric aircraft propulsion. Superconductors exhibit no loss under dc conditions, though ac current and field produce considerable losses due to hysteresis, eddy currents, and coupling mechanisms. For this reason, many present machines are designed to be partially superconducting, meaning that the dc field components are superconducting while the ac armature coils are conventional conductors. Fully superconducting designs can provide increases in power density with significantly higher armature current; however, a good estimate of ac losses is required to determine the feasibility under the machines intended operating conditions. This paper aims to characterize the expected losses in a fully superconducting machine targeted towards aircraft, based on an actively-shielded, partially superconducting machine from prior work. Various factors are examined such as magnet strength, operating frequency, and machine load to produce a model for the loss in the superconducting components of the machine. This model is then used to optimize the design of the machine for minimal ac loss while maximizing power density. Important observations from the study are discussed.

  17. Study of structure of HTS coated conductor with ferromagnetic substrate having low AC transport current loss using FEM

    International Nuclear Information System (INIS)

    Miyagi, D.; Amadutsumi, Y.; Takahashi, N.; Tsukamoto, O.

    2007-01-01

    AC transport current losses of coated conductors with ferromagnetic substrates are higher than the loss calculated by the Norris equation. In order to reduce the AC transport current loss we propose in this paper a structure of the coated conductor that has wider substrate than the SC (Superconducting) layer. The current distribution and AC loss of the proposed model are analyzed by means of FEM. The AC transport current loss is reduced due to the change of current density distribution near the edge of SC layer, consequent to the high value of magnetic permeability of the ferromagnetic substrate, that is wider than the SC layer

  18. Bean model and ac losses in Bi2Ca2Cu3O10/Ag tapes

    International Nuclear Information System (INIS)

    Suenaga, M.; Chiba, T.; Wiesmann, H.J.; Haldar, P.

    1997-01-01

    The Bean model is almost solely used to interpret ac losses in the powder-in-tube processed composite conductor, Bi 2 Sr 2 Ca 2 Cu 3 O 10 /Ag. In order to examine the limits of the applicability of the model, a detailed comparison was made between the values of critical current density J c for Bi(2223)/Ag tapes which were determined by standard four-probe-dc measurement, and which were deduced from the field dependence of the ac losses utilizing the model. A significant inconsistency between these values of J c were found, particularly at high fields. Possible sources of the discrepancies are discussed

  19. Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

    Science.gov (United States)

    Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.

    2010-11-01

    AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

  20. Geometry dependence of magnetic and transport AC losses in Bi-2223/Ag tapes with different aspect ratios

    Energy Technology Data Exchange (ETDEWEB)

    Fang, J [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Luo, X M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Chen, D X [ICREA and Grup Electromagnetisme, Departament de Fisica, Universitat Autonoma Barcelona, 08193 Bellaterra (Spain); Alamgir, A K M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Collings, E W [MSE, Ohio State University, Columbus, OH 43210 (United States); Lee, E [MSE, Ohio State University, Columbus, OH 43210 (United States); Sumption, M D [MSE, Ohio State University, Columbus, OH 43210 (United States); Fang, J G [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Yi, H P [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Song, X H [Innova Superconductor Technology Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Guo, S Q [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Liu, M L [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Xin, Y [Innopower Superconductor Cable Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Han, Z [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)

    2004-10-01

    On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field.

  1. Geometry dependence of magnetic and transport AC losses in Bi-2223/Ag tapes with different aspect ratios

    International Nuclear Information System (INIS)

    Fang, J; Luo, X M; Chen, D X; Alamgir, A K M; Collings, E W; Lee, E; Sumption, M D; Fang, J G; Yi, H P; Song, X H; Guo, S Q; Liu, M L; Xin, Y; Han, Z

    2004-01-01

    On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field

  2. Effect of reduction of mechanical losses in AC superconducting coils having various FRP bobbins

    International Nuclear Information System (INIS)

    Sekine, N.; Tada, S.; Higuchi, T.; Takao, T.; Yamanaka, A.; Fukui, S.

    2004-01-01

    We have demonstrated in our previous works that a use of the particular structural material for superconducting coils was effective to mechanical-loss reduction under AC operation. In this study, we measured losses to investigate influence of the mechanical losses in the coils having various fiber reinforced plastics (FRPs) with different thermal expansion coefficients. The losses were small in the coils whose winding tension at coil-operating temperature were strong, on the contrary, the losses of the coil having the weak winding tension were large. The coil having the strongest winding tension at liquid helium temperature showed the smallest loss in all coils, and the loss agreed with a value from the Norris's analysis. We think that the mechanical loss becomes almost zero in this coil since the strong tension can prevent the periodic vibration of the superconducting wire. The dependence of the loss on the difference in surface conditions of the materials of the superconducting coil's bobbins was not observed, however, the mechanical losses in AC coils strongly depended on the winding tensions at cryogenic temperature

  3. Low AC Loss in a 3 kA HTS Cable of the Dutch Project

    Science.gov (United States)

    Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan; Willén, Dag; Lentge, Heidi; Thidemann, Carsten; Traeholt, Chresten; Melnik, Irina; Geschiere, Alex

    Requirements for a 6 km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160 mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in the cable, potentially affecting public acceptance of the project. A way out would be to substantially reduce AC losses from 1 down to about 0.1 W/m per phase at rated current of 3 kArms, frequency of 50 Hz and temperature of 77 K. In this paper we discuss a strategy towards this ambitious goal, a concept design of the single phase cable 3 kA conductor made of YBCO tapes and present corresponding experimental and simulation data supporting the developed approach leading directly to this goal. HTS cable model was made that show a drastically reduced AC loss. The low loss was achieved by using appropriate pitch angles for two-layer cable conductor of relatively large diameter, by minimizing the gaps between the HTS tapes, and by using narrow HTS tapes that conform well to the roundness of the underlying former. AC loss of 0.12 W/m at 3 kArms was measured at a frequency of 60 Hz and at a temperature of 77 K.

  4. AC loss in the superconducting cables of the CERN Fast Cycled Magnet Prototype

    NARCIS (Netherlands)

    Borgnolutti, F.; Bottura, L.; Nijhuis, Arend; Zhou, Chao; Liu, Bo; Miyoshi, Y.; Krooshoop, Hendrikus J.G.; Richter, D.

    2011-01-01

    Fast Cycled Superconducting Magnets (FCM's) are an option of interest for the long-term consolidation and upgrade plan of the LHC accelerator complex. The economical advantage of FCM's in the range of 2 T bore field, continuously cycled at 0.5 Hz repetition rate, depends critically on the AC loss

  5. Persistent breather excitations in an ac-driven sine-Gordon system with loss

    International Nuclear Information System (INIS)

    Lomdahl, P.S.; Samuelsen, M.R.

    1986-01-01

    In a sine-Gordon system with loss and applied ac driver, a breather can be maintained as a persistent entrained oscillation if the driver is strong enough. The threshold field is determined by a perturbation method and compared to numerical experiments. Excellent agreement is found

  6. AC-loss considerations of a pulse SMES for an accelerator

    International Nuclear Information System (INIS)

    Lyly, M; Hiltunen, I; Jaervelae, J; Korpela, A; Lehti, L; Stenvall, A; Mikkonen, R

    2010-01-01

    In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.

  7. AC loss in superconducting wires operating in a wind turbine like generator

    DEFF Research Database (Denmark)

    Seiler, Eugen; Zirngibl, Thomas; Mijatovic, Nenad

    2010-01-01

    We have manufactured a small circular superconducting coil impregnated with epoxy fibreglass. The coil was wound from a Bi-2223/Ag superconducting wire and it was tested in liquid nitrogen at 77 K. Current-voltage characteristic and the AC losses of the coil were measured and compared...

  8. Theoretical analysis on ac loss properties of two-strand parallel conductors composed of superconducting multifilamentary strands

    CERN Document Server

    Iwakuma, M; Funaki, K

    2002-01-01

    The ac loss properties of two-strand parallel conductors composed of superconducting multifilamentary strands were theoretically investigated. The constituent strands generally need to be insulated and transposed for the sake of uniform current distribution and low ac loss. In case the transposition points deviate from the optimum ones, shielding current is induced according to the interlinkage magnetic flux of the twisted loop enclosed by the insulated strands and the contact resistances at the terminals. It produces an additional ac loss. Supposing a simple situation where a two-strand parallel conductor with one-point transposition is exposed to a uniform ac magnetic field, the basic equations for the magnetic field were proposed and the theoretical expressions of the additional ac losses derived. As a result, the following features were shown. The additional ac loss in the non-saturation case, where the induced shielding current is less than the critical current of a strand, is proportional to the square ...

  9. Low field critical currents and ac losses of thin film niobium--tin superconductors

    International Nuclear Information System (INIS)

    Howard, R.E.

    1977-01-01

    The results of a study of the low field critical current and ac loss properties of niobium-tin thin films and layered composites fabricated by electron-beam coevaporation are presented. Particular emphasis is placed upon determining the suitability of this material for use as a conductor in a superconducting power transmission line. Chapter I contains a summary of this work and its major results together with an introduction to the scientific and engineering concepts associated with a superconducting power transmission line. Chapter II is a discussion of the physics of current transport and the associated loss mechanisms in a type-II superconductor. Chapter III gives the details of the electron-beam coevaporation technique developed to fabricate the samples for this study. Also discussed in this chapter are the effects of the evaporation conditions on the growth morphology of the niobium-tin films. Chapter IV presents the details of the experimental techniques developed to measure the ac loss and critical current in these samples as a function of temperature. Chapter V shows the dependence of the critical current of these films and composites on temperature, magnetic field, and on the number of artificially introduced pinning centers in the layered composites. Experimental results are also presented concerning the stability of these conductors against flux jumps. Chapter VI is a discussion of the ac losses in these samples. Detailed comparisons are made between the measured loss and the predictions of the critical state model

  10. AC losses in multilayer power transmission cables comprised of YBCO tapes

    International Nuclear Information System (INIS)

    Noji, H.

    2011-01-01

    I calculate AC properties in YBCO cable by an electric circuit model. The optimal helical pitches are determined by the calculation. The layer's current distribution is uniform on the optimal helical pitches. The calculation is useful as a first approximation of AC losses. AC losses in multilayer power transmission cables can be reduced by adjusting the helical winding pitch of each layer to make the layer's current distribution uniform. The optimum helical pitch can be estimated using an electric circuit (EC) model based on the expression that calculates the losses in the superconducting tapes composing the cable. It is known that the losses in a monolayer cable depend on the cable parameters (i.e., the gap between neighboring tapes, number of tapes N, diameter of the cable former and width of the tape). However, regarding Amemiya et al.'s measurement on the losses in monolayer cables, the numerical results of the losses calculated using the Norris formula for an isolated thin strip N times are close to the experimental results. Then, to determine the losses in a three-layer cable that Mukoyama et al. have reported, the losses are calculated by the EC model based on the Norris formula. The helical pitch of each layer is adjusted to make the layer's current distribution uniform in the cable reported by Mukoyama et al. The optimum helical pitches are calculated using the condition where the standard deviation of the layer currents is minimum, and the losses of the cable at the optimum helical pitches are calculated at 1 kA rms . By comparing the results of these calculations with the previously measured results, it was found that the mean error of the calculated values relative to the measured values is 23.7%, which indicates that the calculation using the EC model is useful as a first approximation.

  11. Ripple Field AC Losses in 10-MW Wind Turbine Generators With a MgB2 Superconducting Field Winding

    DEFF Research Database (Denmark)

    Liu, Dong; Polinder, Henk; Magnusson, Niklas

    2016-01-01

    Superconducting (SC) synchronous generators are proposed as a promising candidate for 10-20-MW direct-drive wind turbines because they can have low weights and small sizes. A common way of designing an SC machine is to use SC wires with high current-carrying capability in the dc field winding...... and the ac armature winding is made with copper conductors. In such generators, the dc field winding is exposed to ac magnetic field ripples due to space harmonics from the armature. In generator design phases, the ac loss caused by these ripple fields needs to be evaluated to avoid local overheating...... and an excessive cooling budget. To determine the applicability of different design solutions in terms of ac losses, this paper estimates the ac loss level of 10-MW wind generator designs employing a MgB2 SC field winding. The effects on ac losses are compared between nonmagnetic and ferromagnetic teeth...

  12. AC loss performance of cable-in-conduit conductor. Influence of cable mechanical property on coupling loss reduction

    International Nuclear Information System (INIS)

    Matsui, Kunihiro; Koizumi, Norikiyo; Isono, Takaaki; Hamada, Kazuya; Nunoya, Yoshihiko

    2003-01-01

    The ITER Central Solenoid (CS) model coil, CS Insert and Nb 3 Al Insert were developed and tested from 2000 to 2002. The AC loss performances of these coils were investigated in various experiments. In addition, the AC losses of the CS and Nb 3 Al Insert conductors were measured using short CS and Nb 3 Al Insert conductors before the coil tests. The coupling time constants of these conductors were estimated to be 30 and 120 ms, respectively. On the other hand, the test results of the CS and Nb 3 Al Inserts show that the coupling currents induced in these conductors had multiple decay time constants. In fact, the existence of the coupling currents with long decay time constants, the order of which was in the thousands of seconds, was directly observed with hall sensors and voltage taps. Moreover, the AC loss test results show that electromagnetic force decreases coupling losses with exponential decay constants. This is because the weak sinter among the strands, which originated during heat treatment, was broken due to the electromagnetic force, and then the contact resistance among strands increased. It was found that this exponential decay constant was the function of a gap (i.e., a mechanical property of the cable) created between the cable and conduit due to electromagnetic force. The gap can be estimated by pressure drop, measured under the electromagnetic force. The pressure drop can easily be measured at an initial trial charge, and then it is possible to estimate the exponential decay constant before normal coil operation. Accordingly, it is possible to predict promptly how many times the trial operations are necessary to decrease the coupling losses to the designed value by measuring the coupling losses and the pressure drop during the initial coil operation trial. (author)

  13. Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors

    International Nuclear Information System (INIS)

    Iijima, Y.; Hosaka, M.; Sadakata, N.; Saitoh, T.; Kohno, O.; Takeda, K.

    1997-01-01

    Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high J c sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low J c sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics

  14. Finite-element analysis and comparison of the AC loss performance of BSCCO and YBCO conductors

    International Nuclear Information System (INIS)

    Stavrev, Svetlomir; Grilli, Francesco; Dutoit, Bertrand; Ashworth, Stephen

    2006-01-01

    The AC loss performance of two BSCCO and two YBCO conductors of different geometry, characterized by the same self-field critical current of 150 A, is analysed and compared quantitatively. The comparison is made using the finite-element method with a nonlinear B-dependent E-J relation. A new shell-region model is utilised for the simulations of thin YBCO strips. Different AC working conditions are simulated: self-field, applied external field, and combined transport current and external perpendicular field application. Magnetic field and current density profiles are investigated in order to illustrate the reasons for the loss difference in the conductors. Depending on the application, the advantages of using BSCCO or YBCO conductors with specific geometry are outlined

  15. AC losses in superconductors: a multi-scale approach for the design of high current cables

    International Nuclear Information System (INIS)

    Escamez, Guillaume

    2016-01-01

    The work reported in this PhD deals with AC losses in superconducting material for large scale applications such as cables or magnets. Numerical models involving FEM or integral methods have been developed to solve the time transient electromagnetic distributions of field and current densities with the peculiarity of the superconducting constitutive E-J equation. Two main conductors have been investigated. First, REBCO superconductors for applications operating at 77 K are studied and a new architecture of conductor (round wires) for 3 kA cables. Secondly, for very high current cables, 3-D simulations on MgB_2 wires are built and solved using FEM modeling. The following chapter introduced new development used for the calculation of AC losses in DC cables with ripples. The thesis ends with the use of the developed numerical model on a practical example in the european BEST-PATHS project: a 10 kA MgB_2 demonstrator [fr

  16. AC losses in a type II superconductor strip with inhomogeneous critical current distribution

    International Nuclear Information System (INIS)

    Tsukamoto, Osami

    2005-01-01

    Analytical formulae derived by Brandt and Indenbom (1993 Phys. Rev. B 48 12893-906) and Norris (1970 J. Phys. D: Appl. Phys. 3 489-507) are often used to calculate the magnetization and AC transport current losses in HTS strip conductors, respectively. In these formulae, homogeneous distribution of critical sheet current density σ c in the strip is assumed. However, it is considered that σ c distributions are inhomogeneous in actual HTS strips and that the inhomogeneous σ c distributions cause deviations of the measured AC loss data of actual HTS strips from those formulae. A semi-analytical method to calculate AC transport current and magnetization losses is derived for a type II superconductor strip with inhomogeneous distribution of σ c in the direction of the strip width. The method is derived modifying the analysis of Brandt et al. The validity of the semi-analytical method is shown by comparing the results calculated by this method with those calculated by the Norris and Brandt formulae and by a different method of our previous work and also with experimental data. Moreover, it is shown that the deviation of the measured data from the Norris and Brandt models can be estimated by assuming proper σ c distributions

  17. Inkjet printing of multifilamentary YBCO for low AC loss coated conductors

    International Nuclear Information System (INIS)

    Hopkins, S C; Joseph, D; Mitchell-Williams, T B; Glowacki, B A; Calleja, A; Vlad, V R; Vilardell, M; Ricart, S; Granados, X; Puig, T; Obradors, X; Usoskin, A; Falter, M; Bäcker, M

    2014-01-01

    Considerable progress has been made with the development of REBCO coated conductors in recent years, and high performance conductors are available commercially. For many applications, however, the cost remains prohibitive, and AC losses discourage their selection for higher frequency applications. Chemical solution deposition (CSD) methods are attractive for low-cost, scalable preparation of buffer and superconductor layers, and in many respects inkjet printing is the method of choice, permitting non-contact deposition with minimal materials wastage and excellent control of coating thickness. Highly textured coatings of YBCO and Gd-doped CeO 2 have previously been reported on buffered metal substrates. Inkjet printing also introduces the possibility of patterning - directly depositing two and three dimensional structures without subtractive processing - offering a low-cost route to coated conductors with reduced AC losses. In this contribution, the inkjet deposition of superconducting YBCO tracks is reported on industrially relevant buffered metal substrates both by direct printing and an inverse patterning approach. In the latter approach, ceria tracks were printed reported, which are a candidate both for resistive filament spacers and buffer layers. TFA-based precursor solutions have been printed on SS/ABAD-YSZ/CeO 2 and Ni-W/LZO/CeO 2 RABiTS substrates, and the resulting multifilamentary samples characterised by microscopy and scanning Hall probe measurements. The prospects for future inkjet-printed low AC loss coated conductors are discussed, including control of interfilamentary resistivity and bridging, transposed filamentary structures and stabilisation material.

  18. Dependence of the ac loss on the aspect ratio in a cable in conduit conductor

    International Nuclear Information System (INIS)

    Cau, F; Bruzzone, P

    2010-01-01

    The coupling current loss in rectangular superconducting cables is strictly dependent on their aspect ratio, which has an impact on the area linked by the field variation and consequently on the currents induced between strands. The relation between the ac loss and aspect ratio is studied with reference to the testing of three short cable in conduit conductor (CICC) samples at the SULTAN test facility. The first conductor is a 25 kA NbTi cable for the JT60-SA tokamak; the second is a 20 kA Nb 3 Sn cable for the HZB hybrid magnet. The last CICC is a 68 kA Nb 3 Sn cable with layout similar to that of the ITER toroidal field (TF) conductor (called the 'European toroidal field (EUTF) alternate'). All the samples are assembled with two conductor sections differing only in their orientation with respect to the external variable field. In the first and third samples, the cable of one leg is rotated by 90 0 , while in the HZB sample it is rotated by 45 0 with respect to the other leg. The ac loss is measured at the SULTAN test facility using a gas flow calorimetric method. A sample length of 39 cm is exposed to a sinusoidal field with an amplitude of ± 0.3 or ± 0.2 T (depending on the superconductor) and frequency variable in the range 0.1-0.8 Hz. A background field of 2 T perpendicular both to the sinusoidal field and to the sample axis is also applied. The ac loss is assessed by measuring the variation of the He enthalpy, assuming the metal enthalpy to be negligible. The loss curve for both legs is discussed in terms of the respective aspect ratios and the results, including data from former test campaigns, are compared with the aim of finding an analytical relation between the loss and the conductor dimensions.

  19. Low frequency AC losses in multi filamentary superconductors up to 15 Tesla

    International Nuclear Information System (INIS)

    Orlando, T.; Braun, C.; Foner, S.; Schwartz, B.; Zieba, A.

    1983-01-01

    Low frequency (1 Hz) ac losses were measured in a variety of A15 superconducting wires having different fiber geometries. Field modulations ofless than or equal to 1 tesla were superimposed on a fixed background field up to 15 tesla. Losses were measured for Nb 3 Sn in continuous fiber, modified jelly-roll, In Situ, and powder metallurgy processed materials, and for Nb 3 Al powder metallurgy processed materials. The results are compared with dc magnetization measurements. The losses are purely hysteretic at these low frequencies, scale with J /SUB c/ (above about 3 tesla), and are reduced substantially by twisting for all the materials. The lowest losses are observed for the Nb 3 Al wires

  20. AC loss characteristics of Bi2223/Ag sheathed tape wires subjected to mechanical strains and stresses

    International Nuclear Information System (INIS)

    Tsukamoto, Osami; Li, Z

    2007-01-01

    The influence of uniaxial tensile stress-strain on the AC loss characteristics of multifilamentary Bi2223/Ag sheathed tape wires was investigated. The uniaxial tensile stress-strain was applied to the sample wire in liquid nitrogen at atmospheric pressure, and the AC losses (transport, magnetization and total losses) were measured by an electric method. Two kinds of wire, oxide-dispersion strengthened Ag-alloy sheathed and Ag-alloy sheathed wires, were tested. The stress-strain curves of the tested wires were divided in three regions, i.e. elastic deformation, continuous plastic deformation and serrated-like plastic deformation regions, though the ranges of those regions were different for different kinds of wire. In the elastic and continuous plastic regions, the stress-strain curve was smooth and continuous, and in the serrated-like plastic region, the curve was rough. In the serrated-like plastic region, the wires kept elongating, while increase of the tensile stress was suspended. Dependences of the critical currents on the stress-strain were generally as follows. While decreases of the wire critical currents were in the range of less than 4% of the original values of the no-stress condition, the critical currents of the wires were reversible, that is, the critical currents recovered the original values at zero stress when the stress were released, regardless of whether the wires were in the elastic or continuous plastic region. In the continuous plastic region, the critical currents decreased up to 10%-15% of the original values and the critical currents were irreversible when the degradations of the critical currents exceeded about 4%. In the serrated-like plastic regions, the critical currents were more severely degraded. The AC loss characteristics of the wires are different in those regions. In the elastic and continuous plastic regions, the absolute values of AC losses were dependent on the stress-strain. However, the dependences of those normalized

  1. Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)

    International Nuclear Information System (INIS)

    Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.

    2007-01-01

    Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured

  2. Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)

    Science.gov (United States)

    Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.

    2007-10-01

    Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured.

  3. Magnetic hysteresis and complex susceptibility as measures of ac losses in a multifilamentary NbTi superconductor

    International Nuclear Information System (INIS)

    Goldfarb, R.B.; Clark, A.F.

    1985-01-01

    Magnetization and ac susceptibility of a standard NbTi superconductor were measured as a function of longitudinal dc magnetic field. The ac-field-amplitude and frequency dependences of the complex susceptibility are examined. The magnetization is related to the susceptibility by means of a theoretical derivation based on the field dependence of the critical current density. Hysteresis losses, obtained directly from dc hysteresis loops and derived theoretically from ac susceptibility and critical current density, were in reasonable agreement

  4. ac loss and dc critical current densities of Nb3Sn tapes by the solid state diffusion process

    International Nuclear Information System (INIS)

    Suenaga, M.; Klamut, C.; Bussiere, J.F.

    1976-01-01

    The effects of metallurgical processing on 60 Hz ac losses and dc critical currents in Nb 3 Sn tapes fabricated by the solid state diffusion technique were investigated. An addition of Al to the Cu--Sn alloy for the matrix resulted in large reduction in the ac losses of Nb 3 Sn tapes, but the highest linear critical current densities were observed in Nb 3 Sn tapes produced with a Nb-1 wt percent Zr core in a Cu-13 wt percent Sn matrix. Values of the losses and the critical currents in these tapes can meet the present requirements for the ac superconducting power cables

  5. Evolution of beam losses after a power cut of the SR7 AC supply

    CERN Document Server

    GOMEZ ALONSO, A

    2009-01-01

    Magnet failures in the LHC could lead to equipment damage if the energy stored in the accelerator was not discharged properly. The Machine Protection Systems (MPS) ensure this proper discharge and knowledge about the evolution of losses in case of failure is needed to evaluate the adequacy of the protection. A power cut of the AC supply in SR7 would lead to a simultaneous current decay in three normal conducting circuits. The evolution of the losses after such failure is slow, with a loss time constant of more than 100 ms both at 450 GeV and 7 TeV, and in both cases the damage level is not reached before 45 ms. This leaves sufficient time for the MPS to ensure redundant protection. A similar scenario would be expected for a power cut at SR3.

  6. Evaluation of Core Loss in Magnetic Materials Employed in Utility Grid AC Filters

    DEFF Research Database (Denmark)

    Beres, Remus Narcis; Wang, Xiongfei; Blaabjerg, Frede

    2016-01-01

    magnetic materials adopted in utility grid ac filters have been investigated and measured for both sinusoidal and rectangular excitation, with and without dc bias condition. The core loss information can ensure cost effective passive filter designs and may avoid trial-error design procedures of the passive......Inductive components play an important role in filtering the switching harmonics related to the pulse width modulation in voltage source converters. Particularly, the filter reactor on the converter side of the filter is subjected to rectangular excitation which may lead to significant losses...... in the core, depending on the magnetic material of choice and current ripple specifications. Additionally, shunt or series reactors that exists in LCL or trap filters and which are subjected to sinusoidal excitations have different specifications and requirements. Therefore, the core losses of different...

  7. Ac-loss measurement of coated conductors: The influence of the pick-up coil position

    International Nuclear Information System (INIS)

    Schmidt, Curt

    2008-01-01

    The ac-loss measurement by the magnetization method requires calibration for obtaining absolute values. A convenient way of calibration is the calorimetric measurement which yields, within the measuring accuracy, absolute loss values. In the magnetization measurement the hysteresis loop of sample magnetization which determines the losses is measured via the integration of magnetic flux penetrating a pick-up coil. The ratio of flux integral to magnetization integral and hence the calibration factor is however, for a given pick-up coil geometry, not exactly a constant, but depends on the magnetization current pattern within the sample. Especially for thin tapes in perpendicular external field this effect has to be taken into consideration in order to avoid miss measurements. The relation between measured flux and sample magnetization was calculated for special cases of magnetization current distribution in the sample as a function of the pick-up coil position. Furthermore calibration factors were measured as a function of the ac-field amplitude and the result compared with available theoretical models. A good agreement was found between experiment and theory

  8. Flux Pinning and AC Loss in Second Generation High Temperature Superconductor Wires

    Energy Technology Data Exchange (ETDEWEB)

    Paranthaman, Mariappan Parans [ORNL; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2007-01-01

    Major advances have been made in the last 18 years in high-temperature superconductor (HTS) reserach and development, resulting in increased use of HTS materials in commerical and pre-commercial electric-power applications. This new and important book addresses the issues related to flux pinning, AC losses and thick YBCO film growth. Written by top most scientists in the world, it presents the current status and issues related to YBCO coated conductors and the need for further fundamental materials science work in YBCO coated conductor. It will be a useful handbook for years to come.

  9. AC losses in (Bi,Pb) 2Sr 2Ca 2Cu 3O x tapes

    Science.gov (United States)

    D'Anna, G.; Indenbom, M. V.; André, M.-O.; Benoit, W.; Grivel, J.-C.; Hensel, B.; Flükiger, R.

    1994-05-01

    A double peak structure is observed in the AC losses of (Bi,Pb) 2Sr 2Ca 2Cu 3O x silver-sheathed tapes using a torsion-pendulum oscillator. The low-temperature peak is associated to the intragrain flux expulsion, while the high-temperature peak results from a macroscopic current path around the whole sample due to a well-coupled fraction of the grains. The flux pinning by the dislocations forming small-angle grain boundaries is suggested to control the transport current.

  10. Lithium-ion backup batteries for coping extended loss of AC power (ELAP)

    International Nuclear Information System (INIS)

    Chang, Choong-koo

    2017-01-01

    Per NRC Regulations Title 10, Code of Federal Regulations (CFR) 50.63 'Loss of all alternating current power' all Korean nuclear power plants have a coping capability for SBO conditions for a limited time ranging from approximately eight (8) to sixteen (16) hours. The 125V DC systems are designed for eight (8) hours range except Class 1E channel A and B 125V DC system of which duty cycle is 2 hours in APR1400. The strategies proposed by this paper for coping extended loss of AC power (ELAP) involve a three-phase approach. In the first extend class 1E batteries' backup time until 24 hours. Then augment class 1E batteries with Lithium-ion batteries by 72 hours from the event initiation. In addition, obtain additional capability and redundancy from off-site equipment until power systems are restored or commissioned. (author)

  11. Application of response theory to steam venting during a loss of AC power transient

    Energy Technology Data Exchange (ETDEWEB)

    Cady, K.B.; Miller, R.J.

    1987-05-01

    We have applied the theory of response to the loss of AC power transient for an LMFBR design to determine the ultimate loss of coolant inventory and the sensitivity of this figure with respect to the initial conditions and input parameters. Using a simple four region heat transfer model, the analysis shows that 3717 kg coolant are vented after feed water is lost and before venting stops. The sensitivity analysis reveals that this figure is strongly dependent on design parameters and system assumptions. The uncertainty in the lost inventory caused by the uncertainties and correlations in the input parameters and initial conditions is found to be 3464 kg. We thus report the result of the calculation as lost inventory (kg)=3717+-3464 and conclude that the available inventory of 8775 kg is sufficient to ensure an adequate heat sink.

  12. Measuring ac losses in superconducting cables using a resonant circuit:Resonant current experiment (RESCUE)

    DEFF Research Database (Denmark)

    Däumling, Manfred; Olsen, Søren Krüger; Rasmussen, Carsten

    1998-01-01

    be recorded using, for example, a digital oscilloscope. The amplitude decay of the periodic voltage or current accurately reflects the power loss in the system. It consists of two components-an ohmic purely exponential one (from leads, contacts, etc.), and a nonexponential component originating from......A simple way to obtain true ac losses with a resonant circuit containing a superconductor, using the decay of the circuit current, is described. For the measurement a capacitor is short circuited with a superconducting cable. Energy in the circuit is provided by either charging up the capacitors...... with a certain voltage, or letting a de flow in the superconductor. When the oscillations are started-either by opening a switch in case a de is flowing or by closing a switch to connect the charged capacitors with the superconductor-the current (via a Rogowski coil) or the voltage on the capacitor can...

  13. Transport ac loss in a rectangular thin strip with power-law E(J) relation

    International Nuclear Information System (INIS)

    Li, Shuo; Chen, Du-Xing; Fan, Yu; Fang, Jin

    2015-01-01

    Highlights: • Transport ac loss in a thin strip with power-law E(J) is systematically computed. • The scaled results can be accurately used for strips with any critical current and frequency. • Experiments may be unambiguously compared with modeling results at a critical frequency. - Abstract: Transport ac losses of a rectangular thin strip obeying relation E/E c =(J/J c ) n with a fixed critical current I c and n=5,10,20,30, and 40 are accurately computed at a fixed frequency f as functions of the current amplitude I m . The results may be interpolated and scaled to those at any values of I c ,f, and 5⩽n⩽40. Normalized in the same way as that in Norris’ analytical formula derived from the critical-state model and converting f to a critical frequency f c , the modeling results may be better compared with the Norris formula and experimental data. A complete set of calculated modeling data are given with necessary formulas to be easily used by experimentalists in any particular case

  14. AC loss time constant measurements on Nb3Al and NbTi multifilamentary superconductors

    International Nuclear Information System (INIS)

    Painter, T.A.

    1988-03-01

    The AC loss time constant is a previously univestigated property of Nb 3 Al, a superconductor which, with recent technological developments, shows some advantages over the more commonly used superconductors, NbTi and Nb 3 Sn. Four Nb 3 Al samples with varying twist pitches and one NbTi sample are inductively measured for their AC loss time constants. The measured time constants are compared to the theoretical time constant limits imposed by the limits of the transverse resistivity found by Carr [5] and to the theoretical time constants found using the Bean Model as well as to each other. The measured time constants of the Nb 3 Al samples fall approximately halfway between the theoretical time constant limits, and the measured time constants of the NbTi sample is close to the theoretical lower time constant limit. The Bean Model adequately accounts for the variance of the permeability of the Nb 3 Al superconductor in a background magnetic field. Finally, the measured time constant values of the Nb 3 Al samples vary approximately according to the square of their twist pitch. (author)

  15. Sensitivity Analysis of Core Damage by Loss of Auxiliary Feed Water during the Extended Loss of All AC Power

    Energy Technology Data Exchange (ETDEWEB)

    Jeon, Woo Jae; Chung, Soon Il; Hwang, Su Hyun; Lee, Kyung Jin; Lee, Byung Chul [FNC Tech., Yongin (Korea, Republic of); Yun, Duk Joo; Lee, Seung Chan [Korea Hydro and Nuclear Power Co. Ltd., Daejeon (Korea, Republic of)

    2015-10-15

    In this study, the reactor core damage time for OPR1000 type Nuclear Power Plant (NPP) was analyzed to develop a strategy to handle ELAP and to apply to the EOP. The reactor core damage time in the ELAP condition was calculated according to the time of Auxiliary Feedwater (AFW) loss. Fukushima accident was caused by long hours of Station Black Out (SBO) caused by natural disaster beyond Design Based Accident (DBA) criteria. It led to the reactor core damage. After the accident, the regulatory authorities of each country (Japan, US, EU, IAEA, and etc.) recommended developing the necessary systems and strategies in order to cover up the Extended Loss of All AC Power (ELAP) such as one occurred in the Fukushima accident. And the need of procedure or guideline to cope with ELAP has been raised through the stress test for Wolsong Nuclear Power Plant unit 1. Current Emergency Operating Procedures (EOP) used in domestic nuclear power plant are seemed to be insufficient to cope with ELAP. Therefore, it has been required to be improved. As the result, the time of AFW loss in the ELAP condition influences greatly on core damage time.

  16. Study of the Effect of Transport Current and Combined Transverse and Longitudinal Fields on the AC Loss in NET Prototype Conductors

    NARCIS (Netherlands)

    Nijhuis, Arend; ten Kate, Herman H.J.

    1994-01-01

    AC losses in cables carrying DC as well as AC transport currents at different DC background fields up to 2T have been measured on three types of Nb3Sn subcables in a new test facility. In this facility it is possible to apply sinusoidal transverse AC fields up to dB/dt=5T/s and longitudinal AC

  17. A two-dimensional finite element method to calculate the AC loss in superconducting cables, wires and coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Z; Jiang, Y; Pei, R; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, CB2 1PZ (United Kingdom); Ye, L [Department of Electrical Power Engineering, CAU, P. O. Box 210, Beijing 100083 (China); Campbell, A M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, CB3 0HE (United Kingdom)], E-mail: Zh223@cam.ac.uk

    2008-02-15

    In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB{sub 2} wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB{sub 2} wires. The results demonstrate that the multi-element MgB{sub 2} wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement.

  18. A model for calculating the AC losses of second-generation high temperature superconductor pancake coils

    Energy Technology Data Exchange (ETDEWEB)

    Yuan Weijia; Campbell, A M; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, Cambridge CB2 1PZ (United Kingdom)], E-mail: wy215@cam.ac.uk

    2009-07-15

    A model is presented for calculating the AC losses of a stack of second-generation high temperature superconductor tapes. This model takes as a starting point the model of Clem and co-workers for a stack in which each tape carries the same current. It is based on the assumption that the magnetic flux lines lie parallel to the tapes within the part of the stack where the flux has not penetrated. In this paper we allow for the depth of penetration of field to vary across the stack, and use the Kim model to allow for the variation of J{sub c} with B. The model is applied to the cases of a transport current and an applied field. For a transport current the calculated result differs from the Norris expression for a single tape carrying a uniform current and it does not seem possible to define a suitable average J{sub c} which could be used. Our method also gives a more accurate value for the critical current of the stack than other methods. For an applied field the stack behaves as a solid superconductor with the J{sub c} averaged locally over several tapes, but still allowed to vary throughout the stack on a larger scale. For up to about ten tapes the losses rise rapidly with the number of tapes, but in thicker stacks the tapes shield each other and the losses become that of a slab with a field parallel to the faces.

  19. Calculating transport AC losses in stacks of high temperature superconductor coated conductors with magnetic substrates using FEM

    International Nuclear Information System (INIS)

    Ainslie, Mark D.; Flack, Tim J.; Campbell, Archie M.

    2012-01-01

    Properties of stacks of HTS coated conductors with and without a magnetic substrate. Non-magnetic substrate model is consistent with existing methods. Presence of a magnetic substrate increases the total AC loss of the stack. Differences and similarities between certain tapes within stacks are explained. Ferromagnetic loss of substrate negligible in most cases except small currents/fields. In this paper, the authors investigate the electromagnetic properties of stacks of high temperature superconductor (HTS) coated conductors with a particular focus on calculating the total transport AC loss. The cross-section of superconducting cables and coils is often modeled as a two-dimensional stack of coated conductors, and these stacks can be used to estimate the AC loss of a practical device. This paper uses a symmetric two dimensional (2D) finite element model based on the H formulation, and a detailed investigation into the effects of a magnetic substrate on the transport AC loss of a stack is presented. The number of coated conductors in each stack is varied from 1 to 150, and three types of substrate are compared: non-magnetic weakly magnetic and strongly magnetic. The non-magnetic substrate model is comparable with results from existing models for the limiting cases of a single tape (Norris) and an infinite stack (Clem). The presence of a magnetic substrate increases the total AC loss of the stack, due to an increased localized magnetic flux density, and the stronger the magnetic material, the further the flux penetrates into the stack overall. The AC loss is calculated for certain tapes within the stack, and the differences and similarities between the losses throughout the stack are explained using the magnetic flux penetration and current density distributions in those tapes. The ferromagnetic loss of the substrate itself is found to be negligible in most cases, except for small magnitudes of current. Applying these findings to practical applications, where AC

  20. The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets

    Energy Technology Data Exchange (ETDEWEB)

    Moore, Martina, E-mail: m.moore@ifw-dresden.de [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Roth, Stefan; Gebert, Annett [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Schultz, Ludwig [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); TU Dresden, Institute for Materials Science, 01062 Dresden (Germany); Gutfleisch, Oliver [TU Darmstadt, Department of Materials Science, Alarich-Weiß-Str. 16, 64287 Darmstadt (Germany); Fraunhofer Project Group for Materials Recycling and Resource Strategies IWKS, 63457 Hanau (Germany)

    2015-02-01

    Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated.

  1. The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets

    International Nuclear Information System (INIS)

    Moore, Martina; Roth, Stefan; Gebert, Annett; Schultz, Ludwig; Gutfleisch, Oliver

    2015-01-01

    Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated

  2. AC loss, interstrand resistance and mechanical properties of prototype EU DEMO TF conductors up to 30 000 load cycles

    Science.gov (United States)

    Yagotintsev, K.; Nijhuis, A.

    2018-07-01

    Two prototype Nb3Sn cable-in-conduit conductors conductors were designed and manufactured for the toroidal field (TF) magnet system of the envisaged European DEMO fusion reactor. The AC loss, contact resistance and mechanical properties of two sample conductors were tested in the Twente Cryogenic Cable Press under cyclic load up to 30 000 cycles. Though both conductors were designed to operate at 82 kA in a background magnetic field of 13.6 T, they reflect different approaches with respect to the magnet winding pack assembly. The first approach is based on react and wind technology while the second is the more common wind and react technology. Each conductor was tested first for AC loss in virgin condition without handling. The impact of Lorentz load during magnet operation was simulated using the cable press. In the press each conductor specimen was subjected to transverse cyclic load up to 30 000 cycles in liquid helium bath at 4.2 K. Here a summary of results for AC loss, contact resistance, conductor deformation, mechanical heat production and conductor stiffness evolution during cycling of the load is presented. Both conductors showed similar mechanical behaviour but quite different AC loss. In comparison with previously tested ITER TF conductors, both DEMO TF conductors possess very low contact resistance resulting in high coupling loss. At the same time, load cycling has limited impact on properties of DEMO TF conductors in comparison with ITER TF conductors.

  3. Self-field AC losses and critical currents in multi-tube Ag-Bi-2223 conductors

    Energy Technology Data Exchange (ETDEWEB)

    Ciszek, M; Ashworth, S P; Campbell, A M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); James, M P; Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); Garre, R; Conti, S [Centro Ricerche Europa Metalli, Fornaci di Barga, LU (Italy)

    1996-05-01

    The purpose of this work was to investigate the influence of different technological treatments of silver sheathed Bi-2223 tapes on the critical current density and the AC transport losses. The tapes were produced using the 'tube-in-tube' technique, by including a silver rod in the centre of the superconducting powder during packing of the silver tube. The aim of the process is to increase the silver to superconductor surface area and thus also the alignment at the centre of the conductor ceramic core. AC transport losses were measured by means of an electrical method using sinusoidally varying currents in the frequency range 30-180 Hz. In this range the power losses are hysteretic. The measured variation in losses from those predicted by a critical state model is attributed to the complex geometry of superconducting regions existing in these tapes. (author)

  4. The Effect of Temperature Dependence of AC Losses in a Bi-2223/Ag Insert of an 8-T Superconducting Magnet

    DEFF Research Database (Denmark)

    Wang, Lei; Wang, Qiuliang; Wang, Hui

    2016-01-01

    A conduction-cooled split-gap superconducting magnet system with a center field of 8 T has been designed and fabricated in the Institute of Electrical Engineering, Chinese Academy of Sciences. The system consists of two Bi-2223/Ag coils and six NbTi coils. Due to a large aspect ratio of the high-...... in the second case. Hence, it is a good way to reduce the ac losses by changing the charging sequences of the Bi-2223/Ag and NbTi cols. Afterward, the calculated results are compared with the experimental data, and they show a good agreement.......A conduction-cooled split-gap superconducting magnet system with a center field of 8 T has been designed and fabricated in the Institute of Electrical Engineering, Chinese Academy of Sciences. The system consists of two Bi-2223/Ag coils and six NbTi coils. Due to a large aspect ratio of the high......-temperature superconducting tape, there will be large ac losses when the magnet is ramped up and down. An accurate estimation of the total ac losses in the high-temperature superconducting coils is essential for the cryogenic system design. In the Bi-2223/Ag coils, the total ac losses mainly originate from two parts: One...

  5. Design and A.C. loss considerations for the 60 mm dipole magnet in the High Energy Booster

    International Nuclear Information System (INIS)

    Snitchler, G.; Jayakumar, R.; Kovachev, V.; Orrell, D.

    1991-01-01

    The baseline design for the SSC High Energy Booster (HEB) has dipole bending magnets with a 50 mm aperture. A recent dynamic aperture study for the High Energy Booster (HEB) suggests that an increased aperture dipole magnet (DM) is desirable. Two cost neutral options for a 60 mm aperture HEBDM design are investigated. Field transfer function, field harmonics, and relative cost impact for these designs are presented. An analysis of the cryogenic heat load due to A.C. losses generated in the HEB ramp cycle are also reported. Included in this analysis are losses from superconductor hysteresis, yoke hysteresis, strand eddy currents, and cable eddy currents. The A.C. loss impact of 2.5 μm vs. 6 μm filament conductor is presented. Superconducting proximity effect is also considered for 2.5 μm filament conductors

  6. Design and A.C. loss considerations for the 60 mm dipole magnet in the high energy booster

    International Nuclear Information System (INIS)

    Snitchler, G.; Jayakumar, R.; Kovachev, V.; Orrell, D.

    1991-04-01

    The baseline design for the SSC High Energy Booster (HEB) has dipole bending magnets with a 50 mm aperture. A recent dynamic aperture study for the High Energy Booster (HEB) suggests that an increased aperture dipole magnet (DM) is desirable. Two cost neutral options for a 60 mm aperture HEBDM design are investigated. Field transfer function, field harmonics, and relative cost impact for these designs are presented. An analysis of the cryogenic heat and load due to A.C. losses generated in the HEB ramp cycle are also reported. Included in this analysis are losses from superconductor hysteresis, yoke hysteresis, strand eddy currents, and cable eddy currents. The A.C. loss impact of 2.5 μm vs. 6 μm filament conductor will be presented. Superconducting proximity effect is also considered for 2.5 μm filament conductors. 13 refs., 3 figs., 7 tabs

  7. AC losses in Ag-sheathed Bi2223 tapes with Ca2CuO3 as interfilamentary resistive barriers

    International Nuclear Information System (INIS)

    Inada, R.; Iwata, Y.; Tateyama, K.; Nakamura, Y.; Oota, A.; Zhang, P.X.

    2006-01-01

    In this study, we prepared the Bi2223 multifilamentary tapes with Ca 2 CuO 3 as interfilamentary resistive barriers and evaluated their AC magnetization loss properties at 77 K. The Bi2223 tapes with thin barrier layers of Ca 2 CuO 3 around the filaments were prepared by using a standard powder-in-tube (PIT) method. To fabricate the Ca 2 CuO 3 layers around each filament, the outside surface of monocore Ag-sheathed wires was coated by Ca 2 CuO 3 with the slurry. After the heat treatment to decompose and evaporate the organic binder in the slurry, the several coated monocore wires were stacked and packed into another Ag-tube. Then, the packed tube was drawn and rolled into tape shape. The tape was subsequently sintered to form Bi2223 phase inside filaments. The AC magnetization losses in an AC transverse magnetic field were measured by a pick-up coil method. The loss properties in the barrier tape were compared with those in the tape without barriers. The results indicated that introducing Ca 2 CuO 3 barriers is very effective to suppress the electromagnetic coupling among the filaments and also to reduce the magnetization losses under parallel transverse field

  8. Transport current ac losses and current-voltage curves of multifilamentary Bi-2223/Ag tape with artificial defects

    International Nuclear Information System (INIS)

    Polak, M.; Jansak, L.

    2000-01-01

    We experimentally studied the effects of a single artificial defect and a linear array of artificial defects on I-V curves, critical currents and transport current ac losses of 55 filament untwisted Bi-2223/Ag tapes. The artificial defect was a small hole drilled into the tape. The reduction in the critical current measured on a 1 cm long section due to one hole of diameter 0.9 mm was 33% and that due to a linear array of seven similar holes was 62%. The slopes of the I-V curves, n, measured in this section were 33, 16 and 5.8 in the original sample, in the sample with one defect and the sample with seven defects, respectively. Both I c and the slope reduction were smaller if the distance between the potential taps was increased. The transport current ac losses at 50 Hz and I rms = 10 A in the sample with one defect measured in a 1 cm long section were practically the same as those in the original sample (4.1x10 -4 W m -1 ), but they increased by 83% in the sample with a linear array of seven defects. The measured increase in losses per unit length was the smaller, the larger the distance between the potential taps. A comparison between the measured and calculated losses revealed that a formal application of the Norris equations for loss calculations in samples with local defects leads to an overestimation of the ac losses. A procedure for the calculation of transport current losses in samples with local defects based on the Norris model is proposed and verified. (author)

  9. Effect of dc field on ac-loss peak in a commercial Bi:2223/Ag tape

    Science.gov (United States)

    Öztürk, Ali; Düzgün, İbrahim; Çelebi, Selahattin

    2017-12-01

    Measurements of the ac susceptibility in a commercial Bi:2223/Ag tape for some different ac magnetic field amplitudes, Hac, in the presence of bias magnetic field Hdc directed along Hac are reported. It is found that the peak values of the imaginary component of ac susceptibility χ″max versus Hac trace a valley for the orientation where applied field Ha perpendicular to wide face of the tape total. We note that the observation of the valley depends on various parameters such as field dependence parameter n in the critical current density, in the simple power law expression jc = α(T)/Bn, choice of the bias field Hdc together with selected ac field amplitudes Hac, and dimension and geometry of sample studied. Our calculations based on critical state model with jc = α(1 - T/Tcm)p/Bn using the fitting parameters of n = 0.25, p = 2.2, Tcm = 108 K gives quite good results to compare the experimental and calculated curves.

  10. Loss optimizing low power 50 Hz transformers intended for AC/DC standby power supplies

    DEFF Research Database (Denmark)

    Nielsen, Nils

    2004-01-01

    This paper presents the measured efficiency on selected low power conventional 50 Hz/230 V-AC transformers. The small transformers are intended for use in 1 W@5 V-DC series- or buck-regulated power supplies for standby purposes. The measured efficiency is compared for cheap off-the-self transformer...

  11. A Simplified Model to Calculate AC Losses in Large 2G HTS Coils

    DEFF Research Database (Denmark)

    Song, Xiaowei (Andy); Mijatovic, Nenad; Jensen, Bogi Bech

    2015-01-01

    . The model presented uses H formulation which directly solves magnetic fields, and the general partial differential equations (PDEs) module in Comsol Multiphysics is used to implement the model. Afterwards, the model is used to simulate the excitation stage of a racetrack HTS coil with 350 tapes. The AC...

  12. Low AC Loss in a 3 kA HTS Cable of the Dutch Project

    DEFF Research Database (Denmark)

    Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan

    2012-01-01

    Requirements for a 6km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in th...

  13. Assessment of Coping Capability of KORI Unit 1 under Extended Loss AC Power and Loss of Ultimate Heat Sink Initiated by Beyond Design Natural Disaster

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Chang Hyun; Ha, Sang Jun [KHNP CRI, Daejeon (Korea, Republic of); Han, Kee Soo [Nuclear Engineering Service and Solution (NESS) Co. Ltd., Deajeon (Korea, Republic of); Park, Chan Eok [KEPCO Engineering and Constructd., Deajeon (Korea, Republic of)

    2016-10-15

    In Korea, the government and industry performed comprehensive safety inspection on all domestic nuclear power plants against beyond design basis external events and fifty action items have been issued. In addition to post- Fukushima action items, the stress tests for all domestic nuclear power plants are on the way to enhance the safety of domestic nuclear power plants through finding the vulnerabilities in intentional stress conditions initiated by beyond design natural disaster. This paper presents assessment results of coping capability of KORI Unit 1 under the simultaneous Extended Loss of AC Power (ELAP) and Loss of Ultimate Heat Sink (LUHS) which is a representative plant condition initiated by beyond design natural disaster. The assessment of the coping capability of KORI Unit 1 has been performed under simultaneous the extended loss of AC power and loss of ultimate heat sink initiated by beyond design natural disaster. It is concluded that KORI Unit 1 has the capability, in the event of loss of safety functions by beyond design natural disaster, to sufficiently cool down the reactor core without fuel damage, to keep pressure boundaries of the reactor coolant system in transient condition and to control containment and temperature to maintain the integrity of the containment buildings.

  14. Assessment of Coping Capability of KORI Unit 1 under Extended Loss AC Power and Loss of Ultimate Heat Sink Initiated by Beyond Design Natural Disaster

    International Nuclear Information System (INIS)

    Kim, Chang Hyun; Ha, Sang Jun; Han, Kee Soo; Park, Chan Eok

    2016-01-01

    In Korea, the government and industry performed comprehensive safety inspection on all domestic nuclear power plants against beyond design basis external events and fifty action items have been issued. In addition to post- Fukushima action items, the stress tests for all domestic nuclear power plants are on the way to enhance the safety of domestic nuclear power plants through finding the vulnerabilities in intentional stress conditions initiated by beyond design natural disaster. This paper presents assessment results of coping capability of KORI Unit 1 under the simultaneous Extended Loss of AC Power (ELAP) and Loss of Ultimate Heat Sink (LUHS) which is a representative plant condition initiated by beyond design natural disaster. The assessment of the coping capability of KORI Unit 1 has been performed under simultaneous the extended loss of AC power and loss of ultimate heat sink initiated by beyond design natural disaster. It is concluded that KORI Unit 1 has the capability, in the event of loss of safety functions by beyond design natural disaster, to sufficiently cool down the reactor core without fuel damage, to keep pressure boundaries of the reactor coolant system in transient condition and to control containment and temperature to maintain the integrity of the containment buildings

  15. Frequency dependence of magnetic ac loss in a Roebel cable made of YBCO on a Ni-W substrate

    Science.gov (United States)

    Lakshmi, L. S.; Staines, M. P.; Badcock, R. A.; Long, N. J.; Majoros, M.; Collings, E. W.; Sumption, M. D.

    2010-08-01

    We have investigated the frequency dependent contributions to the magnetic ac loss in a 10 strand Roebel cable with 2 mm wide non-insulated strands and a transposition length of 90 mm. This cable is made from 40 mm wide YBCO coated conductor tape manufactured by AMSC and stabilized by electroplating 25 µm thick copper on either side prior to the mechanical punching of the cable strands. The measurements were carried out in both perpendicular and parallel field orientation, at frequencies in the range of 30-200 Hz. While the loss in the perpendicular orientation is predominantly hysteretic in nature, we observe some frequency dependence of the loss when the cable approaches full flux penetration at high field amplitudes. The magnitude is consistent with eddy current losses in the copper stabilization layer. This supports the fact that the inter-strand coupling loss is not significant in this frequency range. In the parallel field orientation, the hysteresis loss in the Ni-W alloy substrate dominates, but we see an unusually strong frequency dependent contribution to the loss which we attribute to intra-strand current loops.

  16. Economic simplified boiling water reactor (ESBWR) response to an extended station blackout/ loss of all AC power

    International Nuclear Information System (INIS)

    Barrett, A.J.; Marquino, W.

    2013-01-01

    U.S. federal regulations require light water cooled nuclear power plants to cope with Station Blackout for a predetermined amount of time based on design factors for the plant. U.S. regulations define Station Blackout (SBO) as a loss of the offsite electric power system concurrent with turbine trip and unavailability of the onsite emergency AC power system. According to U.S. regulations, typically the coping period for an SBO is 4 hours and can be as long as 16 hours for currently operating BWR plants. Being able to cope with an SBO and loss of all AC power is required by international regulators as well. The U.S. licensing basis for the ESBWR is a coping period of 72 hours for an SBO based on U.S. NRC requirements for passive safety plants. In the event of an extended SBO (viz., greater than 72 hours), the ESBWR response shows that the design is able to cope with the event for at least 7 days without AC electrical power or operator action. ESBWR is a Generation III+ reactor design with an array of passive safety systems. The ESBWR primary success path for mitigation of an SBO event is the Isolation Condenser System (ICS). The ICS is a passive, closed loop, safety system that initiates automatically on a loss of power. Upon Station Blackout or loss of all AC power, the ICS begins removing decay heat from the Reactor Pressure Vessel (RPV) by (i) condensing the steam into water in heat exchangers located in pools of water above the containment, and (ii) transferring the decay heat to the atmosphere. The condensed water is then returned by gravity to cool the reactor again. The ICS alone is capable of maintaining the ESBWR in a safe shutdown condition after an SBO for an extended period. The fuel remains covered throughout the SBO event. The ICS is able to remove decay heat from the RPV for at least 7 days and maintains the reactor in a safe shutdown condition. The water level in the RPV remains well above the top of active fuel for the duration of the SBO event

  17. AC loss in YBCO coated conductors at high dB/dt measured using a spinning magnet calorimeter (stator testbed environment)

    Science.gov (United States)

    Murphy, J. P.; Gheorghiu, N. N.; Bullard, T.; Haugan, T.; Sumption, M. D.; Majoros, M.; Collings, E. W.

    2017-09-01

    A new facility for the measurement of AC loss in superconductors at high dB/dt has been developed. The test device has a spinning rotor consisting of permanent magnets arranged in a Halbach array; the sample, positioned outside of this, is exposed to a time varying AC field with a peak radial field of 0.566 T. At a rotor speed of 3600 RPM the frequency of the AC field is 240 Hz, the radial dB/dt is 543 T/s and the tangential dB/dt is 249 T/s. Loss is measured using nitrogen boiloff from a double wall calorimeter feeding a gas flow meter. The system is calibrated using power from a known resistor. YBCO tape losses were measured in the new device and compared to the results from a solenoidal magnet AC loss system measurement of the same samples (in this latter case measurements were limited to a field of amplitude 0.1 T and a dB/dt of 100 T/s). Solenoidal magnet system AC loss measurements taken on a YBCO sample agreed with the Brandt loss expression associated with a 0-0.1 T Ic of 128 A. Subsequently, losses for two more YBCO tapes nominally identical to the first were individually measured in this spinning magnet calorimeter (SMC) machine with a Bmax of 0.566 T and dB/dt of up to 272 T/s. The losses, compared to a simplified version of the Brandt expression, were consistent with the average Ic expected for the tape in the 0-0.5 T range at 77 K. The eddy current contribution was consistent with a 77 K residual resistance ratio, RR, of 4.0. The SMC results for these samples agreed to within 5%. Good agreement was also obtained between the results of the SMC AC loss measurement and the solenoidal magnet AC loss measurement on the same samples.

  18. Fast-ion losses induced by ACs and TAEs in the ASDEX Upgrade tokamak

    NARCIS (Netherlands)

    M. García-Muñoz,; Hicks, N.; van Voornveld, R.; Classen, I.G.J.; Bilato, R.; Bobkov, V.; Brambilla, M.; Bruedgam, M.; Fahrbach, H. U.; Igochine, V.; Jaemsae, S.; Maraschek, M.; Sassenberg, K.

    2010-01-01

    The phase-space of convective and diffusive fast-ion losses induced by shear Alfven eigenmodes has been characterized in the ASDEX Upgrade tokamak. Time-resolved energy and pitch-angle measurements of fast-ion losses correlated in frequency and phase with toroidal Alfven eigenmodes (TAEs) and Alfven

  19. Fast-ion losses induced by ACs and TAEs in the ASDEX Upgrade tokamak

    NARCIS (Netherlands)

    García-Munoz, M.; Hicks, N.; Voornveld, van R.; Classen, I.G.J.; Bilato, R.; Bobkov, V.; Brambilla, M.; Bruedgam, M.; Fahrbach, H. -U.; Igochine, V.; Jaemsae, S.; Maraschek, M.; Sassenberg, K.

    2010-01-01

    The phase-space of convective and diffusive fast-ion losses induced by shear Alfv´en eigenmodes has been characterized in the ASDEX Upgrade tokamak. Time-resolved energy and pitch-angle measurements of fast-ion losses correlated in frequency and phase with toroidal Alfv´en eigenmodes (TAEs) and

  20. Numerical analysis of ac loss in bifilar stacks and coils of ion beam assisted deposition YBCO coated conductors

    International Nuclear Information System (INIS)

    Nguyen, Doan N.; Ashworth, Stephen P.; Willis, Jeffrey O.

    2009-01-01

    In this paper we present a finite element model using the commercial COMSOL software package for calculating the ac loss in bifilar stacks of high temperature superconducting tape. In the model, the current-voltage relationship characterizing the superconducting properties is assumed to follow a power law. The calculations were performed for infinite bifilar stacks with different values of layer-to-layer separation D. With appropriate settings for the boundary conditions, the numerical results agree well with the analytical data obtained from a recently proposed model [J. R. Clem, Phys. Rev. B 77, 134506 (2008)]. The numerical approach was also used to investigate the end effects in a bifilar stack to answer the following question: how many layers away from the end of a stack are required before the environment of a given layer is identical to that in an infinite stack? We find that the answer to this question depends strongly on the value of D. Based on this study, a model for calculating the ac loss in bifilar noninductively wound coils with a finite number of turns is proposed

  1. First AC loss test and analysis of a Bi2212 cable-in-conduit conductor for fusion application

    Science.gov (United States)

    Qin, Jinggang; Shi, Yi; Wu, Yu; Li, Jiangang; Wang, Qiuliang; He, Yuxiang; Dai, Chao; Liu, Fang; Liu, Huajun; Mao, Zhehua; Nijhuis, Arend; Zhou, Chao; Devred, Arnaud

    2018-01-01

    The main goal of the Chinese fusion engineering test reactor (CFETR) is to build a fusion engineering tokamak reactor with a fusion power of 50-200 MW, and plan to test the breeding tritium during the fusion reaction. This may require a maximum magnetic field of the central solenoid and toroidal field coils up to 15 T. New magnet technologies should be developed for the next generation of fusion reactors with higher requirements. Bi2Sr2CaCu2Ox (Bi2212) is considered as a potential and promising superconductor for the magnets in the CFETR. R&D activities are ongoing at the Institute of Plasma Physics, Chinese Academy of Sciences for demonstration of the feasibility of a CICC based on Bi2212 round wire. One sub-size conductor cabled with 42 wires was designed, manufactured and tested with limited strand indentation during cabling and good transport performance. In this paper, the first test results and analysis on the AC loss of Bi2212 round wires and cabled conductor samples are presented. Furthermore, the impact of mechanical load on the AC loss of the sub-size conductor is investigated to represent the operation conditions with electromagnetic loads. The first tests provide an essential basis for the validation of Bi2212 CICC and its application in fusion magnets.

  2. Study of a Modified AC Bridge Technique for Loss Angle Measurement of a Dielectric Material

    Directory of Open Access Journals (Sweden)

    S. C. BERA

    2008-09-01

    Full Text Available A Wheatstone’s bridge network like Schering Bridge, DeSauty Bridge etc measures the loss angle or tangent of loss angle (tanδ of a dielectric material. In high voltage application this loss angle is generally measured by high voltage Schering Bridge. But continuous measurement of tan δ is not possible by these techniques. In the present paper a modified operational amplifiers based Schering Bridge network has been proposed for continuous measurement of tanδ in the form of a bridge network output voltage. Mathematical analysis of the proposed bridge network has been discussed in the paper and experimental work has been performed assuming the lossy dielectric material as a series combination of loss less capacitor and a resistor. Experimental results are reported in the paper. From the mathematical analysis and experimental results it is found that the output of the proposed bridge network is almost linearly related with tanδ.

  3. Experiment of enhancing critical current and reducing ac loss in pancake coil comprised of Ni-coated Bi-2223/Ag tape

    International Nuclear Information System (INIS)

    Alamgir, A.K.M.; Gu, C.; Han, Z.

    2006-01-01

    An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 μm thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance

  4. Experiment of enhancing critical current and reducing ac loss in pancake coil comprised of Ni-coated Bi-2223/Ag tape

    Energy Technology Data Exchange (ETDEWEB)

    Alamgir, A.K.M. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)]. E-mail: alam643@hotmail.com; Gu, C. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Han, Z. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)

    2006-07-01

    An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 {mu}m thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance.

  5. effect of number of rotor poles on ac losses of permanent magnet

    African Journals Online (AJOL)

    HOD

    A study on permanent magnet (PM) eddy current and core losses of dual-stator PM machines is investigated in this paper. ... material in the retaining sleeves of surface-mounted ... rotor-pole numbers (13-poleand 14-pole in particular) ... Table 2: Optimized Machine Parameters. Number of rotor poles. 4. 5. 7. 8. 10. 11. 13. 14.

  6. A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

    Science.gov (United States)

    Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza

    2008-01-01

    AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.

  7. A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

    International Nuclear Information System (INIS)

    Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza

    2008-01-01

    AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency

  8. A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

    Energy Technology Data Exchange (ETDEWEB)

    Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza [Center of Excellence for Power System Automation and Operation, Electrical Engineering Department, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)

    2008-01-15

    AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.

  9. An improved FEM model for computing transport AC loss in coils made of RABiTS YBCO coated conductors for electric machines

    International Nuclear Information System (INIS)

    Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A; Rodriguez-Zermeno, Victor M; Hong Zhiyong

    2011-01-01

    AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.

  10. An improved FEM model for computing transport AC loss in coils made of RABiTS YBCO coated conductors for electric machines

    Energy Technology Data Exchange (ETDEWEB)

    Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A [Department of Engineering, University of Cambridge, 9 J J Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Rodriguez-Zermeno, Victor M [Department of Mathematics, Technical University of Denmark, Kongens Lyngby 2800 (Denmark); Hong Zhiyong, E-mail: mda36@cam.ac.uk [School of Electronic, Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai (China)

    2011-04-15

    AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.

  11. Hysteresis losses in MgB{sub 2} superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

    Energy Technology Data Exchange (ETDEWEB)

    Magnusson, N., E-mail: niklas.magnusson@sintef.no [SINTEF Energy Research, NO-7465 Trondheim (Norway); Abrahamsen, A.B. [DTU Wind Energy, Technical University of Denmark, DK-4000 Roskilde (Denmark); Liu, D. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands); Runde, M. [SINTEF Energy Research, NO-7465 Trondheim (Norway); Polinder, H. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands)

    2014-11-15

    Highlights: • A method for calculating hysteresis losses in the low AC – high DC magnetic field and transport current range has been shown. • The method can be used in the design of wind turbine generators for calculating the losses in the generator DC rotor. • First estimates indicate tolerable current ripple in the 0.1% range for a 4 T DC MgB{sub 2} generator rotor coil. - Abstract: MgB{sub 2} superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be evaluated in the design of the generator to ensure a sufficient overall efficiency. A major loss component is the hysteresis losses in the superconductor itself. In the high DC – low AC current and magnetic field region experimental results still lack for MgB{sub 2} conductors. In this article we reason towards a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting equations use the DC in-field critical current, the geometry of the superconductor and the magnitude of the AC magnetic field component as parameters. This simplified approach can be valuable in the design of MgB{sub 2} DC coils in the 1–4 T range with low AC magnetic field and current ripples.

  12. Final report SBIR Phase II. High current density (Jc), low A.C . loss, low cost, Internal-Tin Superconductors

    International Nuclear Information System (INIS)

    Gregory, Eric

    2009-01-01

    Final report of SBIR to develop an economical process that can produce the best material for high field magnets to be used in the next generation of accelerators. The overall objective is to develop an economical process that can produce the best material for high field magnets to be used in future particle accelerators. The internal-tin process has shown by others to produce high J c Nb 3 Sn material and the work here is primarily directed to lowering the AC losses, increasing piece lengths and lowering costs. In the previous reports on this Phase II work we have explored the finned restack approach. We have however encountered ductility problems when we have attempted to produce material without fins but with large numbers of subelements in the restacks. The work reported has concentrated on the scale up of the internal-tin materials without fins and we have finally made internal tin material with 40 (micro)m subelements which exhibited a J c at 12 T of 2757 A/mm 2 in the non-Cu and a J c at 14 T of 1985 A/mm 2 in the non-Cu. These results are the best we have achieved to date and are approaching those that Oxford has achieved for sometime.

  13. Sensitivity Analysis of Core Damage from Reactor Coolant Pump Seal Leakage during Extended Loss of All AC Power

    Energy Technology Data Exchange (ETDEWEB)

    Park, Da Hee; Kim, Min Gi; Lee, Kyung Jin; Hwang, Su hyun; Lee, Byung Chul [FNC Technology Co. Ltd., Yongin (Korea, Republic of); Yoon, Duk Joo; Lee, Seung Chan [Korea Hydro and Nuclear Power Co. Ltd., Daejeon (Korea, Republic of)

    2015-10-15

    In this study, in order to comprehend the Fukushima accident, the sensitivity analysis was performed to analyze the behavior of Reactor Coolant System (RCS) during ELAP using the RELAP5/MOD3.3 code. The Fukushima accident was caused by tsunami resulted in Station Black Out (SBO) followed by the reactor core melt-down and release of radioactive materials. After the accident, the equipment and strategies for the Extended Loss of All AC Power (ELAP) were recommended strongly. In this analysis, sensitivity studies for the RCP seal failure of the OPR1000 type NPP were performed by using RELAP5/MOD3.3 code. Six cases with different leakage rate of RCP seal were studied for ELAP with operator action or not. The main findings are summarized as follows: (1) Without the operator action, the core uncovery time is determined by the leakage rate of RCP seal. When the leakage rate per RCP seal are 5 gpm, 50 gpm, and 300 gpm respectively, the core uncovery time are 1.62 hr, 1.58 hr, and 1.29 hr respectively. Namely, If the leakage rate of RCP seal was much bigger, the uncover time of core would be shorter. (2) In case that the cooling by SG secondary side was performed using the TDAFP and SG ADV, the core uncovery time was significantly extended.

  14. Temperature dependence of the minimum in AC power losses of (Nb/sub 0.99/Zr/sub 0.01/)3Sn in parallel AC and DC magnetic fields

    International Nuclear Information System (INIS)

    Kovachev, V.T.

    1980-01-01

    ac losses P/sub L/ of bronze-processed (Nb/sub 0.99/Zr/sub 0.01/) 3 Sn strips have been measured between 4.2 and 16.5 K in the presence of a dc magnetic field H 0 . The measurements were performed using an electronic wattmeter with both ac and dc fields parallel to the long flat surfaces of the sample. A minimum in the function P/sub L/(H 0 ) was observed for fixed ac amplitudes h 0 . This minimum was found to occur in the entire temperature range between 4.2 and 16.5 K. A similar minimum was recently reported in Nb 3 Ge [Thompson et al., J. Appl. Phys. 50, 3514 (1979)] at 4.2 K. The position of the minimum is explained here by the same physical model as in Thompson et al. [J. Appl. Phys. 50, 3514 (1979)]; and Clem (ibid. 3518), but extending the model to include the temperature dependence of the entry surface shielding fields ΔH/sub en/(B,T) for flux density in the sample B=0. It is also shown here that loss minimum measurements can be used for the determination of ΔH/sub en/(0,T) in the temperature range 4.2--16.5 K

  15. Hysteresis losses in MgB2 superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

    DEFF Research Database (Denmark)

    Magnusson, N.; Abrahamsen, Asger Bech; Liu, Dawei

    2014-01-01

    MgB2 superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must...... a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting...

  16. Voltage-probe-position dependence and magnetic-flux contribution to the measured voltage in ac transport measurements: which measuring circuit determines the real losses?

    International Nuclear Information System (INIS)

    Pe, T.; McDonald, J.; Clem, J.R.

    1995-01-01

    The voltage V ab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path C s through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path C s and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent ac loss (the time average of the product IV ab ) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) ac loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real ac losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit dimensions. Corresponding calculations also are presented for a sample of elliptical cross section

  17. Electromagnetic field analyses of two-layer power transmission cables consisting of coated conductors with magnetic and non-magnetic substrates and AC losses in their superconductor layers

    International Nuclear Information System (INIS)

    Nakahata, Masaaki; Amemiya, Naoyuki

    2008-01-01

    Two-dimensional electromagnetic field analyses were undertaken using two representative cross sections of two-layer cables consisting of coated conductors with magnetic and non-magnetic substrates. The following two arrangements were used for the coated conductors between the inner and outer layers: (1) tape-on-tape and (2) alternate. The calculated magnetic flux profile around each coated conductor was visualized. In the case of the non-magnetic substrate, the magnetic field to which coated conductors in the outer layer are exposed contains more perpendicular component to the conductor wide face (perpendicular field component) when compared to that in the inner layer. On the other hand, for the tape-on-tape arrangement of coated conductors with a magnetic substrate, the reverse is true. In the case of the alternate arrangement of the coated conductor with a magnetic substrate, the magnetic field to which the coated conductors in the inner and outer layers are exposed experiences a small perpendicular field component. When using a non-magnetic substrate, the AC loss in the superconductor layer of the coated conductors in the two-layer cables is dominated by that in the outer layer, whereas the reverse is true in the case of a magnetic substrate. When comparing the AC losses in superconductor layers of coated conductors with non-magnetic and magnetic substrates in two-layer cables, the latter is larger than the former, but the influence of the magnetism of substrates on AC losses in superconductor layers is not remarkable

  18. Comparison of AC losses, magnetic field/current distributions and critical currents of superconducting circular pancake coils and infinitely long stacks using coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Yuan Weijia; Campbell, A M; Hong, Z; Ainslie, M D; Coombs, T A, E-mail: wy215@cam.ac.u [Electronic, Power and Energy Conversion Group, Electrical Engineering Division, Engineering Department, University of Cambridge, Cambridge CB3 0FA (United Kingdom)

    2010-08-15

    A model is presented for calculating the AC losses, magnetic field/current density distribution and critical currents of a circular superconducting pancake coil. The assumption is that the magnetic flux lines will lie parallel to the wide faces of tapes in the unpenetrated area of the coil. Instead of using an infinitely long stack to approximate the circular coil, this paper gives an exact circular coil model using elliptic integrals. A new efficient numerical method is introduced to yield more accurate and fast computation. The computation results are in good agreement with the assumptions. For a small value of the coil radius, there is an asymmetry along the coil radius direction. As the coil radius increases, this asymmetry will gradually decrease, and the AC losses and penetration depth will increase, but the critical current will decrease. We find that if the internal radius is equal to the winding thickness, the infinitely long stack approximation overestimates the loss by 10% and even if the internal radius is reduced to zero, the error is still only 60%. The infinitely long stack approximation is therefore adequate for most practical purposes. In addition, the comparison result shows that the infinitely long stack approximation saves computation time significantly.

  19. Measurement and Numerical Evaluation of AC-Losses in a ReBCO Roebel Cable at 4.5 K

    CERN Document Server

    van Nugteren, J.; Gao, P.; Bottura, L,; Dhallé, M.; Goldacker, W.; Kario, A.; ten Kate, H.; Kirby, G.; Krooshoop, E.; de Rijk, G.; Rossi, L.; Senatore, C.; Wessel, S.; Yagotintsev, K.; Yang, Y.

    2016-01-01

    EUCARD2 aims to research ReBCO superconducting magnets for future accelerator applications. The properties of ReBCO conductors are very different from low temperature superconductors. To investigate dynamic field quality, stability and normal zone propagation an electrical network model for coated conductor cables was developed. To validate the model two identical samples were prepared at CERN after which measurements were taken at the University of Twente and Southampton University. The model predicts that for Roebel cable, in a changing magnetic field applied in the perpendicular direction, the hysteresis loss is much larger than the coupling loss. In the case of a changing magnetic field applied parallel to the cable coupling loss is dominant. In the first case the experiment is in good agreement with the model. In the second case the data can only be compared qualitatively because the calibration for the inductive measurement is not available.

  20. Power Loss Analysis and Comparision of DC and AC Side Decoupling Module in a H-bridge Inverter

    DEFF Research Database (Denmark)

    Ma, Siyuan; Wang, Haoran; Zhu, Guorong

    2016-01-01

    perspective. The analytical power loss models are derived based on the operation principles of the active power decoupling methods. A comparative study is performed based on a 500 W single-phase H-bridge inverter study case with 400 V DC-link voltage level. The results provide a guideline to justify whether...

  1. Study of AC Magnetic Properties and Core Losses of Fe/Fe3O4-epoxy Resin Soft Magnetic Composite

    Science.gov (United States)

    Laxminarayana, T. A.; Manna, Subhendu Kumar; Fernandes, B. G.; Venkataramani, N.

    Soft Magnetic Composites (SMC) were prepared by coating of nanocrystalline Fe3O4 particles, synthesized by co-precipitation method, on atomized iron powder of particle size less than 53 μm in size using epoxy resin as a binder between iron and Fe3O4. Fe3O4 was chosen, for its high electric resistivity and suitable magnetic properties, to keep the coating layer magnetic and seek improvement to the magnetic properties of SMC. SEM images and XRD patterns were recorded in order to investigate the coatings on the surface of iron powder. A toroid was prepared by cold compaction of coated iron powder at 1050 MPa and subsequently cured at 150˚C for 1 hr in argon atmosphere. For comparison of properties, a toroid of uncoated iron powder was also compacted at 1050 MPa and annealed at 600˚C for 2 hr in argon atmosphere. The coated iron powder composite has a resistivity of greater than 200 μΩm, measured by four probe method. A comparison of Magnetic Hysteresis loops and core losses using B-H Loop tracer in the frequency range 0 to 1500 Hz on the coated and uncoated iron powder is reported.

  2. Loss of vital ac power and the residual heat removal system during mid-loop operations at Vogtle Unit 1 on March 20, 1990

    International Nuclear Information System (INIS)

    1990-06-01

    On March 20, 1990, the Vogtle Electric Generating Plant Unit 1, located in Burke County, Georgia, about 25 miles southeast of Augusta, experienced a loss of all safety (vital) ac power. The plant was in cold shutdown with reactor coolant level lowered to ''mid-loop'' for various maintenance tasks. Both the containment building personnel hatch and equipment hatch were open. One emergency diesel generator and one reserve auxiliary transformer were out of service for maintenance, with the remaining reserve auxiliary transformer supplying both Unit 1 safety buses. A truck in the low voltage switchyard backed into the support column for an offsite power feed to the reserve auxiliary transformer which was supplying safety power. The insulator broke, a phase-to-ground fault occurred, and the feeder circuit breakers for the safety buses opened. The operable emergency diesel generator started automatically because of the undervoltage condition on the safety bus, but tripped off after about 1 minute. About 20 minutes later the diesel generator load sequencer was reset, causing the diesel generator to start a second time. The diesel generator operated for about 1 minute, and tripped off. The diesel generator was restarted in the manual emergency mode 36 minutes after the loss of power. The generator remained on line and provided power to its safety bus. During the 36 minutes without safety bus power, the reactor coolant system temperature rose from about 90 degree F to 136 degree F. This report documents the results of an Incident Investigation Team sent to Vogtle by the Executive Director for Operations of the US Nuclear Regulatory Commission to determine what happened, identify the probable causes, and make appropriate findings and conclusions. 79 figs., 16 tabs

  3. Large A.C. machines theory and investigation methods of currents and losses in stator and rotor meshes including operation with nonlinear loads

    CERN Document Server

    Boguslawsky, Iliya; Hayakawa, Masashi

    2017-01-01

    In this monograph the authors solve the modern scientific problems connected with A.C. motors and generators, based first on the detailed consideration of their physical phenomena. The authors describe the theory and investigative methods they developed and applied in practice, which are considered to be of essential interest for specialists in the field of the electrical engineering industry in European countries, the USA, Argentina, and Brazil, as well as in such countries as India, China, and Iran. This book will be of interest to engineers specialized in the field of the manufacture, operation, and repair of A.C. machines (motors and generators) as well as electric drives; to professors, lecturers, and post-graduate students of technical universities, who are specializing in the field of electric machine engineering and electric drives; and to students who are engaged in the field of high current techniques, electric drives, and electric machine engineering.

  4. AC Initiation System.

    Science.gov (United States)

    An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

  5. AC Losses in Bi2Sr2Ca2Cu3O10+x Tapes and a 3.15-m-Long Single-Phase Cable

    DEFF Research Database (Denmark)

    Juul, Jeppe Søgaard; Mølgaard, Esben Tore; Jensen, Jens

    2011-01-01

    The alternating-current losses in superconducting multifilament BiSCCO-2223 tapes and a 3.15-m single-phase test cable were measured at 77 K using an electrical transport method. The cable had an inner diameter of 42 mm; it was composed of a single layer of 31 multifilament tapes and had a critic...

  6. Study of long-term loss of all AC power supply sources for VVER-1000/V320 in connection with application of new engineering safety features for SAMG

    International Nuclear Information System (INIS)

    Borisov, Evgeni; Grigorov, Dobrin; Mancheva, Kaliopa

    2013-01-01

    Highlights: • In this study we presented analysis for a new SAMG approach. • The approach is applicable for all PWR reactors from 2nd generation. • We investigated two scenarios with total black out. • The RELAP/MOD 3.2 computer code is used in performing the analyses. - Abstract: This paper presents the results of analysis for application of a new Severe Accident Management Guideline (SAMG) approach which is specifically applied for VVER-1000/B320 reactor installations. In general, this innovative approach is fully applicable for all the pressurized water reactors from second generation. The purposes of the analysis for the new SAMG approach application are as follows: • To represent suggestions for new engineering safety features application for SAMG strategies. • To assess the applicability of the new engineering safety features and means for SAMG strategies in case of loss of all off-site power supply sources for VVER-1000/B320 reactor installations. • To represent important operator actions and to analyse the effectiveness of these actions for accidents management in compliance with the new approach. • The RELAP5/MOD3.3 computer code has been used in performing the analyses in a VVER-1000 Nuclear Power Plant (NPP) model. The input data deck for the analysis is optimized, verified and validated

  7. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  8. Low Offset AC Correlator.

    Science.gov (United States)

    This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

  9. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  10. FLUIDIC AC AMPLIFIERS.

    Science.gov (United States)

    Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

  11. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  12. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  13. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  14. AcMNPV

    African Journals Online (AJOL)

    USER

    2010-08-16

    Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

  15. AC BREAKDOWN IN GASES

    Science.gov (United States)

    electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.

  16. THERMIONIC AC GENERATION

    Science.gov (United States)

    is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

  17. Mass of AC Andromedae

    International Nuclear Information System (INIS)

    King, D.S.; Cox, A.N.; Hodson, S.W.

    1975-01-01

    Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)

  18. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, G [Jefferson Lab (United States)

    2014-07-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  19. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  20. Ac irreversibility line of bismuth-based high temperature superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)

    1997-09-01

    We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}

  1. Ac irreversibility line of bismuth-based high temperature superconductors

    International Nuclear Information System (INIS)

    Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.

    1997-01-01

    We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society

  2. AC application of second generation HTS wire

    Science.gov (United States)

    Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.

    2008-02-01

    For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.

  3. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  4. Superconducting ac cable

    Science.gov (United States)

    Schmidt, F.

    1980-11-01

    The components of a superconducting 110 kV ac cable for power ratings or = 2000 MVA were developed. The cable design is of the semiflexible type, with a rigid cryogenic envelope containing a flexible hollow coaxial cable core. The cable core consists of spirally wound Nb-A1 composite wires electrically insulated by high pressure polyethylene tape wrappings. A 35 m long single phase test cable with full load terminals rated at 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of this cable design.

  5. ac superconducting articles

    International Nuclear Information System (INIS)

    Meyerhoff, R.W.

    1977-01-01

    A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface

  6. Superconducting ac cable

    International Nuclear Information System (INIS)

    Schmidt, F.

    1980-01-01

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de

  7. ACS Postflash Characterization

    Science.gov (United States)

    Smith, Linda

    2011-10-01

    This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.

  8. Superconductive AC current limiter

    International Nuclear Information System (INIS)

    Bekhaled, M.

    1987-01-01

    This patent describes an AC current limiter for a power transport line including a power supply circuit and feeding a load circuit via an overload circuit-breaker member. The limiter comprises a transformer having a primary winding connected in series between the power supply circuit and the load circuit and at least one secondary winding of superconductor material contained in a cryogenic enclosure and short-circuited on itself. The leakage reactance of the transformer as seen from the primary winding is low, and the resistance of the at least one secondary winding when in the non-superconducting state and as seen from the primary is much greater than the nominal impedance of the transformer. The improvement whereby the at least one secondary winding of the transformer comprises an active winding in association with a set of auxiliary windings. The set of auxiliary windings is constituted by an even number of series-connected auxiliary windings wound in opposite directions, with the total number of turns in one direction being equal to the total number of turns in the opposite direction, and with the thermal capacity of the secondary winding as a whole being sufficiently high to limit the expansion thereof to a value which remains small during the time it takes the circuit-breaking member to operate

  9. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  10. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  11. dc Arc Fault Effect on Hybrid ac/dc Microgrid

    Science.gov (United States)

    Fatima, Zahra

    The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

  12. Structural, ac conductivity and dielectric properties of 3-formyl chromone

    Science.gov (United States)

    Ali, H. A. M.

    2017-07-01

    The structure for the powder of 3-formyl chromone was examined by X-ray diffraction technique in the 2θ° range ( 4° - 60° . The configuration of Al/3-formyl chromone/Al samples was designed. The electrical and dielectric properties were studied as a function of frequency (42- 5 × 106 Hz) and temperature (298-408K). The ac conductivity data of bulk of 3-formyl chromone varies as a power law with the frequency at different temperatures. The predominant mechanism for ac conduction was deduced. The ac conductivity shows a thermally activated process at different frequencies. The dielectric constant and dielectric loss were determined using the capacitance and dissipation factor measurements at different temperatures. The dielectric loss shows a peak of relaxation time that shifted to higher frequency with an increase in the temperature. The activation energy of the relaxation process was estimated.

  13. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...

  14. Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

    Directory of Open Access Journals (Sweden)

    Evi Ploumpidou

    2017-12-01

    Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

  15. Low frequency ac conduction and dielectric relaxation in poly(N ...

    Indian Academy of Sciences (India)

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

  16. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  17. Nuclear structure of 231Ac

    International Nuclear Information System (INIS)

    Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

    2008-01-01

    The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

  18. AC ignition of HID lamps

    NARCIS (Netherlands)

    Sobota, A.; Kanters, J.H.M.; Manders, F.; Veldhuizen, van E.M.; Haverlag, M.

    2010-01-01

    Our aim was to examine the starting behaviour of mid-pressure argon discharges in pin-pin (point-to-point) geometry, typically used in HID lamps. We focused our work on AC ignition of 300 and 700 mbar Ar discharges in Philips 70W standard burners. Frequency was varied between 200 kHz and 1 MHz. In

  19. AC Application of HTS Conductors in Highly Dynamic Electric Motors

    International Nuclear Information System (INIS)

    Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K

    2006-01-01

    Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit

  20. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  1. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  2. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  3. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  4. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  5. SNS AC Power Distribution and Reliability of AC Power Supply

    CERN Document Server

    Holik, Paul S

    2005-01-01

    The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*

  6. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  7. The AC photovoltaic module is here!

    Science.gov (United States)

    Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

    1997-02-01

    This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

  8. Study of dielectric relaxation and AC conductivity of InP:S single crystal

    Science.gov (United States)

    El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.

    2012-07-01

    The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.

  9. The complex ac susceptibility of superconducting Y-Ba-CuO thin film and bulk samples

    International Nuclear Information System (INIS)

    Lobotka, P.; Goemoery, F.

    1988-01-01

    Complex ac susceptibility measurements as function of temperature on Y-Ba-CuO superconductors are reported. A strong dependence of the susceptibility curves on the ac field magnitude and little influence of the superimposed dc field are observed on both, thin film and bulk samples. The susceptibilities of these materials are frequency independent in the range 30 to 7200 Hz what demonstrates the negligible role of eddy currents. A second peak in the imaginary part of susceptibility is observed in the bulk sample at higher levels of ac field. This implies the existence of another component in the sample with higher T c and lower losses. (author)

  10. Control of a resonant d.c.-link converter for a.c. motor drives

    Directory of Open Access Journals (Sweden)

    Astrid Petterteig

    1992-10-01

    Full Text Available This paper presents the control of the resonant d.c.-link converter for a.c. motor drives. This is a low loss converter with higher efficiency than a conventional PWM converter, but it requires complex control. It needs a special control of the resonant d.c.-link voltage in addition to the discrete control of the a.c. side currents. Simulations show how the control of the a.c. currents, the modulation principle, influences the overall performance of the converter.

  11. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  12. Ac system interruption analysis of an orthogonal-core type dc-ac converter. Koryu keito shadanji no chokko jishinkei dc-ac renkeiyo henkanki no dosa kaiseki

    Energy Technology Data Exchange (ETDEWEB)

    Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College

    1991-04-30

    This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.

  13. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    DR OKE

    presented here that solves the power flow problem node-wise, minimizing losses and .... The process is continued till the nodal mismatch values are negligibly small. .... operation and control; FACTS controllers; deregulation; generations and ...

  14. Development of Nb3Sn AC superconducting wire. Pt. 2

    International Nuclear Information System (INIS)

    Kasahara, Hobun; Torii, Shinji; Akita, Shirabe; Ueda, Kiyotaka; Kubota, Yoji; Yasohama, Kazuhiko; Kobayashi, Hisayasu; Ogasawara, Takeshi.

    1993-01-01

    For the realization of superconducting power apparatus, it is important that the development of highly stable superconducting cables. Nb 3 Sn wire has higher critical temperature than NbTi wire. Therefore, it is possible to make highly stable superconducting wires. In this report, we examine a manufacturing process of Ac Nb 3 Sn wire. This manufacturing process has four times higher critical current density than conventional processes. We have made a 400 kVA class AC coil with React and Wind method. The loss density of this coil was 20MW/m 3 at just before the quench. In this case, the temperature of cable increased about 3.8 K. This means that the Nb 3 Sn coil has a very high stability. (author)

  15. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.

    2017-07-21

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.

  16. Hearing loss

    Science.gov (United States)

    Decreased hearing; Deafness; Loss of hearing; Conductive hearing loss; Sensorineural hearing loss; Presbycusis ... Symptoms of hearing loss may include: Certain sounds seeming too loud Difficulty following conversations when two or more people are talking ...

  17. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  18. Power Electronic Transformer based Three-Phase PWM AC Drives

    Science.gov (United States)

    Basu, Kaushik

    A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common

  19. Measurement of AC electrical characteristics of SSC superconducting dipole magnets

    International Nuclear Information System (INIS)

    Smedley, K.M.; Shafer, R.E.

    1992-01-01

    Experiments were conducted to measure the AC electrical characteristics of SSC superconducting dipole magnets over the frequency range of 0.1 Hz to 10 kHz. A magnet equivalent circuit representing the magnet DC inductance, eddy current losses, coil-to-ground and turn-to-turn capacitance, was synthesized from the experimental data. This magnet equivalent circuit can be used to predict the current ripple distribution along the superconducting magnet string and can provide dynamic information for the design of the collider current regulation loop

  20. Topologically protected loop flows in high voltage AC power grids

    International Nuclear Information System (INIS)

    Coletta, T; Delabays, R; Jacquod, Ph; Adagideli, I

    2016-01-01

    Geographical features such as mountain ranges or big lakes and inland seas often result in large closed loops in high voltage AC power grids. Sizable circulating power flows have been recorded around such loops, which take up transmission line capacity and dissipate but do not deliver electric power. Power flows in high voltage AC transmission grids are dominantly governed by voltage angle differences between connected buses, much in the same way as Josephson currents depend on phase differences between tunnel-coupled superconductors. From this previously overlooked similarity we argue here that circulating power flows in AC power grids are analogous to supercurrents flowing in superconducting rings and in rings of Josephson junctions. We investigate how circulating power flows can be created and how they behave in the presence of ohmic dissipation. We show how changing operating conditions may generate them, how significantly more power is ohmically dissipated in their presence and how they are topologically protected, even in the presence of dissipation, so that they persist when operating conditions are returned to their original values. We identify three mechanisms for creating circulating power flows, (i) by loss of stability of the equilibrium state carrying no circulating loop flow, (ii) by tripping of a line traversing a large loop in the network and (iii) by reclosing a loop that tripped or was open earlier. Because voltages are uniquely defined, circulating power flows can take on only discrete values, much in the same way as circulation around vortices is quantized in superfluids. (paper)

  1. Calculation of single phase AC and monopolar DC hybrid corona effects

    International Nuclear Information System (INIS)

    Zhao, T.; Sebo, S.A.; Kasten, D.G.

    1996-01-01

    Operating a hybrid HVac and HVdc line is an option for increasing the efficiency of power transmission and overcoming the difficulties in obtaining a new right-of-way. This paper proposes a new calculation method for the study of hybrid line corona. The proposed method can be used to calculate dc corona losses and corona currents in dc or ac conductors for single phase ac and monopolar dc hybrid lines. Profiles of electric field strength and ion current density at ground level can be estimated. The effects of the presence of an energized ac conductor on dc conductor corona and dc voltage on ac conductor corona are included in the method. Full-scale and reduced-scale experiments were utilized to investigate the hybrid line corona effects. Verification of the proposed calculation method is given

  2. Pregnancy Loss

    Science.gov (United States)

    ... To receive Pregnancy email updates Enter email Submit Pregnancy loss Pregnancy loss is a harsh reality faced ... have successful pregnancies. Expand all | Collapse all Why pregnancy loss happens As many as 10 to 15 ...

  3. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

  4. Nonmonotonic low frequency losses in HTSCs

    International Nuclear Information System (INIS)

    Castro, H; Gerber, A; Milner, A

    2007-01-01

    A calorimetric technique has been used in order to study ac-field dissipation in ceramic BSCCO samples at low frequencies between 0.05 and 250 Hz, at temperatures from 65 to 90 K. In contrast to previous studies, where ac losses have been reported with a linear dependence on magnetic field frequency, we find a nonmonotonic function presenting various maxima. Frequencies corresponding to local maxima of dissipation depend on the temperature and the amplitude of the ac magnetic field. Flux creep is argued to be responsible for this behaviour. A simple model connecting the characteristic vortex relaxation times (flux creep) and the location of dissipation maxima versus frequency is proposed

  5. A decomposition method for network-constrained unit commitment with AC power flow constraints

    International Nuclear Information System (INIS)

    Bai, Yang; Zhong, Haiwang; Xia, Qing; Kang, Chongqing; Xie, Le

    2015-01-01

    To meet the increasingly high requirement of smart grid operations, considering AC power flow constraints in the NCUC (network-constrained unit commitment) is of great significance in terms of both security and economy. This paper proposes a decomposition method to solve NCUC with AC power flow constraints. With conic approximations of the AC power flow equations, the master problem is formulated as a MISOCP (mixed integer second-order cone programming) model. The key advantage of this model is that the active power and reactive power are co-optimised, and the transmission losses are considered. With the AC optimal power flow model, the AC feasibility of the UC result of the master problem is checked in subproblems. If infeasibility is detected, feedback constraints are generated based on the sensitivity of bus voltages to a change in the unit reactive power generation. They are then introduced into the master problem in the next iteration until all AC violations are eliminated. A 6-bus system, a modified IEEE 30-bus system and the IEEE 118-bus system are used to validate the performance of the proposed method, which provides a satisfactory solution with approximately 44-fold greater computational efficiency. - Highlights: • A decomposition method is proposed to solve the NCUC with AC power flow constraints • The master problem considers active power, reactive power and transmission losses. • OPF-based subproblems check the AC feasibility using parallel computing techniques. • An effective feedback constraint interacts between the master problem and subproblem. • Computational efficiency is significantly improved with satisfactory accuracy

  6. AC distribution system for TFTR pulsed loads

    International Nuclear Information System (INIS)

    Carroll, R.F.; Ramakrishnan, S.; Lemmon, G.N.; Moo, W.I.

    1977-01-01

    This paper outlines the AC distribution system associated with the Tokamak Fusion Test Reactor and discusses the significant areas related to design, protection, and equipment selection, particularly where there is a departure from normal utility and industrial applications

  7. Nonlinear AC susceptibility, surface and bulk shielding

    Science.gov (United States)

    van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.

    1996-02-01

    We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.

  8. Logistics Reduction: Advanced Clothing System (ACS)

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

  9. Marketingová komunikace AC Sparta Praha

    OpenAIRE

    Fanta, Jan

    2016-01-01

    Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...

  10. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  11. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  12. Compensation methods applied in current control schemes for large AC drive systems

    DEFF Research Database (Denmark)

    Rus, D. C.; Preda, N. S.; Teodorescu, Remus

    2012-01-01

    The paper deals with modified PI current control structures for large AC drive systems which use surface mounted permanent magnet synchronous machines or squirrel-cage induction motors supplied with voltage source inverters. In order to reduce the power losses caused by high frequency switching...

  13. Comparative evaluation of soft-switching, bidirectional, isolated AC/DC converter topologies

    NARCIS (Netherlands)

    Everts, J.; Krismer, F.; Van den Keybus, J.; Driesen, Johan; Kolar, J.W.

    2012-01-01

    For realizing bidirectional and isolated AC/DC converters, soft-switching techniques/topologies seem to be a favourable choice as they enable a further loss and volume reduction of the system. Contrary to the traditional dual-stage approach, using a power factor corrector (PFC) stage in series with

  14. AC-DC integrated load flow calculation for variable speed offshore wind farms

    DEFF Research Database (Denmark)

    Zhao, Menghua; Chen, Zhe; Blaabjerg, Frede

    2005-01-01

    This paper proposes a sequential AC-DC integrated load flow algorithm for variable speed offshore wind farms. In this algorithm, the variable frequency and the control strategy of variable speed wind turbine systems are considered. In addition, the losses of wind turbine systems and the losses...... of converters are also integrated into the load flow algorithm. As a general algorithm, it can be applied to different types of wind farm configurations, and the load flow is related to the wind speed....

  15. Ac susceptibility of a Bi-2223/Ag tape in a perpendicular field

    International Nuclear Information System (INIS)

    Savvides, N.; Mueller, K.-H.

    1999-01-01

    Full text: We report experimental measurements and theoretical calculations of the real ( X ') and imaginary or loss ( X '') parts of the ac susceptibility as a function of temperature T = 4 - 130 K, frequency ω/2π = 5 Hz - 5 kHz and ac magnetic field amplitude μ 0 H m = 0.02 - 7 mT for of a monofilament silver-sheathed Bi-2223 tape. The susceptibilities consist of a hysteretic component due to ac loss ( Xsc '') in the superconductor core and an eddy current component due to eddy current loss ( Xed '') in the silver sheath. At high temperatures the low frequency limit is used to calculate the hysteretic and eddy current susceptibilities while at low temperatures the susceptibility is found to be due to eddy currents flowing along the edges of the tape. The measured loss at low frequencies (< 50 Hz) and high temperatures is dominated by the hysteresis loss which varies with amplitude but is essentially independent of frequency. At higher frequencies the eddy current loss of the silver sheath becomes dominant and it increases dramatically with frequency at both low and high temperatures

  16. Design and synthesis of 225Ac radioimmunopharmaceuticals

    International Nuclear Information System (INIS)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.

    2002-01-01

    The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans

  17. Study of Power Flow Algorithm of AC/DC Distribution System including VSC-MTDC

    Directory of Open Access Journals (Sweden)

    Haifeng Liang

    2015-08-01

    Full Text Available In recent years, distributed generation and a large number of sensitive AC and DC loads have been connected to distribution networks, which introduce a series of challenges to distribution network operators (DNOs. In addition, the advantages of DC distribution networks, such as the energy conservation and emission reduction, mean that the voltage source converter based multi-terminal direct current (VSC-MTDC for AC/DC distribution systems demonstrates a great potential, hence drawing growing research interest. In this paper, considering losses of the reactor, the filter and the converter, a mathematical model of VSC-HVDC for the load flow analysis is derived. An AC/DC distribution network architecture has been built, based on which the differences in modified equations of the VSC-MTDC-based network under different control modes are analyzed. In addition, corresponding interface functions under five control modes are provided, and a back/forward iterative algorithm which is applied to power flow calculation of the AC/DC distribution system including VSC-MTDC is proposed. Finally, by calculating the power flow of the modified IEEE14 AC/DC distribution network, the efficiency and validity of the model and algorithm are evaluated. With various distributed generations connected to the network at appropriate locations, power flow results show that network losses and utilization of transmission networks are effectively reduced.

  18. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  19. High benefits approach for electrical energy conversion in electric vehicles from DC to PWM-AC without any generated harmonic

    International Nuclear Information System (INIS)

    Fathabadi, Hassan

    2014-01-01

    Highlights: • Novel hybrid power source including AC feature for using in electric/hybrid vehicles. • Minimizing the energy loss in electric/hybrid vehicles by using the proposed system. • Suitable AC wave form for braking/accelerating purposes in electric/hybrid vehicles. • A novelty is that the harmonic generated by the added AC feature is really zero. • Another novelty is the capability of choosing arbitrary frequency for AC feature. - Abstract: This paper presents a novel hybrid power source, including a Li-ion battery together with an interface, which generates simultaneously electrical energy with the forms of both DC and AC for electric vehicles. A novel and high benefits approach is applied to convert the electrical energy of the Li-ion battery from DC form to single-phase symmetric pulse-width modulation (PWM)-AC form. Harmonic generation is one of the important problems when electrical energy is converted from DC to AC but there are not any generated harmonic during the DC/AC conversion using the proposed technique. The proposed system will be widely used in electric/hybrid vehicles because it has many benefits. Minimizing the energy loss (saving energy), no generated harmonic (it is really zero), the capability of arbitrary/necessary frequency selection for output AC voltage and the ability of long distance energy transmission are some novelties and advantages of the proposed system. The proposed hybrid power source including DC/AC PWM inverter is simulated in Proteus 6 software environment and a laboratory-based prototype of the hybrid power source is constructed to validate the theoretical and simulation results. Simulation and experimental results are presented to prove the superiority of the proposed hybrid power supply

  20. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  1. Superconducting three element synchronous ac machine

    International Nuclear Information System (INIS)

    Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

    1975-01-01

    There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

  2. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  3. AC conductivity for a holographic Weyl semimetal

    Energy Technology Data Exchange (ETDEWEB)

    Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)

    2017-03-23

    We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.

  4. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...

  5. Preliminary study on AC superconducting machines

    International Nuclear Information System (INIS)

    Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

    1988-01-01

    This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

  6. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  7. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  8. Statistical time lags in ac discharges

    International Nuclear Information System (INIS)

    Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F

    2011-01-01

    The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

  9. Statistical time lags in ac discharges

    Energy Technology Data Exchange (ETDEWEB)

    Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)

    2011-04-06

    The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

  10. Study on core make-up water experiment of AC600 make-up water tank

    International Nuclear Information System (INIS)

    Ji Fuyun; Li Changlin; Zheng Hua; Liu Shaohua; Xu Xiaolan

    1999-01-01

    The core makeup tank (CMT) is a principal component of the passive high pressure safety injection systems for AC600 and has a function to inject cold borated water into reactor vessel during abnormal events. The purpose of this experiment is to verify the gravity drain behavior of the CMT and to provide experimental data to verify the computer codes used in the safety analyses. Five experiments with simulative small and medium break conditions are conducted at AC600 core makeup tank performance test facility of Nuclear Power Institute of China (NPIC). The author provides the results of one test. The simulated accident is a small break loss-of-coolant accident

  11. Estimation of Transformer Parameters and Loss Analysis for High Voltage Capacitor Charging Application

    DEFF Research Database (Denmark)

    Thummala, Prasanth; Schneider, Henrik; Ouyang, Ziwei

    2013-01-01

    In a bi-directional DC-DC converter for capacitive charging application, the losses associated with the transformer makes it a critical component. In order to calculate the transformer losses, its parameters such as AC resistance, leakage inductance and self capacitance of the high voltage (HV......) winding has to be estimated accurately. This paper analyzes the following losses of bi-directional flyback converter namely switching loss, conduction loss, gate drive loss, transformer core loss, and snubber loss, etc. Iterative analysis of transformer parameters viz., AC resistance, leakage inductance...

  12. Multi-phase AC/AC step-down converter for distribution systems

    Science.gov (United States)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  13. Dielectric behavior and ac electrical conductivity of nanocrystalline nickel aluminate

    International Nuclear Information System (INIS)

    Kurien, Siby; Mathew, Jose; Sebastian, Shajo; Potty, S.N.; George, K.C.

    2006-01-01

    Nanocrystalline nickel aluminate was prepared by chemical co-precipitation, and nanoparticles having different particle size were obtained by annealing the precursor at different temperatures. The TG/DTA measurements showed thermal decomposition was a three-step process with crystallisation of the spinel phase started at a temperature 420 deg. C. The X-ray diffraction analysis confirmed that the specimen began to crystallise on annealing above 420 deg. C and became almost crystalline at about 900 deg. C. The particle sizes were calculated from XRD. Dielectric properties of nickel aluminate were studied as a function of the frequency of the applied ac signal at different temperatures. It was seen the real dielectric constant ε', and dielectric loss tan δ decreased with frequency of applied field while the ac conductivity increased as the frequency of the applied field increased. The dielectric relaxation mechanism is explained by considering nanostructured NiAl 2 O 4 as a carrier-dominated dielectric with high density of hopping charge carriers. The variation of ε' with different particle size depends on several interfacial region parameters, which change with the average particle size

  14. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  15. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Gould, O.L.

    1996-01-01

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  16. THE ACS NEARBY GALAXY SURVEY TREASURY

    International Nuclear Information System (INIS)

    Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  17. Meso Mechanical Analysis of AC Mixture Response

    NARCIS (Netherlands)

    Woldekidan, M.F.; Huurman, M.; Vaccari, E.; Poot, M.

    2012-01-01

    Ongoing research into performance modeling of Asphalt Concrete (AC) mixtures using meso mechanics approaches is being undertaken at Delft University of Technology (TUD). The approach has already been successfully employed for evaluating the long term performance of porous asphalt concrete. The work

  18. Capacitance measurements and AC conductivity of Nickel Phthalocyanine films

    International Nuclear Information System (INIS)

    Darwish, S.

    2005-01-01

    A C dark Current measurements of nickel phthalocyanine thin films using ohmic gold electrodes are investigated in the frequency range 30-10 Hz and within the temperature range 295-385 K. The A C conductivity as D Ac is found to vary as within the index s < 1, indicating a dominant hopping process at low temperatures. From the temperature dependence of A C conductivity, free carrier conduction with mean activation energy of 0.31 eV is observed at higher temperatures. Capacitance and loss tangent are found to be decreased with increasing frequency and increase with increasing temperature. Such characteristics are found to be in good qualitative agreement with existing equivalent circuit model assuming ohmic contacts

  19. Dielectric response and ac conductivity analysis of hafnium oxide nanopowder

    International Nuclear Information System (INIS)

    Karahaliou, P K; Xanthopoulos, N; Krontiras, C A; Georga, S N

    2012-01-01

    The dielectric response of hafnium oxide nanopowder was studied in the frequency range of 10 -2 -10 6 MHz and in the temperature range of 20-180 °C. Broadband dielectric spectroscopy was applied and the experimental results were analyzed and discussed using the electric modulus (M*) and alternating current (ac) conductivity formalisms. The analyses of the dc conductivity and electric modulus data revealed the presence of mechanisms which are thermally activated, both with almost the same activation energy of 1.01 eV. A fitting procedure involving the superposition of the thermally activated dc conductivity, the universal dielectric responce and the near constant loss terms has been used to describe the frequency evolution of the real part of the specific electrical conductivity. The conductivity master curve was obtained, suggesting that the time-temperature superposition principle applies for the studied system, thus implying that the conductivity mechanisms are temperature independent.

  20. AC conductivity and dielectric properties of bulk tungsten trioxide (WO3)

    Science.gov (United States)

    El-Nahass, M. M.; Ali, H. A. M.; Saadeldin, M.; Zaghllol, M.

    2012-11-01

    AC conductivity and dielectric properties of tungsten trioxide (WO3) in a pellet form were studied in the frequency range from 42 Hz to 5 MHz with a variation of temperature in the range from 303 K to 463 K. AC conductivity, σac(ω) was found to be a function of ωs where ω is the angular frequency and s is the frequency exponent. The values of s were found to be less than unity and decrease with increasing temperature, which supports the correlated barrier hopping mechanism (CBH) as the dominant mechanism for the conduction in WO3. The dielectric constant (ε‧) and dielectric loss (ε″) were measured. The Cole-Cole diagram determined complex impedance for different temperatures.

  1. Experiencing Loss

    DEFF Research Database (Denmark)

    Kristiansen, Maria; Younis, Tarek; Hassani, Amani

    2015-01-01

    In this article, we explore how Islam, minority status and refugee experiencesintersect in shaping meaning-making processes following bereavement. We do this througha phenomenological analysis of a biographical account of personal loss told by Aisha, a Muslim Palestinian refugee living in Denmark......, who narrates her experience of losing herhusband to lung cancer. By drawing on a religious framework, Aisha creates meaning fromher loss, which enables her to incorporate this loss into her life history and sustain agency.Her narrative invites wider audiences to witness her tale of overcoming loss...

  2. Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

    Science.gov (United States)

    Han, Xiaomin; Li, Guojing; Zhang, Shuqun

    2017-01-01

    Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

  3. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  4. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  5. Flux-transfer losses in helically wound superconducting power cables

    International Nuclear Information System (INIS)

    Clem, John R; Malozemoff, A P

    2013-01-01

    Minimization of ac losses is essential for economic operation of high-temperature superconductor (HTS) ac power cables. A favorable configuration for the phase conductor of such cables has two counter-wound layers of HTS tape-shaped wires lying next to each other and helically wound around a flexible cylindrical former. However, if magnetic materials such as magnetic substrates of the tapes lie between the two layers, or if the winding pitch angles are not opposite and essentially equal in magnitude to each other, current distributes unequally between the two layers. Then, if at some point in the ac cycle the current of either of the two layers exceeds its critical current, a large ac loss arises from the transfer of flux between the two layers. A detailed review of the formalism, and its application to the case of paramagnetic substrates including the calculation of this flux-transfer loss, is presented. (paper)

  6. Physical aspects of magnetic hyperthermia: Low-frequency ac field absorption in a magnetic colloid

    International Nuclear Information System (INIS)

    Raikher, Yu. L.; Stepanov, V.I.

    2014-01-01

    A uniaxially anisotropic superparamagnetic particle suspended in a viscous fluid and subjected to an ac field is considered. Consistently taking into account both internal (Néel) and external (Brownian) magnetic relaxations, a simple expression for the dynamic susceptibility is obtained. This result, with regard to the ac field energy absorption, is compared to the common heuristic approach. This is done for a model polydisperse colloid containing maghemite nanoparticles, which are assumed to posses either bulk or surface magnetic anisotropy. It is shown that viscous losses caused by the particle motion in a fluid matrix make important contribution to the full magnetic response of a ferrocolloid and, thus, its ability to absorb the ac field energy. The obtained exact expression, which takes in both dissipation mechanisms, paves the way to correct optimization of the nanoparticle-mediated heating effect. - Highlights: • A uniaxially anisotropic superparamagnetic particle suspended in a viscous fluid and subjected to an ac field is considered. • Consistently taking into account both internal (Néel) and external (Brownian) magnetic relaxations, a simple expression for the dynamic susceptibility is obtained. • This result, with regard to the ac field energy absorption, is compared to the common heuristic approach using as a benchmark a model polydisperse colloid containing maghemite nanoparticles, which are assumed to posses either bulk or surface magnetic anisotropy. • It is shown that viscous losses caused by the particle motion in a fluid matrix make important contribution to the full magnetic response of a ferrocolloid and, thus, its ability to absorb the ac field energy. • The obtained exact expression, which takes in both dissipation mechanisms, paves the way to correct optimization of the nanoparticle-mediated heating effect

  7. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  8. Memory loss

    Science.gov (United States)

    ... barbiturates or ( hypnotics ) ECT (electroconvulsive therapy) (most often short-term memory loss) Epilepsy that is not well controlled Illness that ... appointment. Medical history questions may include: Type of memory loss, such as short-term or long-term Time pattern, such as how ...

  9. Faradaic AC Electrokinetic Flow and Particle Traps

    Science.gov (United States)

    Ben, Yuxing; Chang, Hsueh-Chia

    2004-11-01

    Faradaic reaction at higher voltages can produce co-ion polarization at AC electrodes instead of counter-ion polarization due to capacitive charging from the bulk. The Faradaic co-ion polarization also does not screen the external field and hence can produce large net electro-kinetic flows at frequencies lower than the inverse RC time of the double layer. Due to the opposite polarization of capacitve and Faradaic charging, we can reverse the direction of AC flows on electrodes by changing the voltage and frequency. Particles and bacteria are trapped and then dispersed at stagnation lines, at locations predicted by our theory, by using these two flows sequentially. This technique offers a good way to concentrate and detect bacteria.

  10. Impedance Spectroscopy and AC Conductivity Studies of Bulk 3-Amino-7-(dimethylamino)-2-methyl-hydrochloride

    Science.gov (United States)

    El-Shabaan, M. M.

    2018-02-01

    Impedance spectroscopy and alternating-current (AC) conductivity (σ AC) studies of bulk 3-amino-7-(dimethylamino)-2-methyl-hydrochloride (neutral red, NR) have been carried out over the temperature (T) range from 303 K to 383 K and frequency (f) range from 0.5 kHz to 5 MHz. Dielectric data were analyzed using the complex impedance (Z *) and complex electric modulus (M *) for bulk NR at various temperatures. The impedance loss peaks were found to shift towards high frequencies, indicating an increase in the relaxation time (τ 0) and loss in the material, with increasing temperature. For each temperature, a single depressed semicircle was observed at high frequencies, originating from the bulk transport, and a spike in the low-frequency region, resulting from the electrode effect. Fitting of these curves yielded an equivalent circuit containing a parallel combination of a resistance R and constant-phase element (CPE) Q. The carrier transport in bulk NR is governed by the correlated barrier hopping (CBH) mechanism, some parameters of which, such as the maximum barrier height (W M), charge density (N), and hopping distance (r), were determined as functions of both temperature and frequency. The frequency dependence of σ AC at different temperatures indicated that the conduction in bulk NR is a thermally activated process. The σ AC value at different frequencies increased linearly with temperature.

  11. Aging, Counterfeiting Configuration Control (AC3)

    Science.gov (United States)

    2010-01-31

    Systems Intergrated Into AC3 CABS - Common As-Built System PRISM - Process Re-inventing Integration Systems for Manufacturing PDM - Product Data...looks forward to deploying the completed tool at Raytheon in a true production environment, for as much as we like the challenge associated with...performance of DoD systems. DoD systems are particularly susceptible to intrusion of counterfeit parts, especially during surge and extended production

  12. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  13. Modeling photovoltaic systems for AC appliances

    Directory of Open Access Journals (Sweden)

    Andreea Maria Neaca

    2009-10-01

    Full Text Available In this paper is described the development of a model which can simulate the performance of a photovoltaic (PV system under specific meteorological conditions and transforming the DC current into AC current. In this model, the accent stands on the design of a series charge regulator. It is treated also the benefit of creating a circuit, with different methods, that can test the maximum power point trackers (MPPT for different photovoltaic applications.

  14. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    Over the last decade, distributed energy resources (DER) technology has undergone a fast development. Increased penetration of DER units and wide spread use of renewable energy sources challenge the entire architecture of traditional power system. Microgrid, characterizing higher flexibility......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  15. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  16. Alternating current loss characteristics in (bismuth,lead)SCCO and yttrium barium copper oxide superconducting tapes

    Science.gov (United States)

    Nguyen, Doan Ngoc

    Alternating current (AC) loss and current carrying capacity are two of the most crucial considerations in large-scale power applications of high temperature superconducting (HTS) conductors. AC losses result in an increased thermal load for cooling machines, and thus increased operating costs. Furthermore, AC losses can stimulate quenching phenomena or at least decrease the stability margin for superconducting devices. Thus, understanding AC losses is essential for the development of HTS AC applications. The main focus of this dissertation is to make reliable total AC loss measurements and interpret the experimental results in a theoretical framework. With a specially designed magnet, advanced total AC loss measurement system in liquid nitrogen (77 K) has been successfully built. Both calorimetric and electromagnetic methods were employed to confirm the validity of the measured results and to have a more thorough understanding of AC loss in HTS conductors. The measurement is capable of measuring total AC loss in HTS tapes over a wide range of frequency and amplitude of transport current and magnetic field. An accurate phase control technique allows measurement of total AC loss with any phase difference between the transport current and magnetic field by calorimetric method. In addition, a novel total AC loss measurement system with variable temperatures from 30 K to 100 K was successfully built and tested. Understanding the dependence of AC losses on temperature will enable optimization of the operating temperature and design of HTS devices. As a part of the dissertation, numerical calculations using Brandt's model were developed to study electrodynamics and total AC loss in HTS conductors. In the calculations, the superconducting electrical behavior is assumed to follow a power-law model. In general, the practical properties of conductors, including field-dependence of critical current density Jc, n-value and non-uniform distribution of Jc, can be accounted for in

  17. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  18. Interior point algorithm-based power flow optimisation of a combined AC and DC multi-terminal grid

    Directory of Open Access Journals (Sweden)

    Farhan Beg

    2015-01-01

    Full Text Available The high cost of power electronic equipment, lower reliability and poor power handling capacity of the semiconductor devices had stalled the deployment of systems based on DC (multi-terminal direct current system (MTDC networks. The introduction of voltage source converters (VSCs for transmission has renewed the interest in the development of large interconnected grids based on both alternate current (AC and DC transmission networks. Such a grid platform also realises the added advantage of integrating the renewable energy sources into the grid. Thus a grid based on DC MTDC network is a possible solution to improve energy security and check the increasing supply demand gap. An optimal power solution for combined AC and DC grids obtained by the solution of the interior point algorithm is proposed in this study. Multi-terminal HVDC grids lie at the heart of various suggested transmission capacity increases. A significant difference is observed when MTDC grids are solved for power flows in place of conventional AC grids. This study deals with the power flow problem of a combined MTDC and an AC grid. The AC side is modelled with the full power flow equations and the VSCs are modelled using a connecting line, two generators and an AC node. The VSC and the DC losses are also considered. The optimisation focuses on several different goals. Three different scenarios are presented in an arbitrary grid network with ten AC nodes and five converter stations.

  19. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho

    2017-01-01

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field

  20. The Hubble Legacy Archive ACS grism data

    Science.gov (United States)

    Kümmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.

    2011-06-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 μm, with a dispersion of 40 Å/pixel and a resolution of ~80 Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47 919 datasets (65% of the total number of extracted spectra) for 32 149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2 - 4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects

  1. Alpha decay 225 Ac → 221Fr

    International Nuclear Information System (INIS)

    Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.

    2004-01-01

    Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the

  2. Weight Loss

    Science.gov (United States)

    ... Rights Employment Discrimination Health Care Professionals Law Enforcement Driver's License For Lawyers Food & Fitness Home Food MyFoodAdvisor ... Fit Types of Activity Weight Loss Assess Your Lifestyle Getting Started Food Choices In My Community Home ...

  3. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  4. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  5. Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

    Science.gov (United States)

    Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

    2012-01-01

    The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

  6. Alternating current losses of a 10 metre long low loss superconducting cable conductor determined from phase sensitive measurements

    International Nuclear Information System (INIS)

    Krueger Olsen, S.; Kuehle, A.; Traeholt, C.; C Rasmussen, C.; Toennesen, O.; Daeumling, M.; Rasmussen, C.N.; Willen, D.W.A.

    1999-01-01

    The ac loss of a superconducting cable conductor carrying an ac current is small. Therefore the ratio between the inductive (out-of-phase) and the resistive (in-phase) voltages over the conductor is correspondingly high. In vectorial representations this results in phase angles between the current and the voltage over the cable close to 90 degrees. This has the effect that the loss cannot be derived directly using most commercial lock-in amplifiers due to their limited absolute accuracy. However, by using two lock-in amplifiers and an appropriate correction scheme the high relative accuracy of such lock-in amplifiers can be exploited. In this paper we present the results from ac-loss measurements on a low loss 10 metre long high temperature superconducting cable conductor using such a correction scheme. Measurements were carried out with and without a compensation circuit that could reduce the inductive voltage. The 1 μV cm -1 critical current of the conductor was 3240 A at 77 K. At an rms current of 2 kA (50 Hz) the ac loss was derived to be 0.6±0.15 W m -1 . This is, to the best of our knowledge, the lowest value of ac loss of a high temperature superconducting cable conductor reported so far at these high currents. (author)

  7. Three-Phase AC Optimal Power Flow Based Distribution Locational Marginal Price: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Rui; Zhang, Yingchen

    2017-05-17

    Designing market mechanisms for electricity distribution systems has been a hot topic due to the increased presence of smart loads and distributed energy resources (DERs) in distribution systems. The distribution locational marginal pricing (DLMP) methodology is one of the real-time pricing methods to enable such market mechanisms and provide economic incentives to active market participants. Determining the DLMP is challenging due to high power losses, the voltage volatility, and the phase imbalance in distribution systems. Existing DC Optimal Power Flow (OPF) approaches are unable to model power losses and the reactive power, while single-phase AC OPF methods cannot capture the phase imbalance. To address these challenges, in this paper, a three-phase AC OPF based approach is developed to define and calculate DLMP accurately. The DLMP is modeled as the marginal cost to serve an incremental unit of demand at a specific phase at a certain bus, and is calculated using the Lagrange multipliers in the three-phase AC OPF formulation. Extensive case studies have been conducted to understand the impact of system losses and the phase imbalance on DLMPs as well as the potential benefits of flexible resources.

  8. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  9. AC susceptibility enhancement studies in magnetic systems

    International Nuclear Information System (INIS)

    Mukherjee, S.; Ranganathan, R.; Chakravarti, A.; Sil, S.

    2001-01-01

    Enhancement of AC susceptibility has been observed for typical ferromagnets (Gd), reentrant spin glasses like (Fe 1.5 Mn 1.5 Si) and canted spin systems (Ce(Fe 0.96 Al 0.04 ) 2 ). The data have been interpreted with the help of a simulation model based on dry friction-like pinning of domain walls for systems having ferromagnetic domain structures. A strong pinning mechanism appears in the reentrant spin glass like and canted spin systems at low temperatures in addition to the intrinsic one in the ferromagnetic phase. The temperature variation of the pinning potential has been given qualitatively for the reentrant spin glass like systems

  10. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez

    2015-01-01

    and DC microgrids, and then investigates the existing and promising solutions for the corresponding challenges. To the authors’ knowledge, three parts of smart grids are required to be developed to facilitate implementation of protection scheme in microgrids. The main requirements and open issues......In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  11. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  12. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  13. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

  14. Hidden loss

    DEFF Research Database (Denmark)

    Kieffer-Kristensen, Rikke; Johansen, Karen Lise Gaardsvig

    2013-01-01

    to participate. RESULTS: All children were affected by their parents' ABI and the altered family situation. The children's expressions led the authors to identify six themes, including fear of losing the parent, distress and estrangement, chores and responsibilities, hidden loss, coping and support. The main......PRIMARY OBJECTIVE: The purpose of this study was to listen to and learn from children showing high levels of post-traumatic stress symptoms after parental acquired brain injury (ABI), in order to achieve an in-depth understanding of the difficulties the children face in their everyday lives...... finding indicates that the children experienced numerous losses, many of which were often suppressed or neglected by the children to protect the ill parents. CONCLUSIONS: The findings indicated that the children seemed to make a special effort to hide their feelings of loss and grief in order to protect...

  15. Optimizing efficiency on conventional transformer based low power AC/DC standby power supplies

    DEFF Research Database (Denmark)

    Nielsen, Nils

    2004-01-01

    This article describes the research results for simple and cheap methods to reduce the idle- and load-losses in very low power conventional transformer based power supplies intended for standby usage. In this case "very low power" means 50 Hz/230 V-AC to 5 V-DC@1 W. The efficiency is measured...... on two common power supply topologies designed for this power level. The two described topologies uses either a series (or linear) or a buck regulation approach. Common to the test power supplies is they either are using a standard cheap off-the-shelf transformer, or one, which are loss optimized by very...

  16. Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

    Directory of Open Access Journals (Sweden)

    Amir V. Tavakoli

    2017-09-01

    Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

  17. Bifurcation theory of ac electric arcing

    International Nuclear Information System (INIS)

    Christen, Thomas; Peinke, Emanuel

    2012-01-01

    The performance of alternating current (ac) electric arcing devices is related to arc extinction or its re-ignition at zero crossings of the current (so-called ‘current zero’, CZ). Theoretical investigations thus usually focus on the transient behaviour of arcs near CZ, e.g. by solving the modelling differential equations in the vicinity of CZ. This paper proposes as an alternative approach to investigate global mathematical properties of the underlying periodically driven dynamic system describing the electric circuit containing the arcing device. For instance, the uniqueness of the trivial solution associated with the insulating state indicates the extinction of any arc. The existence of non-trivial attractors (typically a time-periodic state) points to a re-ignition of certain arcs. The performance regions of arcing devices, such as circuit breakers and arc torches, can thus be identified with the regions of absence and existence, respectively, of non-trivial attractors. Most important for applications, the boundary of a performance region in the model parameter space is then associated with the bifurcation of the non-trivial attractors. The concept is illustrated for simple black-box arc models, such as the Mayr and the Cassie model, by calculating for various cases the performance boundaries associated with the bifurcation of ac arcs. (paper)

  18. A nonlinear model for AC induced corrosion

    Directory of Open Access Journals (Sweden)

    N. Ida

    2012-09-01

    Full Text Available The modeling of corrosion poses particular difficulties. The understanding of corrosion as an electrochemical process has led to simple capacitive-resistive models that take into account the resistance of the electrolytic cell and the capacitive effect of the surface potential at the interface between conductors and the electrolyte. In some models nonlinear conduction effects have been added to account for more complex observed behavior. While these models are sufficient to describe the behavior in systems with cathodic protection, the behavior in the presence of induced AC currents from power lines and from RF sources cannot be accounted for and are insufficient to describe the effects observed in the field. Field observations have shown that a rectifying effect exists that affects the cathodic protection potential and this effect is responsible for corrosion in the presence of AC currents. The rectifying effects of the metal-corrosion interface are totally missing from current models. This work proposes a nonlinear model based on finite element analysis that takes into account the nonlinear behavior of the metal-oxide interface and promises to improve modeling by including the rectification effects at the interface.

  19. Measuring Gravitational Flexion in ACS Clusters

    Science.gov (United States)

    Goldberg, David

    2005-07-01

    We propose measurement of the gravitational "Flexion" signal in ACS cluster images. The flexion, or "arciness" of a lensed background galaxy arises from variations in the lensing field. As a result, it is extremely sensitive to small scale perturbations in the field, and thus, to substructure in clusters. Moreover, because flexion represents gravitationally induced asymmetries in the lensed image, it is completely separable from traditional measurements of shear, which focus on the induced ellipticity of the image, and thus, the two signals may be extracted simultaneously. Since typical galaxies are roughly symmetric upon 180 degree rotation, even a small induced flexion can potentially produce a noticeable effect {Goldberg & Bacon, 2005}. We propose the measurement of substructure within approximately 4 clusters with high-quality ACS data, and will further apply a test of a new tomographic technique whereby comparisons of lensed arcs at different redshifts may be used to estimate the background cosmology, and thus place constraints on the equation of state of dark energy.

  20. Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

    International Nuclear Information System (INIS)

    Fang Minggang; Nie, Yingchao; Theilmann, David A.

    2009-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

  1. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  2. An ABC transporter mutation is correlated with insect resistance to Bacillus thuringiensis Cry1Ac toxin.

    Directory of Open Access Journals (Sweden)

    Linda J Gahan

    2010-12-01

    Full Text Available Transgenic crops producing insecticidal toxins from Bacillus thuringiensis (Bt are commercially successful in reducing pest damage, yet knowledge of resistance mechanisms that threaten their sustainability is incomplete. Insect resistance to the pore-forming Cry1Ac toxin is correlated with the loss of high-affinity, irreversible binding to the mid-gut membrane, but the genetic factors responsible for this change have been elusive. Mutations in a 12-cadherin-domain protein confer some Cry1Ac resistance but do not block this toxin binding in in vitro assays. We sought to identify mutations in other genes that might be responsible for the loss of binding. We employed a map-based cloning approach using a series of backcrosses with 1,060 progeny to identify a resistance gene in the cotton pest Heliothis virescens that segregated independently from the cadherin mutation. We found an inactivating mutation of the ABC transporter ABCC2 that is genetically linked to Cry1Ac resistance and is correlated with loss of Cry1Ac binding to membrane vesicles. ABC proteins are integral membrane proteins with many functions, including export of toxic molecules from the cell, but have not been implicated in the mode of action of Bt toxins before. The reduction in toxin binding due to the inactivating mutation suggests that ABCC2 is involved in membrane integration of the toxin pore. Our findings suggest that ABC proteins may play a key role in the mode of action of Bt toxins and that ABC protein mutations can confer high levels of resistance that could threaten the continued utilization of Bt-expressing crops. However, such mutations may impose a physiological cost on resistant insects, by reducing export of other toxins such as plant secondary compounds from the cell. This weakness could be exploited to manage this mechanism of Bt resistance in the field.

  3. An ABC transporter mutation is correlated with insect resistance to Bacillus thuringiensis Cry1Ac toxin.

    Science.gov (United States)

    Gahan, Linda J; Pauchet, Yannick; Vogel, Heiko; Heckel, David G

    2010-12-16

    Transgenic crops producing insecticidal toxins from Bacillus thuringiensis (Bt) are commercially successful in reducing pest damage, yet knowledge of resistance mechanisms that threaten their sustainability is incomplete. Insect resistance to the pore-forming Cry1Ac toxin is correlated with the loss of high-affinity, irreversible binding to the mid-gut membrane, but the genetic factors responsible for this change have been elusive. Mutations in a 12-cadherin-domain protein confer some Cry1Ac resistance but do not block this toxin binding in in vitro assays. We sought to identify mutations in other genes that might be responsible for the loss of binding. We employed a map-based cloning approach using a series of backcrosses with 1,060 progeny to identify a resistance gene in the cotton pest Heliothis virescens that segregated independently from the cadherin mutation. We found an inactivating mutation of the ABC transporter ABCC2 that is genetically linked to Cry1Ac resistance and is correlated with loss of Cry1Ac binding to membrane vesicles. ABC proteins are integral membrane proteins with many functions, including export of toxic molecules from the cell, but have not been implicated in the mode of action of Bt toxins before. The reduction in toxin binding due to the inactivating mutation suggests that ABCC2 is involved in membrane integration of the toxin pore. Our findings suggest that ABC proteins may play a key role in the mode of action of Bt toxins and that ABC protein mutations can confer high levels of resistance that could threaten the continued utilization of Bt-expressing crops. However, such mutations may impose a physiological cost on resistant insects, by reducing export of other toxins such as plant secondary compounds from the cell. This weakness could be exploited to manage this mechanism of Bt resistance in the field.

  4. Alternating current losses of a 10 metre long low loss superconducting cable conductor determined from phase sensitive measurements

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten

    1999-01-01

    The ac loss of a superconducting cable conductor carrying an ac current is small. Therefore the ratio between the inductive (out-of-phase) and the resistive (in-phase) voltages over the conductor is correspondingly high. In vectorial representations this results in phase angles between the current......-in amplifiers can be exploited. In this paper we present the results from ac-loss measurements on a low loss 10 metre long high temperature superconducting cable conductor using such a correction scheme. Measurements were carried out with and without a compensation circuit that could reduce-the inductive...... voltage. The 1 mu V cm(-1) critical current of the conductor was 3240 A at 77 K. At an rms current of 2 kA (50 Hz) the ac loss was derived to be 0.6 +/- 0.15 W m(-1). This is, to the best of our knowledge, the lowest value of ac loss of a high temperature superconducting cable conductor reported so far...

  5. Ac conductivity and dielectric properties of bulk tin phthalocyanine dichloride (SnPcCl 2)

    Science.gov (United States)

    El-Nahass, M. M.; Farid, A. M.; Abd El-Rahman, K. F.; Ali, H. A. M.

    2008-07-01

    The ac conductivity, σac( ω), has been measured for bulk tin phthalocyanine dichloride (SnPcCl 2) in the form of compressed pellet with evaporated ohmic Au electrodes in a temperature range 303-403 K. Ac conductivity, σac( ω), is found to vary as ωs in the frequency range 42 Hz-5×10 6 Hz. At low range of frequency, s<1 and it decreases with the increase in temperature indicating a dominant hopping process. At high range of frequency, s is found to be equal to ≈1.09 and is temperature independent. The dielectric constant, ε1, and dialectic loss, ε2, have been determined for bulk SnPcCl 2. Both ε1 and ε2 decrease with the increase in frequency and increase with the increase in temperature. The Cole-Cole types have been used to determine some parameters such as; the macroscopic relaxation time ( τo), the molecular relaxation time ( τ), the activation energy for relaxation ( Eo) and the distribution parameter ( α). The temperature dependence of τ is expressed by a thermally activated process with the activation energy of 0.299 eV.

  6. Nature of Dielectric Properties, Electric Modulus and AC Electrical Conductivity of Nanocrystalline ZnIn2Se4 Thin Films

    Science.gov (United States)

    El-Nahass, M. M.; Attia, A. A.; Ali, H. A. M.; Salem, G. F.; Ismail, M. I.

    2018-02-01

    The structural characteristics of thermally deposited ZnIn2Se4 thin films were indexed utilizing x-ray diffraction as well as scanning electron microscopy techniques. Dielectric properties, electric modulus and AC electrical conductivity of ZnIn2Se4 thin films were examined in the frequency range from 42 Hz to 106 Hz. The capacitance, conductance and impedance were measured at different temperatures. The dielectric constant and dielectric loss decrease with an increase in frequency. The maximum barrier height was determined from the analysis of the dielectric loss depending on the Giuntini model. The real part of the electric modulus revealed a constant maximum value at higher frequencies and the imaginary part of the electric modulus was characterized by the appearance of dielectric relaxation peaks. The AC electrical conductivity obeyed the Jonscher universal power law. Correlated barrier hopping model was the appropriate mechanism for AC conduction in ZnIn2Se4 thin films. Estimation of the density of states at the Fermi level and activation energy, for AC conduction, was carried out based on the temperature dependence of AC electrical conductivity.

  7. ACS6, a Hydrogen sulfide-donating derivative of sildenafil, inhibits homocysteine-induced apoptosis by preservation of mitochondrial function

    Directory of Open Access Journals (Sweden)

    Tang Xiao-Qing

    2011-08-01

    Full Text Available Abstract Background The hydrogen sulfide-releasing sildenafil, ACS6, has been demonstrated to inhibit superoxide formation through donating hydrogen sulfide (H2S. We have found that H2S antagonizes homocysteine-induced oxidative stress and neurotoxicity. The aim of the present study is to explore the protection of ACS6 against homocysteine-triggered cytotoxicity and apoptosis and the molecular mechanisms underlying in PC12 cells. Methods Cell viability was determined by Cell Counting Kit-8 assay. Cell apoptosis was observed using the chromatin dye Hoechst 33258 and analyzed by Flow Cytometry after propidium iodide staining. Mitochondrial membrane potential was monitored using the fluorescent dye Rh123. Intracellular reactive oxygen species were determined by oxidative conversion of cell permeable 2',7'-dichlorfluorescein-diacetate to fluorescent 2',7'-dichlorfluorescein. The expression of cleaved caspase-3 and bcl-2 and the accumulation of cytosolic cytochrome c were analyzed by Western blot. Results We show that ACS6 protects PC12 cells against cytotoxicity and apoptosis induced by homocysteine and blocks homocysteine-triggered cytochrome c release and caspase-3 activation. ACS6 treatment results in not only prevention of homocysteine-caused mitochondrial membrane potential (Δψ loss and reactive oxygen species (ROS overproduction but also reversal of Bcl-2 down-expression. Conclusions These results indicate that ACS6 protects PC12 cells against homocysteine-induced cytotoxicity and apoptosis by preservation of mitochondrial function though inhibiting both loss of Δψ and accumulation of ROS as well as modulating the expression of Bcl-2. Our study provides evidence both for a neuroprotective effect of ACS6 and for further evaluation of ACS6 as novel neuroprotectants for Alzheimer's disease associated with homocysteine.

  8. Transcranial alternating current stimulation (tACS

    Directory of Open Access Journals (Sweden)

    Andrea eAntal

    2013-06-01

    Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.

  9. A wide-frequency range AC magnetometer to measure the specific absorption rate in nanoparticles for magnetic hyperthermia

    International Nuclear Information System (INIS)

    Garaio, E.; Collantes, J.M.; Garcia, J.A.; Plazaola, F.; Mornet, S.; Couillaud, F.; Sandre, O.

    2014-01-01

    Measurement of specific absorption rate (SAR) of magnetic nanoparticles is crucial to assert their potential for magnetic hyperthermia. To perform this task, calorimetric methods are widely used. However, those methods are not very accurate and are difficult to standardize. In this paper, we present AC magnetometry results performed with a lab-made magnetometer that is able to obtain dynamic hysteresis-loops in the AC magnetic field frequency range from 50 kHz to 1 MHz and intensities up to 24 kA m −1 . In this work, SAR values of maghemite nanoparticles dispersed in water are measured by AC magnetometry. The so-obtained values are compared with the SAR measured by calorimetric methods. Both measurements, by calorimetry and magnetometry, are in good agreement. Therefore, the presented AC magnetometer is a suitable way to obtain SAR values of magnetic nanoparticles. - Highlights: • We propose AC magnetometry as a method to measure the specific absorption rate (SAR) of magnetic nanoparticles suitable for magnetic hyperthermia therapy. • We have built a lab-made AC magnetometer, which is able to measure magnetic dynamic hysteresis-loops of nanoparticle dispersions. • The device works with AC magnetic field intensities up to 24 kA m −1 in a frequency range from 75 kHz to 1 MHz. • The SAR values of maghemite nanoparticles around 12 nm in magnetic diameter dispersed in water are measured by the lab-made magnetometer and different calorimetric methods. • Although all methods are in good agreement, several factors (probe location, thermal inertia, losses, etc.) make calorimetric method less accurate than AC magnetometry

  10. AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

    Science.gov (United States)

    El-Nahass, M. M.; Ali, H. A. M.

    2012-06-01

    AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

  11. Effect of alkali content on AC conductivity of borate glasses containing two transition metals

    International Nuclear Information System (INIS)

    Kashif, I.; Rahman, Samy A.; Soliman, A.A.; Ibrahim, E.M.; Abdel-Khalek, E.K.; Mostafa, A.G.; Sanad, A.M.

    2009-01-01

    Sodium borate glasses containing iron and molybdenum ions with the total concentration of transition ions constant and gradual substitution of sodium oxide (network modifier) by borate oxide (network former) was prepared. Densities, molar volume, DC and AC conductivities are measured. The trends of these properties are attributed to changes in the glass network structure. Their DC and AC conductivity increased with increasing NaO concentration. The increase of AC conductivity of sodium borate glasses is attributed to the chemical composition and the hopping mechanism of conduction. Measurements of the dielectric constant (ε) and dielectric loss (tan δ) as a function of frequency (50 Hz-100 kHz) and temperature (RT-600 K) indicate that the increase in dielectric constant and loss (ε and tan δ) values with increasing sodium ion content could be attributed to the assumption that Fe and Mo ions tend to assume network-forming position in the glass compositions studied. The variation of the value of frequency exponent s for all glass samples as the function of temperature at a definite frequency indicates that the value of s decreases with increasing the temperature which agrees with the correlated barrier-hopping (CBH) model.

  12. Magnetic irreversibility in granular superconductors: ac susceptibility study

    International Nuclear Information System (INIS)

    Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.

    1991-01-01

    Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)

  13. Diffusion cooling of electrons in an A.C. field

    International Nuclear Information System (INIS)

    Robson, R.E.

    1997-01-01

    Boundaries affect the measured values of transport coefficients in all drift tube experiments, to a greater or lesser extent, and nowhere is this more apparent than in the experiment first devised by Cavalleri (1969) and subsequently adapted by Crompton and coworkers in the 1970s. The phenomenon of 'diffusion cooling' is particularly striking and arises essentially from a penetration of the 'boundary layer' (of thickness of the order of the mean free path for energy exchange) throughout a significant portion of the gas chamber. Although this is something of an obstacle to extracting the classical diffusion coefficient from experimental data, it is of great interest in its own right from a theoretical point of view, and the Crompton et al. experiments motivated several theoretical treatments which successfully explained diffusion cooling, albeit for zero applied field and on the basis of the 'two-term' spherical harmonic representation of the velocity distribution function. The present paper puts these theories in the context of the modern, generalised eigenvalue theory, which may be used as a basis for describing all swarm experiments. In addition, the earlier zero-field studies are generalised to the extent that an a.c. heating field is included, as was the case for the original Cavalleri experimental set-up. This field is found to enhance diffusion cooling effects for a simple model elastic collisional cross sections, by pumping electrons into the energy regime preferred for loss to the walls. 32 refs

  14. Low Cost Fabrication of 2G Wires for AC Applications

    Energy Technology Data Exchange (ETDEWEB)

    Kodenkandath, T.; List, F.A., III

    2005-09-15

    Ink-jet printing has been demonstrated as an adaptable technology for printing YBCO filaments using a Metal Organic (MO) YBCO precursor. The technology was demonstrated using AMSC's proprietary metal organic TFA-based YBCO precursor and a commercial piezoelectric print-head on RABiTS templates. Filaments with a width of 100 um and spacing of 200 um were successfully printed, decomposed and processed to YBCO. Critical currents of {approx} 200 A/cm-w were achieved in a series of filaments with a 2 mm width. The single nozzle laboratory printer used in the Phase 1 program is capable of printing {approx} 100 um wide single filaments at a rate of 8-10 cm/sec. The electrical stabilization of filaments with a Ag ink was also evaluated using ink-jet printing. The overall objective of the Phase 1 Project was the evaluation and demonstration of inkjet-printing for depositing YBCO filaments on textured templates (RABiTS, IBAD, ISD, etc. substrates) with properties appropriate for low loss ac conductors. Goals of the Phase 1 program included development of an appropriate precursor ink, demonstration of the printing process, processing and characterization of printed YBCO filaments and evaluation of the process for further development.

  15. Review of the system compatibility and ride-through options for AC and DC drives including multilevel inverters

    Energy Technology Data Exchange (ETDEWEB)

    Jouanne, A. von [Power Electronics Lab. - Elect. and Compt. Engineering Dept. - Oregon State Univ., Corvallis, OR (United States); Ben Banerjee, B. [Electric Power Research Inst. - Power Electronics, Energy Delivery, Palo Alto, CA (United States)

    2000-07-01

    Adjustable speed drive (ASD) compatibility and ride-through issues have caused increased concerns due to the susceptibility of AC and DC drives to power disturbances, and the costly results of process disruptions. These losses can be avoided for critical production processes by using ASDs with ride-through capabilities. This paper assesses industrial ride-through requirements and application issues for AC and DC drives, including medium voltage (2300/4160 V) multi-level inverter topologies. Ride-through alternatives are evaluated based on design, implementation and cost considerations in order to determine the most suitable solutions for various kVA ratings and time duration requirements. (orig.)

  16. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  17. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  18. Frequency Dependent Losses in Transmission Cable Conductors

    DEFF Research Database (Denmark)

    Olsen, Rasmus Schmidt; Holbøll, Joachim; Guðmundsdóttir, Unnur Stella

    2011-01-01

    , such as thermal conditions in and around the cable, as well as the heat generated in conductors, screens, armours etc., taking into account proximity and skin effects. The work performed and presented in this paper is concerned with an improved determination of the losses generated in the conductor, by means...... of better calculation of the AC resistance of transmission cable conductors, in particular regarding higher frequencies. In this way, also losses under harmonics can be covered. Furthermore, the model is suitable for modelling of transient attenuation in high voltage cables. The AC resistance is calculated...... based on the current density distribution in different conductor designs by means of the Finite Element Method (FEM). The obtained results and methods are compared to available standards (IEC publication 60287-1-1)....

  19. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  20. A perpendicular AC biased ferrite tuned cavity for the TRIUMF KAON factory booster synchrotron

    International Nuclear Information System (INIS)

    Poirier, R.L.; Enegren, T.A.; Haddock, C.; Enchevich, I.

    1990-06-01

    The rf cavity for the booster synchrotron requires a frequency swing of 46 MHz at a repetition rate of 50 Hz. This will be accomplished using a tuner containing yttrium garnet ferrite where the bias field is perpendicular to the rf magnetic field. Conventional methods use parallel biased NiZn ferrite. Yttrium garnet ferrite possess a high electric quality factor. However the ac magnetizing circuit is much more complicated and special care must be taken to minimize the induced eddy current losses when designing the tuner. A dc biased prototype cavity was constructed and tested at Los Alamos. As part of the project definition study for the proposed KAON factory, this cavity has now been almost entirely rebuilt at TRIUMF with a completely redesigned tuner for ac bias operation. Measurements and test results will be reported. (Author) 2 refs., 8 figs

  1. Oblique propagating electromagnetic ion - Cyclotron instability with A.C. field in outer magnetosphere

    Science.gov (United States)

    Pandey, R. S.; Singh, Vikrant; Rani, Anju; Varughese, George; Singh, K. M.

    2018-05-01

    In the present paper Oblique propagating electromagnetic ion-cyclotron wave has been analyzed for anisotropic multi ion plasma (H+, He+, O+ ions) in earth magnetosphere for the Dione shell of L=7 i.e., the outer radiation belt of the magnetosphere for Loss-cone distribution function with a spectral index j in the presence of A.C. electric field. Detail for particle trajectories and dispersion relation has been derived by using the method of characteristic solution on the basis of wave particle interaction and transformation of energy. Results for the growth rate have been calculated numerically for various parameters and have been compared for different ions present in magnetosphere. It has been found that for studying the wave over wider spectrum, anisotropy for different values of j should be taken. The effect of frequency of A.C. electric field and angle which propagation vector make with magnetic field, on growth rate has been explained.

  2. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer

    Directory of Open Access Journals (Sweden)

    Phuc Thinh Doan

    2013-06-01

    Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43

  3. AC impedance electrochemical modeling of lithium-ion positive electrodes

    International Nuclear Information System (INIS)

    Dees, D.; Gunen, E.; Abraham, D.; Jansen, A.; Prakash, J.

    2004-01-01

    Under Department of Energy's Advanced Technology Development Program,various analytical diagnostic studies are being carried out to examine the lithium-ion battery technology for hybrid electric vehicle applications, and a series of electrochemical studies are being conducted to examine the performance of these batteries. An electrochemical model was developed to associate changes that were observed in the post-test analytical diagnostic studies with the electrochemical performance loss during testing of lithium ion batteries. While both electrodes in the lithium-ion cell have been studied using a similar electrochemical model, the discussion here is limited to modeling of the positive electrode. The positive electrode under study has a composite structure made of a layered nickel oxide (LiNi 0.8 Co 0.15 Al 0.05 O 2 ) active material, a carbon black and graphite additive for distributing current, and a PVDF binder all on an aluminum current collector. The electrolyte is 1.2M LiPF 6 dissolved in a mixture of EC and EMC and a Celgard micro-porous membrane is used as the separator. Planar test cells (positive/separator/negative) were constructed with a special fixture and two separator membranes that allowed the placement of a micro-reference electrode between the separator membranes (1). Electrochemical studies including AC impedance spectroscopy were then conducted on the individual electrodes to examine the performance and ageing effects in the cell. The model was developed by following the work of Professor Newman at Berkeley (2). The solid electrolyte interface (SEI) region, based on post-test analytical results, was assumed to be a film on the oxide and an oxide layer at the surface of the oxide. A double layer capacity was added in parallel with the Butler-Volmer kinetic expression. The pertinent reaction, thermodynamic, and transport equations were linearized for a small sinusoidal perturbation (3). The resulting system of differential equations was solved

  4. Spin models for the single molecular magnet Mn12-AC

    Science.gov (United States)

    Al-Saqer, Mohamad A.

    2005-11-01

    The single molecular magnet (SMM) Mn12-AC attracted the attention of scientists since the discovery of its magnetic hystereses which are accompanied by sudden jumps in magnetic moments at low temperature. Unlike conventional bulk magnets, hysteresis in SMMs is of molecular origin. This qualifies them as candidates for next generation of high density storage media where a molecule which is at most few nanometers in size can be used to store a bit of information. However, the jumps in these hystereses, due to spin tunneling, can lead to undesired loss of information. Mn12-AC molecule contains twelve magnetic ions antiferromagnetically coupled by exchanges leading to S = 10 ground state manifold. The magnetic ions are surrounded by ligands which isolate them magnetically from neighboring molecules. The lowest state of S = 9 manifold is believed to lie at about 40 K above the ground state. Therefore, at low temperatures, the molecule is considered as a single uncoupled moment of spin S = 10. Such model has been used widely to understand phenomena exhibited by the molecule at low temperatures including the tunneling of its spin, while a little attention has been paid for the multi-spin nature of the molecule. Using the 8-spin model, we demonstrate that in order to understand the phenomena of tunneling, a full spin description of the molecule is required. We utilized a calculation scheme where a fraction of energy levels are used in the calculations and the influence of levels having higher energy is neglected. From the dependence of tunnel splittings on the number of states include, we conclude that models based on restricting the number of energy levels (single-spin and 8-spin models) lead to unreliable results of tunnel splitting calculations. To attack the full 12-spin model, we employed the Davidson algorithm to calculated lowest energy levels produced by exchange interactions and single ion anisotropies. The model reproduces the anisotropy properties at low

  5. Ac and dc motor flooding times

    International Nuclear Information System (INIS)

    Crowley, D.A.; Hinton, J.H.

    1988-01-01

    Reactor safety studies, such as the emergency cooling system (ECS) limits analyses and the probabilistic risk assessment, require that the flood-out times be calculated for the ac and dc motors at the -40 foot level. New calculations are needed because dams of an improved design have been installed between the pump room and motor room, and because updated leak rate calculations have shown that the maximum possible leak rate is larger than that which had been previously calculated. The methodology for calculating the motor flood-out times has also been improved. A computer program has been written to calculate flood-out times for various leak rates and sump pump operabilities. For ECS limits analyses, the worst case dc motor flood-out times are 161 and 297 seconds in LKC and P-areas, respectively. These times are for a 135,468 gpm leak that first flows to the motor room and all of the sump pumps are off

  6. Improving Power Quality in AC Supply Grids

    Directory of Open Access Journals (Sweden)

    Piotr Fabijański

    2015-12-01

    Full Text Available This paper describes a digital and actual model of the UPQC (Unified Power Quality Conditioner integrated system for power quality improvement. The UPQC’s design and its connection to an AC supply grid, 1-phase and 3-phase alike, provide effective compensation of unwanted interferences in the waveforms of load supply voltages and non-linear load currents. This article presents an overview of topologies and control strategies. The study of the UPQC confirmed its positive impact on the power quality. The electricity parameters were significantly improved. Total harmonic distortion in supply voltage THDu decreased six-fold to 1.89%, and total harmonic distortion in load current THDi decreased more than ten-fold to 2.38% for a non-linear load (uncontrolled bridge rectifier with load L. Additionally, symmetrisation of supply voltages and reactive power compensation Q of linear load was obtained. The UPQC integrated system for power quality improvement can be used wherever high-quality and PN-EN 50160 standard – compliant electricity is required.

  7. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  8. Cosmic Shear With ACS Pure Parallels

    Science.gov (United States)

    Rhodes, Jason

    2002-07-01

    Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan textiti {F775W} we will measure for the first time: beginlistosetlength sep0cm setlengthemsep0cm setlengthopsep0cm em the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

  9. Synthesis, characterization and AC conductivity studies of silver doped conducting polyaniline/graphene/SrTiO3 composites

    Science.gov (United States)

    Vinay, K.; Shivakumar, K.; Ravikiran, Y. T.; Revanasiddappa, M.

    2018-05-01

    The present work is an investigation of ac conduction behaviour and dielectric response of Polyaniline/Ag/Graphene/SrTiO3 (PAGS) composite prepared by in-situ chemical oxidative interfacial polymerization using (NH4)2S2O8 as an oxidising agent at 0-5°C. The structural characterization of the samples was examined using FT-IR and XRD techniques. The ac conductivity and dielectric response of synthesized polymer composites were investigated at room temperature in the frequency range varying from 5 × 101 - 5 × 106 Hz using HIOKI make 3532-50 LCR Hi-tester. The ac conductivity increases with increase in frequency and follows the regular trend, the real dielectric constant (ɛ') and imaginary dielectric constant (ɛ'') decreases with increase in frequency and exhibits almost zero dielectric loss at higher frequencies, which suggests that the composite is a lossless material at frequencies beyond 3Hz.

  10. Introduction of hvdc transmission into a predominantly ac network

    Energy Technology Data Exchange (ETDEWEB)

    Casson, W; Last, F H; Huddart, K W

    1966-02-01

    Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.

  11. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  12. Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

    Indian Academy of Sciences (India)

    SHARIF F ZAMAN

    the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.

  13. ELECTRONIC SYSTEM FOR EXPERIMENTATION IN AC ELECTROGRAVIMETRY I: TECHNIQUE FUNDAMENTALS

    Directory of Open Access Journals (Sweden)

    Róbinson Torres

    Full Text Available Basic fundamentals of AC electrogravimetry are introduced. Their main requirements and characteristics are detailed to establish the design of an electronic system that allows the appropriate extraction of data needed to determine the electrogravimetric transfer function (EGTF and electrochemical impedance (EI, in an experimental set-up for the AC electrogravimetry technique.

  14. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  15. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...

  16. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

  17. Effect of temperature on the AC impedance of protein

    Indian Academy of Sciences (India)

    The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...

  18. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...

  19. Levitação acústica

    OpenAIRE

    Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

    2015-01-01

    A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

  20. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  1. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    . This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...

  2. Successful enrichment of the ubiquitous freshwater acI Actinobacteria.

    Science.gov (United States)

    Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk

    2014-02-01

    Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

  3. Temperature dependence of critical current and transport current losses of 4 mm YBCO coated conductors manufactured using nonmagnetic substrate

    Science.gov (United States)

    Kvitkovic, J.; Hatwar, R.; Pamidi, S. V.; Fleshler, S.; Thieme, C.

    2015-12-01

    The temperature dependence of the critical current and AC losses were measured on American Superconductor Corporation's (AMSC) second generation high temperature superconducting (2G HTS) wire produced by Rolling Assisted Biaxially Textured Substrate (RABiTS) and Metal Organic Deposition (MOD) process. Wires manufactured with two types of substrates were characterized. The magnetic substrate with composition Ni5a%W exhibits a magnetic signature and has non-negligible AC losses in AC power applications. A new nonmagnetic substrate with an alloy composition Ni9a%W has been developed by AMSC to address the AC losses in 2G HTS. The data presented show that the performance of the new conductor is identical to the conductor with magnetic substrate in terms of critical current density. The data on AC losses demonstrate the absence of ferromagnetic loss component in the new conductor and significantly reduced AC losses at low to moderate values of I/Ic. The reduced losses will translate into reduced capital costs and lower operating costs of superconducting electrical devices for AC applications.

  4. Tailored vacuum chambers for ac magnets

    International Nuclear Information System (INIS)

    Harvey, A.

    1985-01-01

    The proposed LAMPF-II accelerator has a 60-Hz booster synchrotron and a 3-Hz main ring. To provide a vacuum enclosure inside the magnets with low eddy-current losses and minimal field distortion, yet capable of carrying rf image currents and providing beam stabilization, we propose an innovative combination pipe. Structurally, the enclosure is high-purity alumina ceramic, which is strong, radiation resistant, and has good vacuum properties. Applied to the chamber are thin, spaced, silver conductors using adapted thick-film technology. The conductor design can be tailored to the stabilization requirements, for example, longitudinal conductors for image currents, circumferential for transverse stabilization. The inside of the chamber has a thin, resistive coating to avoid charge build-up. The overall 60-Hz power loss is less than 100 W/m

  5. Evaluation of Required Water Sources during Extended Loss of All AC Power for CANDU NPPs

    Energy Technology Data Exchange (ETDEWEB)

    Jeon, Woo Jae; Lee, Kyung Jin; Kim, Min Ki; Kim, Keon Yeop; Park, Da Hee; Oh, Seo Bin [FNC Technology Co., Yongin (Korea, Republic of); Chang, Young Jin; Byun, Choong Seop [KHNP, Daejeon (Korea, Republic of)

    2016-10-15

    Fukushima accident was caused by lasting long hours of Station Black-Out (SBO) triggered from natural disaster. This accident had resulted in the reactor core damage. The purpose of this study is to evaluate the required water sources to maintain hot standby conditions until 72 hours during ELAP situation. The analysis was performed with CATHENA code. CATHENA code has been developed for the best-estimated transient simulation of CANDU plants. This study was carried out to evaluate the strategy to maintain hot standby conditions during ELAP situation in CANDU reactors. In this analysis, water was supplied to SG by MSSV open and by the gravity feed. It can cool the core without damage until the dousing tank depletion. Before dousing tank depletion, the emergency water supply pump was available by emergency power restoration. The pump continuously fed water to SG. So it is expected that the reactor core can be cooled down without damage for 72 hours if water source is enough to feed. This result is useful to make a strategy against SBO including ELAP situation.

  6. Flex concept for US-A BWR extended loss of AC power events

    International Nuclear Information System (INIS)

    Powers, J.; Aoyagi, Y.; Kataoka, K.; Thomas, S.; Mookhoek, B.

    2015-09-01

    The US-Advanced Boiling Water Reactor (US-A BWR), certified by the US NRC, is a third generation, evolutionary boiling water reactor design which is the reference for the South Texas Project Units 3 and 4 (Stp 3 and 4) Combined License Application (Cola) and incorporates numerous design and technology enhancements for improved safety performance. Nuclear Innovation North America (NINA) is the License Applicant for this new build project, and Toshiba is the selected primary technology contractor. The Stp 3 and 4 project has finished the US NRC technical review of the Cola, and the final safety evaluation report (FSER) is scheduled to be issued by the US NRC in 2015. Following the accident at the Fukushima Dai-ichi plant, the US-A BWR was reviewed for Beyond Design Basis Event (BDBE) safety using industry and regulatory guidance for US NRC Order EA-12-049 Order Modifying Licenses with Regard to Requirements for Mitigation of Beyond Design Basis External Events (BDBEE). By virtue of the design approach, the US-A BWR is capable of providing an indefinite coping period for a station blackout. The use of installed systems with extended coping times is a significant advantage of the US-A BWR compared to most of the plants currently operating in the U.S. In addition, the Stp 3 and 4 design incorporates enhancements consistent with the current US industry Diverse and Flexible Coping Strategies (Flex) initiative. The final technical topic requiring review by the US NRC Advisory Committee on Reactor Safeguards was the Flex Integrated Plan submitted by NINA, and this review was successfully completed. This paper summarizes the progress of the US-A BWR in licensing the Flex Integrated Plan for the project, and describes the technology and features of the US-A BWR design that contribute to safety post-Fukushima. It also provides an informational comparison of the design capabilities of the US-A BWR for extreme external events, and relates these capabilities to re-assessments performed for the Laguna Verde site following the Fukushima event. (Author)

  7. Flex concept for US-A BWR extended loss of AC power events

    Energy Technology Data Exchange (ETDEWEB)

    Powers, J. [Toshiba America Nuclear Energy, Charlotte, North Carolina (United States); Aoyagi, Y.; Kataoka, K. [Toshiba Corporation, Kawasaki, Kanagawa (Japan); Thomas, S.; Mookhoek, B., E-mail: jim.powers@toshiba.com [Nuclear Innovation North America, Lake Jackson, Texas (United States)

    2015-09-15

    The US-Advanced Boiling Water Reactor (US-A BWR), certified by the US NRC, is a third generation, evolutionary boiling water reactor design which is the reference for the South Texas Project Units 3 and 4 (Stp 3 and 4) Combined License Application (Cola) and incorporates numerous design and technology enhancements for improved safety performance. Nuclear Innovation North America (NINA) is the License Applicant for this new build project, and Toshiba is the selected primary technology contractor. The Stp 3 and 4 project has finished the US NRC technical review of the Cola, and the final safety evaluation report (FSER) is scheduled to be issued by the US NRC in 2015. Following the accident at the Fukushima Dai-ichi plant, the US-A BWR was reviewed for Beyond Design Basis Event (BDBE) safety using industry and regulatory guidance for US NRC Order EA-12-049 Order Modifying Licenses with Regard to Requirements for Mitigation of Beyond Design Basis External Events (BDBEE). By virtue of the design approach, the US-A BWR is capable of providing an indefinite coping period for a station blackout. The use of installed systems with extended coping times is a significant advantage of the US-A BWR compared to most of the plants currently operating in the U.S. In addition, the Stp 3 and 4 design incorporates enhancements consistent with the current US industry Diverse and Flexible Coping Strategies (Flex) initiative. The final technical topic requiring review by the US NRC Advisory Committee on Reactor Safeguards was the Flex Integrated Plan submitted by NINA, and this review was successfully completed. This paper summarizes the progress of the US-A BWR in licensing the Flex Integrated Plan for the project, and describes the technology and features of the US-A BWR design that contribute to safety post-Fukushima. It also provides an informational comparison of the design capabilities of the US-A BWR for extreme external events, and relates these capabilities to re-assessments performed for the Laguna Verde site following the Fukushima event. (Author)

  8. Developing Test Apparatus and Measurements of AC Loss of High Temperature Superconductors

    Science.gov (United States)

    2012-11-01

    dewar with a LN2 thermal radiation shield. The removable sample chamber was fabricated from a G-10 fiberglass tube bonded to an aluminum flange to...LN2 thermal radiation shield and the outer aluminized Mylar wrapped evacuated insulation space as shown in Fig. 1. An important feature of this...background flow drift , we can calculate the total excess of energy deposited into the pool of LN2 by the coil. Dividing this energy by the time the

  9. AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

    International Nuclear Information System (INIS)

    McCarthy, Christina B.; Theilmann, David A.

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

  10. Compounding Of Ac Compressor Using Waste Heat Recovery From Exhaust Gas

    Directory of Open Access Journals (Sweden)

    Bheshma Yogendra Kiran

    2015-08-01

    Full Text Available This project works on the theme of turbocharger in which a low pressure high speed turbine is placed in the exhaust gas manifold. The exhaust gas from the engine is made to rotate the turbine where the thermal power of exhaust gas is converted into rotary motion through turbine. This rotary motion from turbine is given to the turbocharger compressor which compresses the refrigerant vapor. So through this air conditioning effect is obtained without loss of any crankshaft. The kinetic energy extracted from the turbine is used to run the AC compressor by planetary gear train.

  11. Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

    Science.gov (United States)

    Luczak, Susan E; Rosen, I Gary

    2014-08-01

    Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

  12. A Multi-Functional Fully Distributed Control Framework for AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Nasirian, Vahidreza; Quintero, Juan Carlos Vasquez

    2018-01-01

    This paper proposes a fully distributed control methodology for secondary control of AC microgrids. The control framework includes three modules: voltage regulator, reactive power regulator, and active power/frequency regulator. The voltage regulator module maintains the average voltage of the mi......This paper proposes a fully distributed control methodology for secondary control of AC microgrids. The control framework includes three modules: voltage regulator, reactive power regulator, and active power/frequency regulator. The voltage regulator module maintains the average voltage...... of the microgrid distribution line at the rated value. The reactive power regulator compares the local normalized reactive power of an inverter with its neighbors’ powers on a communication graph and, accordingly, fine-tunes Q-V droop coefficients to mitigate any reactive power mismatch. Collectively, these two....../reactive power sharing. An AC microgrid is prototyped to experimentally validate the proposed control methodology against the load change, plug-and-play operation, and communication constraints such as delay, packet loss, and limited bandwidth....

  13. An Integrated Multifunctional Bidirectional AC/DC and DC/DC Converter for Electric Vehicles Applications

    Directory of Open Access Journals (Sweden)

    Liwen Pan

    2016-06-01

    Full Text Available This paper presents an on-board vehicular battery charger that integrates bidirectional AC/DC converter and DC/DC converter to achieve high power density for application in electric vehicles (EVs. The integrated charger is able to transfer electrical energy between the battery pack and the electric traction system and to function as an AC/DC battery charger. The integrated charger topology is presented and the design of passive components is discussed. The control schemes are developed for motor drive system and battery-charging system with a power pulsation reduction circuit. Simulation results in MATLAB/Simulink and experiments on a 30-kW motor drive and 3.3-kW AC/DC charging prototype validate the performance of the proposed technology. In addition, power losses, efficiency comparison and thermal stress for the integrated charger are illustrated. The results of the analyses show the validity of the advanced integrated charger for electric vehicles.

  14. UHV A.C. transmission: Technology and prospects

    International Nuclear Information System (INIS)

    Cauzillo, B.A.; Manzoni, G.; Nicolini, P.

    1992-04-01

    At the beginning of the 70's, UHV transmission was regarded as imminent in many countries in view of the expected concentration of generating units (possibly of the nuclear type and grouped together in a few large plants, each of several GW), and research projects were therefore launched in the U.S.A., Canada, Italy, Japan, USSR, etc. Nowadays, the expected introduction of UHV transmission seems remote due to the slowdown in electricity growth and to the tendency towards distributed generation. Nevertheless, there are exceptions: the 1,200 kV 2,400 km-long transmission system in operation in Siberia-Kazahkstan-Urals, and the 1,100 kV 200 km double-circuit line under construction in Japan (which will, however, be operated at 500 kV up to the end of the century). In addition, in Italy, the research programme of a 1000 kV project has now been completed and a 1,050 kV pilot plant is under construction in Tuscany, consisting of a short 1,050kV line and a 420/1,050 kV 1,200 MVA substation. The technology of UHV AC transmission has therefore been proved effective and may represent an available option for the power systems of the next century. From the power system planning point-of-view, UHV's favourable characteristics lie in the possibility of transmitting large amount of power, of the order of 5 GW per circuit, with lower costs, reduced losses, and less land occupation than in the case of EHV lines

  15. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  16. Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte

    International Nuclear Information System (INIS)

    García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.

    2016-01-01

    The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.

  17. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.

    2002-01-01

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  18. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2015-01-01

    Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...

  19. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2014-01-01

    Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...

  20. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  1. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  2. Living with vision loss

    Science.gov (United States)

    Diabetes - vision loss; Retinopathy - vision loss; Low vision; Blindness - vision loss ... of visual aids. Some options include: Magnifiers High power reading glasses Devices that make it easier to ...

  3. Adapting AC Lines to DC Grids for Large-Scale Renewable Power Transmission

    Directory of Open Access Journals (Sweden)

    D. Marene Larruskain

    2014-10-01

    Full Text Available All over the world, governments of different countries are nowadays promoting the use of clean energies in order to achieve sustainable energy systems. In this scenario, since the installed capacity is continuously increasing, renewable sources can play an important role. Notwithstanding that, some important problems may appear when connecting these sources to the grid, being the overload of distribution lines one of the most relevant. In fact, renewable generation is usually connected to the nearest AC grid, although this HV system may not have been designed considering distributed generation. In the particular case of large wind farms, the electrical grid has to transmit all the power generated by wind energy and, as a consequence, the AC system may get overloaded. It is therefore necessary to determine the impact of wind power transmission so that appropriate measures can be taken. Not only are these measures influenced by the amount of power transmitted, but also by the quality of the transmitted power, due to the output voltage fluctuation caused by the highly variable nature of wind. When designing a power grid, although AC systems are usually the most economical solution because of its highly proven technology, HVDC may arise in some cases (e.g. offshore wind farms as an interesting alternative, offering some added values such as lower losses and better controllability. This way, HVDC technology can solve most of the aforementioned problems and has a good potential for future use. Additionally, the fast development of power electronics based on new and powerful semiconductor devices allow the spread of innovative technologies, such as VSC-HVDC, which can be applied to create DC grids. This paper focuses on the main aspects involved in adapting the existing overhead AC lines to DC grids, with the objective of improving the transmission of distributed renewable energy to the centers of consumption.

  4. PREVENTION AND CONTROL OF TUBERCULOSIS *A.C. Okoh ...

    African Journals Online (AJOL)

    drclement

    *A.C. Okoh. Department of Community Health, University of Teaching Hospital Benin City,. Nigeria ... tuberculosis to be a global emergency. There is an ... laboratory capacity as few laboratories are ... control: Survelliance, planning, financing.

  5. Nontrivial ac spin response in the effective Luttinger model

    International Nuclear Information System (INIS)

    Hu Liangbin; Zhong Jiansong; Hu Kaige

    2006-01-01

    Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before

  6. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-01-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received

  7. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  8. AC/CRC adjacent lane surfacing : construction report.

    Science.gov (United States)

    1991-06-01

    Asphaltic Concrete (AC) and Portland Cement Concrete (PCC) are common roadway materials used in Oregon. In a recent construction project -- Poverty Flats/Mecham Section -- the Oregon State Highway Division (OSHD) designed, as part of the project, a "...

  9. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...

  10. Detection of Genetic Modification 'ac2' in Potato Foodstuffs

    Directory of Open Access Journals (Sweden)

    Petr Kralik

    2009-01-01

    Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

  11. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  12. c-axis ac susceptibility in high-Tc superconductors

    International Nuclear Information System (INIS)

    Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.

    1996-01-01

    We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

  13. Fast electric dipole transitions in Ra-Ac nuclei

    International Nuclear Information System (INIS)

    Ahmad, I.

    1985-01-01

    Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs

  14. National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit

    Science.gov (United States)

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...

  15. A THREE-PHASE BOOST DC-AC CONVERTER

    African Journals Online (AJOL)

    dc-ac converter (inverter) based on the dc-dc boost converters. ... Sliding mode controllers are designed to perform a robust control for the ... Computer simulations and spectral analysis demon- ... the conventional three-phase buck inverter,.

  16. AC/ARNG Integrated Division Concept Study, Appendices, Volume 3

    National Research Council Canada - National Science Library

    Twohig, John

    1997-01-01

    ...) division headquarters. The US Army Training and Doctrine Command (TRADOC) was tasked to conduct a viability assessment of the AC/ARNG Integrated Division concept and focus on merits and implementation issues...

  17. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto

    2014-01-01

    Analytical methods of cable performance in EHV AC electrical power are discussed in this comprehensive reference. Descriptions of energization, power quality, cable safety constraints and more, guide readers in cable planning and power network operations.

  18. Controlled formation of metallic nanowires via Au nanoparticle ac trapping

    International Nuclear Information System (INIS)

    Bernard, L; Calame, M; Molen, S J van der; Liao, J; Schoenenberger, C

    2007-01-01

    Applying ac voltages, we trapped gold nanoparticles between micro-fabricated electrodes under well-defined conditions. We demonstrate that the nanoparticles can be controllably fused together to form homogeneous gold nanowires with pre-defined diameters and conductance values. Whereas electromigration is known to form a gap when a dc voltage is applied, this ac technique achieves the opposite, thereby completing the toolkit for the fabrication of nanoscale junctions

  19. Controlled formation of metallic nanowires via Au nanoparticle ac trapping

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, L; Calame, M; Molen, S J van der; Liao, J; Schoenenberger, C [Institute of Physics, University of Basel, CH-4056 Basel (Switzerland)

    2007-06-13

    Applying ac voltages, we trapped gold nanoparticles between micro-fabricated electrodes under well-defined conditions. We demonstrate that the nanoparticles can be controllably fused together to form homogeneous gold nanowires with pre-defined diameters and conductance values. Whereas electromigration is known to form a gap when a dc voltage is applied, this ac technique achieves the opposite, thereby completing the toolkit for the fabrication of nanoscale junctions.

  20. AC-Induced Bias Potential Effect on Corrosion of Steels

    Science.gov (United States)

    2009-02-05

    induction, variable conduction Experimental Setup Super- martensitic stainless steel composition Analysis: C Mn Si Cr Ni Mo Cu N Typical 13 Cr ɘ.01 0.6... stainless steel used in pipelines. •Low carbon (ɘ.01): allows the formation of a “soft” martensite that is more resistant than standard martensitic ...Proposed AC Corrosion Models  AC Simulated Corrosion testing  Stainless steel pipe and coating  Cathodic protection  Experimental Setup  Preliminary

  1. Antifriction coatings based on a-C for biomedicine applications

    International Nuclear Information System (INIS)

    Yurjev, Y N; Kiseleva, D V; Zaitcev, D A; Sidelev, D V; Korneva, O S

    2016-01-01

    This article reports on the investigation of mechanical properties of carbon films deposited by dual magnetron sputtering system with closed and mirror magnetic field. There is shown that a-C films with predominantly sp 2 -phase have relatively high hardness (up to 20 GPa) and low friction index (∼0.01). The influence of magnetic field on friction index is determined. The analysis of experimental data shows the obtained a-C samples can be used for biomedicine applications. (paper)

  2. AC Calorimetric Design for Dynamic of Biological Materials

    OpenAIRE

    Shigeo Imaizumi

    2006-01-01

    We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...

  3. Optimal football strategies: AC Milan versus FC Barcelona

    OpenAIRE

    Papahristodoulou, Christos

    2012-01-01

    In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

  4. Hair Loss (Alopecia)

    Science.gov (United States)

    ... care Kids’ zone Video library Find a dermatologist Hair loss Overview Hereditary hair loss: Millions of men ... of hair loss can often be successfully treated. Hair loss: Overview Also called alopecia (al-o-PEE- ...

  5. AC quantum voltmeter for the industry; AC-Quantenvoltmeter fuer die Industrie

    Energy Technology Data Exchange (ETDEWEB)

    Behr, Ralf [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe 2.63 ' ' Josephson-Effekt, Spannung' ' ; Smandek, Bernhard [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe Q.33 ' ' Technologietransfer' '

    2016-09-15

    In a first part difficulties and challenges of the novel operation principle, the ''differential scanning system'' are discussed and explained, how with highest metrological precision the proof of principle succeeded. By common research with other national metrology institutes the concept was consolidated and improved. In a second part it was exemplarically illuminated, how by an efficient dovetailing of European and national promotion programs with different application neighbourhood consolidated knowledge of basic metrological research could be transferred to economy and especially small and medium companies. With an AC quantum voltmeter up to 10 V and 1 kHz already a unique commercial device is available. How the development foreseeable goes on illuminates the final part of the article.

  6. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    independent producers/consumers to connect to multiple distribution grids in order to optimise the electricity price, as this will vary during the day from one power distribution company to another one. It will be needed to have a load that can smoothly adjust the power consumed from each power grid in order......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...

  7. Risk Assessment Method of UHV AC/DC Power System under Serious Disasters

    Directory of Open Access Journals (Sweden)

    Rishang Long

    2016-12-01

    Full Text Available Based on the theory of risk assessment, the risk assessment method for an ultra-high voltage (UHV AC/DC hybrid power system under severe disaster is studied. Firstly, considering the whole process of cascading failure, a fast failure probability calculation method is proposed, and the whole process risk assessment model is established considering the loss of both fault stage and recovery stage based on Monte Carlo method and BPA software. Secondly, the comprehensive evaluation index system is proposed from the aspects of power system structure, fault state and economic loss, and the quantitative assessment of system risk is carried out by an entropy weight model. Finally, the risk assessment of two UHV planning schemes are carried out and compared, which proves the effectiveness of the research work.

  8. Ion peak narrowing by applying additional AC voltage (ripple voltage) to FAIMS extractor electrode.

    Science.gov (United States)

    Pervukhin, Viktor V; Sheven, Dmitriy G

    2010-01-01

    The use of a non-uniform electric field in a high-field asymmetric waveform ion mobility spectrometry (FAIMS) analyzer increases sensitivity but decreases resolution. The application of an additional AC voltage to the extractor electrode ("ripple" voltage, U(ripple)) can overcome this effect, which decreases the FAIMS peak width. In this approach, the diffusion ion loss remains minimal in the non-uniform electric field in the cylindrical part of the device, and all ion losses under U(ripple) occur in a short portion of their path. Application of the ripple voltage to the extractor electrode is twice as efficient as the applying of U(ripple) along the total length of the device. 2010 American Society for Mass Spectrometry. Published by Elsevier Inc. All rights reserved.

  9. A multi-channel AC power supply controller

    International Nuclear Information System (INIS)

    Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

    2003-01-01

    A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

  10. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  11. Mechanism of internal browning of pineapple: The role of gibberellins catabolism gene (AcGA2ox) and GAs

    Science.gov (United States)

    Zhang, Qin; Rao, Xiuwen; Zhang, Lubin; He, Congcong; Yang, Fang; Zhu, Shijiang

    2016-01-01

    Internal browning (IB), a physiological disorder (PD) that causes severe losses in harvested pineapple, can be induced by exogenous gibberellins (GAs). Over the years, studies have focused on roles of Gibberellin 2-oxidase (GA2oxs), the major GAs catabolic enzyme in plants, in the regulation of changes in morphology or biomass. However, whether GA2oxs could regulate PD has not been reported. Here, a full-length AcGA2ox cDNA was isolated from pineapple, with the putative protein sharing 23.59% to 72.92% identity with GA2oxs from five other plants. Pineapples stored at 5 °C stayed intact, while those stored at 20 °C showed severe IB. Storage at 5 °C enhanced AcGA2ox expression and decreased levels of a GAs (GA4) ‘compared with storage at 20 °C. However, at 20 °C, exogenous application of abscisic acid (ABA) significantly suppressed IB. ABA simultaneously upregulated AcGA2ox and reduced GA4. Ectopic expression of AcGA2ox in Arabidopsis resulted in reduced GA4, lower seed germination, and shorter hypocotyls and roots, all of which were restored by exogenous GA4/7. Moreover, in pineapple, GA4/7 upregulated polyphenol oxidase, while storage at 5 °C and ABA downregulated it. These results strongly suggest the involvement of AcGA2ox in regulation of GAs levels and a role of AcGA2ox in regulating IB. PMID:27982026

  12. Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

    Science.gov (United States)

    Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

    One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

  13. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  14. AC power flow importance measures considering multi-element failures

    International Nuclear Information System (INIS)

    Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

    2017-01-01

    Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

  15. Alternating magnetic field losses in ATLAS type aluminium stabilized NbTi superconductors

    CERN Document Server

    Boxman, E W; ten Kate, H H J

    2002-01-01

    During ramping up- and down of the current in large-scale magnets the ramp losses are an important factor affecting the thermal and electro-magnetic stability of the system. The calculation of the losses is not straightforward due to the large dimensions of the conductor (~600 mm/sup 2/) implying that diffusion effects have to be taken into account. The AC-losses of the Al stabilized NbTi cable conductors used in the ATLAS magnet system were measured in 0.5 m long samples, using an inductive method with pick-up coils as well as the calorimetric method. External varying magnetic fields up to 2 tesla amplitude were applied parallel and perpendicular to the conductor wide surface. The results are compared to theory. It is found that hysteresis loss, eddy current loss in the Aluminum cladding and cable-to-cladding coupling loss contribute most to the AC loss. (5 refs).

  16. Aragonite coating solutions (ACS) based on artificial seawater

    Science.gov (United States)

    Tas, A. Cuneyt

    2015-03-01

    Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  17. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  18. Induced AC voltages on pipelines may present a serious hazard

    International Nuclear Information System (INIS)

    Kirkpatrick, E.L.

    1997-01-01

    The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP

  19. ACS and STEMI treatment: gender-related issues.

    Science.gov (United States)

    Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude

    2012-08-01

    Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.

  20. An adenylyl cyclase like-9 gene (NlAC9) influences growth and fecundity in the brown planthopper, Nilaparvata lugens (Stål) (Hemiptera: Delphacidae).

    Science.gov (United States)

    Ge, LinQuan; Gu, HaoTian; Huang, Bo; Song, Qisheng; Stanley, David; Liu, Fang; Yang, Guo-Qing; Wu, Jin-Cai

    2017-01-01

    The cAMP/PKA intracellular signaling pathway is launched by adenylyl cyclase (AC) conversion of adenosine triphosphate (ATP) to 3', 5'-cyclic AMP (cAMP) and cAMP-dependent activation of PKA. Although this pathway is very well known in insect physiology, there is little to no information on it in some very small pest insects, such as the brown planthopper (BPH), Nilaparvata lugens Stål. BPH is a destructive pest responsible for tremendous crop losses in rice cropping systems. We are investigating the potentials of novel pest management technologies from RNA interference perspective. Based on analysis of transcriptomic data, the BPH AC like-9 gene (NlAC9) was up-regulated in post-mating females, which led us to pose the hypothesis that NlAC9 is a target gene that would lead to reduced BPH fitness and populations. Targeting NlAC9 led to substantially decreased soluble ovarian protein content, yeast-like symbiont abundance, and vitellogenin gene expression, accompanied with stunted ovarian development and body size. Eggs laid were decreased and oviposition period shortened. Taken together, our findings indicated that NlAC9 exerted pronounced effects on female fecundity, growth and longevity, which strongly supports our hypothesis.

  1. An adenylyl cyclase like-9 gene (NlAC9 influences growth and fecundity in the brown planthopper, Nilaparvata lugens (Stål (Hemiptera: Delphacidae.

    Directory of Open Access Journals (Sweden)

    LinQuan Ge

    Full Text Available The cAMP/PKA intracellular signaling pathway is launched by adenylyl cyclase (AC conversion of adenosine triphosphate (ATP to 3', 5'-cyclic AMP (cAMP and cAMP-dependent activation of PKA. Although this pathway is very well known in insect physiology, there is little to no information on it in some very small pest insects, such as the brown planthopper (BPH, Nilaparvata lugens Stål. BPH is a destructive pest responsible for tremendous crop losses in rice cropping systems. We are investigating the potentials of novel pest management technologies from RNA interference perspective. Based on analysis of transcriptomic data, the BPH AC like-9 gene (NlAC9 was up-regulated in post-mating females, which led us to pose the hypothesis that NlAC9 is a target gene that would lead to reduced BPH fitness and populations. Targeting NlAC9 led to substantially decreased soluble ovarian protein content, yeast-like symbiont abundance, and vitellogenin gene expression, accompanied with stunted ovarian development and body size. Eggs laid were decreased and oviposition period shortened. Taken together, our findings indicated that NlAC9 exerted pronounced effects on female fecundity, growth and longevity, which strongly supports our hypothesis.

  2. Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

    Energy Technology Data Exchange (ETDEWEB)

    Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

    2008-07-01

    Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

  3. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  4. AC Conductivity Studies of Lithium Based Phospho Vanadate Glasses

    International Nuclear Information System (INIS)

    Nagendra, K.; Babu, G. Satish; Gowda, Veeranna; Reddy, C. Narayana

    2011-01-01

    Glasses in the system xLi 2 SO 4 -20Li 2 O-(80-x) [80P 2 O 5 -20V 2 O 5 ](5≥x≥20 mol%) has been prepared by melt quenching method. Dc and ac conductivity has been studied over a wide range of frequency (10 Hz to 10 MHz) and temperature (298 K-523 K). The dc conductivity found to increase with increase of Li 2 SO 4 concentration. The ac conductivities have been fitted to the Almond-West type single power law equation σ(ω) = σ(0)+Aω s where 's' is the power law exponent. The ac conductivity found to increase with increase of Li 2 SO 4 concentration. An attempt is made to elucidate the enhancement of lithium ion conduction in phosphor-vanadate glasses by considering the expansion of network structure.

  5. Objectives and status of development of AC600

    International Nuclear Information System (INIS)

    Zhao Chengkun

    1997-01-01

    AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600

  6. Reliability of emergency ac power systems at nuclear power plants

    International Nuclear Information System (INIS)

    Battle, R.E.; Campbell, D.J.

    1983-07-01

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project

  7. 21 CFR 880.6320 - AC-powered medical examination light.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

  8. Hybrid AC-High Voltage DC Grid Stability and Controls

    Science.gov (United States)

    Yu, Jicheng

    The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

  9. Understanding Grief and Loss

    Science.gov (United States)

    ... the process of adapting to life after a loss. It is influenced by each person’s society, culture, and religion. Bereavement is the state of having experienced a loss. Common grief reactions Reactions to loss are called ...

  10. Application of ac impedance in fuel cell research and development

    Energy Technology Data Exchange (ETDEWEB)

    Selman, J R; Lin, Y P [Illinois Inst. of Tech., Chicago, IL (United States). Dept. of Chemical Engineering

    1993-10-01

    In applying ac impedance to fuel cells and their porous (gas diffusion) electrodes the emphasis lies on different fuel cell components, and their properties, according to the fuel cell type. The focus has been directed at the electrode/electrolyte interface in MCFC and PAFC, whereas in SOFC and PEMFC the ionic/electronic conductivity of the electrolyte or the characteristics of its composite with the electrocatalyst is of primary interest. The limitations of ac impedance in fuel cell application are in part due to difficulties of interpretation and in part due to experimental difficulties because of the generally fast electrode reaction kinetics. Further research directions are indicated. (author)

  11. Droop-free Distributed Control for AC Microgrids

    DEFF Research Database (Denmark)

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.

    2016-01-01

    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...

  12. Productos «Celotex» para acondicionamientos Acústicos

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-02-01

    Full Text Available Not availableBajo la denominación general «Celotex», que es un nombre registrado, la Casa Americana The Celotex Corporation, cuyo domicilio social es 120 South, La Salle Street, Chicago J. lllinois, fabrica diversos materiales para fines de acondicionamiento acústico elaborados, según los tipos de que se trate, con fibra de caña de azúcar, lanas minerales, acero, amianto, etc., perforados o no y de acuerdo con el efecto estético y acústico que se desee obtener.

  13. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...

  14. Programmable Power Supply for AC Switching Magnet of Proton Accelerator

    CERN Document Server

    Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung

    2005-01-01

    The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.

  15. Economic Loan Loss Provision and Expected Loss

    Directory of Open Access Journals (Sweden)

    Stefan Hlawatsch

    2010-10-01

    Full Text Available The intention of a loan loss provision is the anticipation of the loan's expected losses by adjusting the book value of the loan. Furthermore, this loan loss provision has to be compared to the expected loss according to Basel II and, in the case of a difference, liable equity has to be adjusted. This however assumes that the loan loss provision and the expected loss are based on a similar economic rationale, which is only valid conditionally in current loan loss provisioning methods according to IFRS. Therefore, differences between loan loss provisions and expected losses should only result from different approaches regarding the parameter estimation within each model and not due to different assumptions regarding the outcome of the model. The provisioning and accounting model developed in this paper overcomes the before-mentioned shortcomings and is consistent with an economic rationale of expected losses. Additionally, this model is based on a close-to-market valuation of the loan that is in favor of the basic idea of IFRS. Suggestions for changes in current accounting and capital requirement rules are provided.

  16. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  17. Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.

    Science.gov (United States)

    Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide

    2015-10-01

    Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  18. Ac conductivity and relaxation mechanism in Ba0.9Sr0.1TiO3

    International Nuclear Information System (INIS)

    Singh, A.K.; Barik, Subrat K.; Choudhary, R.N.P.; Mahapatra, P.K.

    2009-01-01

    The ac conductivity and relaxation mechanism in Ba 0.9 Sr 0.1 TiO 3 ceramics have been investigated systematically. A high-temperature solid-state reaction technique was used to synthesize the compound. The formation of the compound was checked by an X-ray diffraction (XRD) technique. The dielectric permittivity and the loss tangent of the sample were measured in a frequency range from 1 kHz to 1 MHz at different temperatures (30-500 deg. C). A study on dielectric properties reveals the electrical relaxation phenomenon occurs in the material. The activation energy was calculated from the temperature variation of dc conductivity. Studies of frequency and temperature dependence of ac conductivity of the compound suggest that conduction process in the material is thermally activated.

  19. AC bias operation of the perpendicular biased ferrite tuned cavity for the TRIUMF KAON Factory booster synchrotron

    International Nuclear Information System (INIS)

    Poirier, R.L.; Enegren, T.A.; Enchevich, I.B.

    1991-05-01

    The RF cavity for the booster synchrotron requires a frequency swing from 46 MHz at a repetition rate of 50 Hz and a maximum accelerating gap voltage of 65 kV. A DC biased prototype cavity built at LANL using perpendicular-biased yttrium-garnet ferrites, rather than the more conventional parallel-biased NiZn ferrites, has now undergone major reconstruction at TRIUMF for AC bias operation. RF signal level measurements have shown that the frequency swing at a repetition rate of 50 Hz can be accomplished and still handle the eddy current losses in the cavity structures with minimal effect on the magnetizing field. The prototype cavity is now undergoing high power RF tests with full power AC bias operation. The results of these tests and operational experience is reported. (Author) ref., 6 figs

  20. Investigation on discharge characteristics of a coaxial dielectric barrier discharge reactor driven by AC and ns power sources

    Science.gov (United States)

    Qian, WANG; Feng, LIU; Chuanrun, MIAO; Bing, YAN; Zhi, FANG

    2018-03-01

    A coaxial dielectric barrier discharge (DBD) reactor with double layer dielectric barriers has been developed for exhaust gas treatment and excited either by AC power or nanosecond (ns) pulse to generate atmospheric pressure plasma. The comparative study on the discharge characteristics of the discharge uniformity, power deposition, energy efficiency, and operation temperature between AC and ns pulsed coaxial DBD is carried out in terms of optical and electrical characteristics and operation temperature for optimizing the coaxial DBD reactor performance. The voltages across the air gap and dielectric layer and the conduction and displacement currents are extracted from the applied voltages and measured currents of AC and ns pulsed coaxial DBDs for the calculation of the power depositions and energy efficiencies through an equivalent electrical model. The discharge uniformity and operating temperature of the coaxial DBD reactor are monitored and analyzed by optical images and infrared camera. A heat conduction model is used to calculate the temperature of the internal quartz tube. It is found that the ns pulsed coaxial DBD has a much higher instantaneous power deposition in plasma, a lower total power consumption, and a higher energy efficiency compared with that excited by AC power and is more homogeneous and stable. The temperature of the outside wall of the AC and ns pulse excited coaxial DBD reaches 158 °C and 64.3 °C after 900 s operation, respectively. The experimental results on the comparison of the discharge characteristics of coaxial DBDs excited by different powers are significant for understanding of the mechanism of DBDs, reducing energy loss, and optimizing the performance of coaxial DBD in industrial applications.

  1. Wasted Heat Engine Utilization in Central AC Condenser Type Water Chiller for Economical Energy Water Heaters

    Directory of Open Access Journals (Sweden)

    I Made Rasta

    2012-11-01

    Full Text Available Central AC type water chiller is a refrigeration machine that release heat to environment. Heat energy that released to environment comes from room heat load that absorbed by machine and heat from compressor. The best form in using this loss energy is heat recovery water heater technology, where this machine will take heat from condenser by a heat exchanger to heating water. Refrigerant will flow in the heat exchanger before entering condenser, after that refrigerant flow to other components such as, expansion valve, evaporator, compressor and than return again to condenser, this process will be cycling regularly (closed cycle. Based on experimental and analysis result especially for AC with capacity 2 Pk, and tank capacity 75 liter, with water heater recovery device obtained that: (1 Compressor power consumption decrease from 1.66 kW to 1.59kW. (2 Heat rejected from condenser and used by water heater has ratio 4.683 kJ/s and 1.59 kJ/s, with water heater efficiency is 32.2%. (3 Maximum water temperature can be reached are in range 34oC – 47.5oC in 10-150 minutes and flow rate is 0.5 – 2.5 liter /min

  2. Experimental Investigation of the Corona Discharge in Electrical Transmission due to AC/DC Electric Fields

    Directory of Open Access Journals (Sweden)

    Fuangpian Phanupong

    2016-01-01

    Full Text Available Nowadays, using of High Voltage Direct Current (HVDC transmission to maximize the transmission efficiency, bulk power transmission, connection of renewable power source from wind farm to the grid is of prime concern for the utility. However, due to the high electric field stress from Direct Current (DC line, the corona discharge can easily be occurred at the conductor surface leading to transmission loss. Therefore, the polarity effect of DC lines on corona inception and breakdown voltage should be investigated. In this work, the effect of DC polarity and Alternating Current (AC field stress on corona inception voltage and corona discharge is investigated on various test objects, such as High Voltage (HV needle, needle at ground plane, internal defect, surface discharge, underground cable without cable termination, cable termination with simulated defect and bare overhead conductor. The corona discharge is measured by partial discharge measurement device with high-frequency current transformer. Finally, the relationship between supply voltage and discharge intensity on each DC polarity and AC field stress can be successfully determined.

  3. Mitigating voltage lead errors of an AC Josephson voltage standard by impedance matching

    Science.gov (United States)

    Zhao, Dongsheng; van den Brom, Helko E.; Houtzager, Ernest

    2017-09-01

    A pulse-driven AC Josephson voltage standard (ACJVS) generates calculable AC voltage signals at low temperatures, whereas measurements are performed with a device under test (DUT) at room temperature. The voltage leads cause the output voltage to show deviations that scale with the frequency squared. Error correction mechanisms investigated so far allow the ACJVS to be operational for frequencies up to 100 kHz. In this paper, calculations are presented to deal with these errors in terms of reflected waves. Impedance matching at the source side of the system, which is loaded with a high-impedance DUT, is proposed as an accurate method to mitigate these errors for frequencies up to 1 MHz. Simulations show that the influence of non-ideal component characteristics, such as the tolerance of the matching resistor, the capacitance of the load input impedance, losses in the voltage leads, non-homogeneity in the voltage leads, a non-ideal on-chip connection and inductors between the Josephson junction array and the voltage leads, can be corrected for using the proposed procedures. The results show that an expanded uncertainty of 12 parts in 106 (k  =  2) at 1 MHz and 0.5 part in 106 (k  =  2) at 100 kHz is within reach.

  4. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... communications industry. Applicant states that, on a pro forma basis post-Transaction, its assets will consist of... providing wholesale wireless communications services to its members. The Transaction agreements contemplate... portion of the ACS Wireless' revenue. Applicant states that post-Transaction, on a pro forma basis, for...

  5. AC conductivity of a quantum Hall line junction

    International Nuclear Information System (INIS)

    Agarwal, Amit; Sen, Diptiman

    2009-01-01

    We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.

  6. Reliability assurance program for operational emergency ac power system

    International Nuclear Information System (INIS)

    Heineman, J.B.; Ragland, W.A.; Mueller, C.J.

    1985-01-01

    A comprehensive review of emergency ac power systems in nuclear generating plants (the vast majority of these plants contain redundant diesel generator systems) delineates several operational areas that can be improved by instituting a reliability assurance program (RAP), which initially upgrades the diesel generator performance and provides for ongoing monitoring and maintenance based upon alert levels

  7. AC-600 reactor reloading pattern optimization by using genetic algorithms

    International Nuclear Information System (INIS)

    Wu Hongchun; Xie Zhongsheng; Yao Dong; Li Dongsheng; Zhang Zongyao

    2000-01-01

    The use of genetic algorithms to optimize reloading pattern of the nuclear power plant reactor is proposed. And a new encoding and translating method is given. Optimization results of minimizing core power peak and maximizing cycle length for both low-leakage and out-in loading pattern of AC-600 reactor are obtained

  8. Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

    Indian Academy of Sciences (India)

    A series of ammonia treated Mo/Activated Carbon (AC) catalysts were synthesized by wet impregnation method by nominal incorporation of 5, 10 and 15 wt% of molybdenum. The calcined catalysts (500◦C, 4 h, N₂ flow) were subjected to a stepwise ammonia treatment at temperatures from 25 up to 700◦C. This work ...

  9. AC-Conductivity measurements on γ-aluminium oxynitride

    NARCIS (Netherlands)

    Willems, H.X.; Hal, van P.F.; Metselaar, R.; With, de G.

    1995-01-01

    AC-conductivity measurements were performed on aluminium oxynitrides (Alons) because of their interesting defect structure. Although it became apparent that these Alons are not stable in the temperature range used, the electrical properties of the materials could be measured with impedance

  10. Introducing AC Inductive Reactance with a Power Tool

    Science.gov (United States)

    Bryant, Wesley; Baker, Blane

    2016-01-01

    The concept of reactance in AC electrical circuits is often non-intuitive and difficult for students to grasp. In order to address this lack of conceptual understanding, classroom exercises compare the predicted resistance of a power tool, based on electrical specifications, to measured resistance. Once students discover that measured resistance…

  11. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    deviate from 2 thus signalling on the time-reversal breaking by the ac field. ... is also the parity effect: the enchancement is only present if either P or Q is even. ... analysis (see figure 1) is possible and the ergodic zero-dimensional approx-.

  12. Novel dielectric reduces corona breakdown in ac capacitors

    Science.gov (United States)

    Loehner, J. L.

    1972-01-01

    Dielectric system was developed which consists of two layers of 25-gage paper separated by one layer of 50-gage polypropylene to reduce corona breakdown in ac capacitors. System can be used in any alternating current application where constant voltage does not exceed 400 V rms. With a little research it could probably be increased to 700 to 800 V rms.

  13. a.c. conductance study of polycrystal C60

    International Nuclear Information System (INIS)

    Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin

    1995-01-01

    The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))

  14. Model for the dynamic study of AC contactors

    Energy Technology Data Exchange (ETDEWEB)

    Corcoles, F.; Pedra, J.; Garrido, J.P.; Baza, R. [Dep. d' Eng. Electrica ETSEIB. UPC, Barcelona (Spain)

    2000-08-01

    This paper proposes a model for the dynamic analysis of AC contactors. The calculation algorithm and implementation are discussed. The proposed model can be used to study the influence of the design parameters and the supply in their dynamic behaviour. The high calculation speed of the implemented algorithm allows extensive ranges of parameter variations to be analysed. (orig.)

  15. Team-oriented Adaptive Droop Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Nasirian, Vahidreza; Guerrero, Josep M.

    2014-01-01

    This paper proposes a distributed control strategy for voltage and reactive power regulation in ac Microgrids. First, the control module introduces a voltage regulator that maintains the average voltage of the system on the rated value, keeping all bus voltages within an acceptable range. Dynamic...

  16. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    DEFF Research Database (Denmark)

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig

    2016-01-01

    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling...

  17. Evaluation of ac conductivity behaviour of graphite filled

    Indian Academy of Sciences (India)

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled ...

  18. Aragonite coating solutions (ACS) based on artificial seawater

    International Nuclear Information System (INIS)

    Tas, A. Cuneyt

    2015-01-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry

  19. Aragonite coating solutions (ACS) based on artificial seawater

    Energy Technology Data Exchange (ETDEWEB)

    Tas, A. Cuneyt, E-mail: c_tas@hotmail.com

    2015-03-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  20. Single stage buck-boost DC-AC neutral point clamped inverter

    DEFF Research Database (Denmark)

    Mo, Wei; Loh, Poh Chiang; Andrew, A.

    2012-01-01

    This paper proposes a new single stage buck-boost DC-AC neutral point clamped inverter topology which integrates the cascaded configurations of recently introduced inductor-capacitor-capacitor-transformer impedance source network (by Adamowicz) and classic NPC configuration. As a consequence......, it has enhanced buck-boost functionality and low output voltage distortions compared to the traditional Z-source inverter; it has continuous input current which reduces the source stress and inverter noise; it also contains two built-in capacitors which can block the DC current in the transformer...... windings thus preventing the core from saturation; lowers the voltage stresses and power losses of inverter switches and reduces the sizes of filtering devices and as well as obtains better output performance compared to the original two-level Z-source inverters. A phase disposition pulse width modulation...

  1. Beamforming transmission in IEEE 802.11ac under time-varying channels.

    Science.gov (United States)

    Yu, Heejung; Kim, Taejoon

    2014-01-01

    The IEEE 802.11ac wireless local area network (WLAN) standard has adopted beamforming (BF) schemes to improve spectral efficiency and throughput with multiple antennas. To design the transmit beam, a channel sounding process to feedback channel state information (CSI) is required. Due to sounding overhead, throughput increases with the amount of transmit data under static channels. Under practical channel conditions with mobility, however, the mismatch between the transmit beam and the channel at transmission time causes performance loss when transmission duration after channel sounding is too long. When the fading rate, payload size, and operating signal-to-noise ratio are given, the optimal transmission duration (i.e., packet length) can be determined to maximize throughput. The relationship between packet length and throughput is also investigated for single-user and multiuser BF modes.

  2. Operation Cost Minimization of Droop-Controlled AC Microgrids Using Multiagent-Based Distributed Control

    DEFF Research Database (Denmark)

    Li, Chendan; Savaghebi, Mehdi; Guerrero, Josep M.

    2016-01-01

    on the power rating of the power converters. With various primary source for the distributed generator (DG), factors that are closely related to the operation cost, such as fuel cost of the generators and losses should be taken into account in order to improve the efficiency of the whole system. In this paper......, a multiagent-based distributed method is proposed to minimize the operation cost in AC microgrids. In the microgrid, each DG is acting as an agent which regulates the power individually using a novel power regulation method based on frequency scheduling. An optimal power command is obtained through carefully...... designed consensus algorithm by using sparse communication links only among neighbouring agents. Experimental results for different cases verified that the proposed control strategy can effectively reduce the operation cost....

  3. Design and simulation experimental study of bracket plates in steam generator for AC600 PWR

    International Nuclear Information System (INIS)

    Zhang Fuyuan; Zhang Wenqi; Ji Quankai; Zeng Xi; Xie Yongyao

    1998-01-01

    Seven-holes type bracket plate at the inlet nozzle and three-holes taper bracket plate at outlet nozzle are designed. According to 'local form and structure change' simulation theory, hydraulic models and simulators for the simulative experiments are designed. Taking water as the medium, the simulative experiments have been completed at the room temperature. The ζ-Re curves (here, ζ is the local pressure loss coefficient at the nozzles after the bracket plates are installed and Re is Reynolds number) have been got. Based on the experimental results, the computation and the analysis have been shown that. If the bracket plates are used in the steam generator (SG) of AC600 PWR, the pressure drop of primary side in the SG is about 14 percent higher than that of the 55/19 B style SG

  4. Performance Analysis of Three-Phase Induction Motor with AC Direct and VFD

    Science.gov (United States)

    Kumar, Dinesh

    2018-03-01

    The electrical machine analysis and performance calculation is a very important aspect of efficient drive system design. The development of power electronics devices and power converters provide smooth speed control of Induction Motors by changing the frequency of input supply. These converters, on one hand are providing a more flexible speed control that also leads to problems of harmonics and their associated ailments like pulsating torque, distorted current and voltage waveforms, increasing losses etc. This paper includes the performance analysis of three phase induction motor with three-phase AC direct and variable frequency drives (VFD). The comparison has been concluded with respect to various parameters. MATLAB-SIMULINKTM is used for the analysis.

  5. Photovoltaic AC fusion converter (PVAC). Design consideration and experimental evaluation; Taiyoko hatsuden denryoku/shoyo denryoku kongo sochi no hoshiki to seino

    Energy Technology Data Exchange (ETDEWEB)

    Tsuchiya, Y. [Hachinohe National College of Technology, Aomori (Japan); Sakakibara, T. [Toyohashi University, of Technology, Aichi (Japan)

    1997-11-25

    The photovoltaic AC fusion converter (PVAC), of which cost reduction of the total system is possible, was developed. PVAC controls the supply of commercial power by preferentially supplying photovoltaic power to loads for realization of energy conservation. Further, setting the maximum output of solar cell less than the rated load, the system was made the one with no need of storage batteries. This system was realized in a hybrid of the conventional rectification technology and the stand-alone maximum power point tracking photovoltaic system technology. The solar cell input efficiency had been measured as 84% at maximum. Main losses are consumption power of power source, switching loss of inverter, and continuity loss of diode. Ninety-seven percent of the commercial power input efficiency was obtained. Main losses are consumption power of power source, continuity loss of diode bridge, and resistance loss of smoothing reactor. The effect of energy conservation by the use of PVAC was also admitted. 6 refs., 7 figs.

  6. Hair loss in women.

    Science.gov (United States)

    Harfmann, Katya L; Bechtel, Mark A

    2015-03-01

    Hair loss is a common cause of morbidity for many women. As a key member of the woman's health care team, the obstetrician/gynecologist may be the first person to evaluate the complaint of hair loss. Common types of nonscarring hair loss, including female pattern hair loss and telogen effluvium, may be diagnosed and managed by the obstetrician/gynecologist. A systematic approach to diagnosis and management of these common forms of hair loss is presented.

  7. Composite Cu/Fe/MgB{sub 2} superconducting wires and MgB{sub 2}/YSZ/Hastelloy coated conductors for ac and dc applications

    Energy Technology Data Exchange (ETDEWEB)

    Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Majoros, M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, Madingley Road, Cambridge (United Kingdom); Vickers, M [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Eisterer, M [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Toenies, S [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Weber, H W [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Fukutomi, M [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Komori, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Togano, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan)

    2003-02-01

    We discuss the results of a study of MgB{sub 2} multifilamentary conductors and coated conductors from the point of view of their future dc and ac applications. The correlation between the slope of the irreversibility line induced by neutron irradiation defects and in situ structural imperfections and the critical temperature and critical current density is discussed with respect to the conductor performance and applicability. We debate the possible origin of the observed anomalous decrease of ac susceptibility at 50 K in copper clad in situ powder-in-tube MgB{sub 2} wires. Different conductor preparation methods and conductor architectures, and attainable critical current densities are presented. Some numerical results on critical currents, thermal stability and ac losses of future MgB{sub 2} multifilamentary and coated conductors with magnetic cladding of their filaments are also discussed.

  8. The Effect of Adding Antimony Trioxide (Sb2O3 ‎On A.C Electrical Properties of (PVA-PEG Films

    Directory of Open Access Journals (Sweden)

    Akeel Shakir Alkelaby

    2017-12-01

    Full Text Available In this work, many samples have been prepared by adding Antimony Trioxide (Sb2O3 to the polyvinyl alcohol-poly ethylene glycol (PVA-PEG. The effect of the Sb2O3 added as a filler with different weight percentages on the A.C electrical properties have been investigated. The samples were prepared as films by solution cast technique. The experimental results of the A.C electrical properties show that the dielectric constant increase with the increasing frequency of applied electrical field and concentration of the Antimony Trioxide. Dielectric loss decrease with the increasing the frequency, while it increases with the increase of the concentration of the Antimony Trioxide. The A.C electrical conductivity increase with increasing the Antimony Trioxide contain and frequency for the composition.

  9. Rotating electrical machines part 2 : methods for determining losses and efficiency of rotating electrical machinery form tests (excl. machines for traction vehicles)

    CERN Document Server

    International Electrotechnical Commission. Geneva

    1972-01-01

    Applies to d.c. machines and to a.c. synchronous and induction machines. The principles can be applied to other types of machines such as rotary converters, a.c. commutator motors and single-phase induction motors for which other methods of determining losses are used.

  10. Abscisic Acid Antagonizes Ethylene Production through the ABI4-Mediated Transcriptional Repression of ACS4 and ACS8 in Arabidopsis.

    Science.gov (United States)

    Dong, Zhijun; Yu, Yanwen; Li, Shenghui; Wang, Juan; Tang, Saijun; Huang, Rongfeng

    2016-01-04

    Increasing evidence has revealed that abscisic acid (ABA) negatively modulates ethylene biosynthesis, although the underlying mechanism remains unclear. To identify the factors involved, we conducted a screen for ABA-insensitive mutants with altered ethylene production in Arabidopsis. A dominant allele of ABI4, abi4-152, which produces a putative protein with a 16-amino-acid truncation at the C-terminus of ABI4, reduces ethylene production. By contrast, two recessive knockout alleles of ABI4, abi4-102 and abi4-103, result in increased ethylene evolution, indicating that ABI4 negatively regulates ethylene production. Further analyses showed that expression of the ethylene biosynthesis genes ACS4, ACS8, and ACO2 was significantly decreased in abi4-152 but increased in the knockout mutants, with partial dependence on ABA. Chromatin immunoprecipitation-quantitative PCR assays showed that ABI4 directly binds the promoters of these ethylene biosynthesis genes and that ABA enhances this interaction. A fusion protein containing the truncated ABI4-152 peptide accumulated to higher levels than its full-length counterpart in transgenic plants, suggesting that ABI4 is destabilized by its C terminus. Therefore, our results demonstrate that ABA negatively regulates ethylene production through ABI4-mediated transcriptional repression of the ethylene biosynthesis genes ACS4 and ACS8 in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.

  11. A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

    Science.gov (United States)

    Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

    2017-05-01

    Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

  12. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  13. Study on interstrand coupling losses in Rutherford-type superconducting cables

    International Nuclear Information System (INIS)

    Lei, Y.Z.; Shintomi, T.; Terashima, A.; Hirabayashi, H.

    1993-02-01

    Two sets of experimental apparatus for measuring the AC losses in superconducting strands and Rutherford-type cable conductors have been constructed. A few strand samples and a number of compacted cable samples with and without a CuMn matrix have been measured. The hysteresis loss, loss from coupling within strands and loss from coupling between strands in cables have been distinguished from each other. The results show that, even for Rutherford cables without any soldering and coating, their AC losses may be quite different from each other due to the variation of the interstrand coupling loss. For cables without a CuMn matrix, interstrand coupling loss increases nearly according to a geometrical series with an increase of curing temperature simulating coil fabrication. However, cables with the CuMn matrix show a relatively small curing temperature dependence. For most of the samples, losses do not show any evident dependence on the mechanical pressure. Interstrand resistances in one of these cables have also been measured; the results indicate that the tendency for a decrease in the interstrand resistances is consistent with the results of AC loss measurements. (author)

  14. Advanced reliability improvement of AC-modules (ARIA)

    International Nuclear Information System (INIS)

    Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.

    2001-09-01

    The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string

  15. Loss and Inductance Investigation in Superconducting Cable Conductors

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Tønnesen, Ole; Træholt, Chresten

    1999-01-01

    An important parameter in the design and optimization of a superconducting cable conductor is the control of the current distribution among single tapes and layers. This distribution is to a large degree determined by inductances, since the resistances are low. The self and mutual inductances...... of transport current and current distribution.This presentation is based on a number of experiments performed on prototype superconducting cable conductors. The critical current (1uV/cm) of the conductor at 77K was 1590 A (cable #1) and 3240 A (cable #2) respectively.At an rms current of 2 kA (50 Hz) the AC......-loss was measured on cable #2 to 0.6W/mxphase. This is, to our knowledge, the lowest AC-loss (at 2kA and 77K) of a high temperature superconducting cable conductor reported so far....

  16. AC Voltage Control of DC/DC Converters Based on Modular Multilevel Converters in Multi-Terminal High-Voltage Direct Current Transmission Systems

    Directory of Open Access Journals (Sweden)

    Rui Li

    2016-12-01

    Full Text Available The AC voltage control of a DC/DC converter based on the modular multilevel converter (MMC is considered under normal operation and during a local DC fault. By actively setting the AC voltage according to the two DC voltages of the DC/DC converter, the modulation index can be near unity, and the DC voltage is effectively utilized to output higher AC voltage. This significantly decreases submodule (SM capacitance and conduction losses of the DC/DC converter, yielding reduced capital cost, volume, and higher efficiency. Additionally, the AC voltage is limited in the controllable range of both the MMCs in the DC/DC converter; thus, over-modulation and uncontrolled currents are actively avoided. The AC voltage control of the DC/DC converter during local DC faults, i.e., standby operation, is also proposed, where only the MMC connected on the faulty cable is blocked, while the other MMC remains operational with zero AC voltage output. Thus, the capacitor voltages can be regulated at the rated value and the decrease of the SM capacitor voltages after the blocking of the DC/DC converter is avoided. Moreover, the fault can still be isolated as quickly as the conventional approach, where both MMCs are blocked and the DC/DC converter is not exposed to the risk of overcurrent. The proposed AC voltage control strategy is assessed in a three-terminal high-voltage direct current (HVDC system incorporating a DC/DC converter, and the simulation results confirm its feasibility.

  17. Abundance of dioxygenase genes similar to Ralstonia sp strain U2 nagAc is correlated with naphthalene concentrations in coal tar-contaminated freshwater sediments

    Energy Technology Data Exchange (ETDEWEB)

    Dionisi, H.M.; Chewning, C.S.; Morgan, K.H.; Menn, F.M.; Easter, J.P; Sayler, G.S. [University of Tennessee, Knoxville, TN (United States). Center for Environmental Biotechnology

    2004-07-01

    We designed a real-time PCR assay able to recognize dioxygenase large-subunit gene sequences with more than 90% similarity to the Ralstonia sp. strain U2 nagAc gene (nagAc-like gene sequences) in order to study the importance of organisms carrying these genes in the biodegradation of naphthalene. Sequencing of PCR products indicated that this real-time PCR assay was specific and able to detect a variety of nagAc-like gene sequences. One to 100 ng of contaminated-sediment total DNA in 25-{mu}l reaction mixtures produced an amplification efficiency of 0.97 without evident PCR inhibition. The assay was applied to surficial freshwater sediment samples obtained in or in close proximity to a coal tar-contaminated Superfund site. Naphthalene concentrations in the analyzed samples varied between 0.18 and 106 mg/kg of dry weight sediment. The assay for nagAc-like sequences indicated the presence of (4.1 {+-} 0.7) X 10{sup 3} to (2.9 {+-} 0.3) X 10{sup 5} copies of nagAc-like dioxygenase genes per mug of DNA extracted from sediment samples. These values corresponded to (1.2 {+-} 0.6) X 10{sup 5} to (5.4 {+-} 0.4) X 10{sup 7} copies of this target per g of dry weight sediment when losses of DNA during extraction were taken into account. There was a positive correlation between naphthalene concentrations and nagAc-like gene copies per microgram of DNA = 0.89) and per gram of dry weight sediment = 0.77). These results provide evidence of the ecological significance of organisms carrying nagAc-like genes in the biodegradation of naphthalene.

  18. PREGNANCY LOSS IN MARES

    Directory of Open Access Journals (Sweden)

    Tibary A

    2015-12-01

    Full Text Available Pregnancy loss is an important aspect of equine practice due to the economic and emotional loss that it engenders. Pregnancy loss is often divided in two categories: early pregnancy loss (EPL or embryonic death (ED (first 42 days and fetal losses (after 42 days. Diagnosis of the causes of pregnancy loss is often very challenging. Many of the causes of EPL remain poorly documented but studies on embryo development and embryo-uterine interaction have been able to shed some light on predisposing factors. Fetal losses or abortions are dominated by infectious causes and particularly bacterial placentitis. Detailed reviews of pregnancy loss were recently published by the authors (Tibary et al., 2012; Tibary and Pearson, 2012; Tibary et al., 2014. The objective of this paper is to provide an overview of the epidemiology, etiology, diagnosis and prevention of pregnancy loss in the mare.

  19. Dielectric relaxation and AC conductivity studies of Se90Cd10−xInx glassy alloys

    Directory of Open Access Journals (Sweden)

    Nitesh Shukla

    2016-06-01

    Full Text Available Chalcogenide glassy alloys of Se90Cd10−xInx (x = 2, 4, 6, 8 are synthesized by melt quench technique. The prepared glassy alloys have been characterized by techniques such as differential scanning calorimetry (DSC, scanning electron microscopy (SEM and energy dispersive X-ray (EDAX. Dielectric properties of Se90Cd10−xInx (x = 2, 4, 6, 8 chalcogenide glassy system have been studied using impedance spectroscopic technique in the frequency range 42 Hz to 5 MHz at room temperature. It is found that the dielectric constants ɛ′, dielectric loss factor ɛ″ and loss angle Tan δ depend on frequency. ɛ′, ɛ″ and loss angle Tan δ are found to be decreasing with the In content in Se90Cd10−xInx glassy system. AC conductivity of the prepared sample has also been studied. It is found that AC conductivity increases with frequency where as it has decreasing trend with increasing In content in Se–Cd matrix. The semicircles observed in the Cole–Cole plots indicate a single relaxation process.

  20. Corona helps curb losses

    Energy Technology Data Exchange (ETDEWEB)

    Laasonen, M.; Lahtinen, M.; Lustre, L.

    1996-11-01

    The greatest power losses in electricity transmission arise through a phenomenon called load losses. Corona losses caused by the surface discharge of electricity also constitute a considerable cost item. IVS, the nationwide network company, is investigating corona- induced losses, and has also commissioned similar research from IVO International, the Technical Research Centre of Finland (VTT) and from Tampere University of Technology. The research work strives to gain more in-depth knowledge on the phenomenon of frosting and its impact on corona losses. The correct prediction of frost helps reduce corona losses, while also cutting costs considerably. (orig.)

  1. Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

    Directory of Open Access Journals (Sweden)

    Vinod Kumar Singh

    2016-09-01

    Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

  2. Analytical solution of the PNP equations at AC applied voltage

    International Nuclear Information System (INIS)

    Golovnev, Anatoly; Trimper, Steffen

    2012-01-01

    A symmetric binary polymer electrolyte subjected to an AC voltage is considered. The analytical solution of the Poisson–Nernst–Planck equations (PNP) is found and analyzed for small applied voltages. Three distinct time regimes offering different behavior can be discriminated. The experimentally realized stationary behavior is discussed in detail. An expression for the external current is derived. Based on the theoretical result a simple method is suggested of measuring the ion mobility and their concentration separately. -- Highlights: ► Analytical solution of Poisson–Nernst–Planck equations. ► Binary polymer electrolyte subjected to an external AC voltage. ► Three well separated time scales exhibiting different behavior. ► The experimentally realized stationary behavior is discussed in detail. ► A method is proposed measuring the mobility and the concentration separately.

  3. SNL software manual for the ACS Data Analytics Project.

    Energy Technology Data Exchange (ETDEWEB)

    Stearley, Jon R.; McLendon, William Clarence, III; Rodrigues, Arun F.; Williams, Aaron S.; Hooper, Russell Warren; Robinson, David Gerald; Stickland, Michael G.

    2011-10-01

    In the ACS Data Analytics Project (also known as 'YumYum'), a supercomputer is modeled as a graph of components and dependencies, jobs and faults are simulated, and component fault rates are estimated using the graph structure and job pass/fail outcomes. This report documents the successful completion of all SNL deliverables and tasks, describes the software written by SNL for the project, and presents the data it generates. Readers should understand what the software tools are, how they fit together, and how to use them to reproduce the presented data and additional experiments as desired. The SNL YumYum tools provide the novel simulation and inference capabilities desired by ACS. SNL also developed and implemented a new algorithm, which provides faster estimates, at finer component granularity, on arbitrary directed acyclic graphs.

  4. Security analysis of interconnected AC/DC systems

    DEFF Research Database (Denmark)

    Eriksson, Robert

    2015-01-01

    This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid...... any line or transformer limits. Simulations were performed in a model of the Nordic power system where a dc grid is placed on top. The simulation supports the method as a tool to consider transfer limits in the grid to avoid violate the same and increase the security after a converter outage........ The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...

  5. Development of AC-DC power system simulator

    International Nuclear Information System (INIS)

    Ichikawa, Tatsumi; Ueda, Kiyotaka; Inoue, Toshio

    1984-01-01

    A modeling and realization technique is described for realtime plant dynamics simulation of nuclear power generating unit in AC-DC power system simulator. Dynamic behavior of reactor system and steam system is important for investigation a further adequate unit control and protection system to system faults in AC and DC power system. Each unit of two nuclear power generating unit in the power system simulator consists of micro generator, DC motors, flywheels and process computer. The DC motor and flywheel simulates dynamic characteristics of steam turbine, and process computer simulates plant dynamics by digital simulation. We have realized real-time plant dynamics simulation by utilizing a high speed process I/O and a high speed digital differential analyzing processor (DDA) in which we builted a newly developed simple plant model. (author)

  6. Autonomous power management for interlinked AC-DC microgrids

    DEFF Research Database (Denmark)

    Nutkani, Inam Ullah; Meegahapola, Lasantha; Andrew, Loh Poh Chiang

    2018-01-01

    of the DC micro-grid before importing power from the interlinked AC microgrid. This strategy enables voltage regulation in the DC microgrid, and also reduces the number of converters in operation. The proposed scheme is fully autonomous while it retains the plug-n-play features for generators and tie......The existing power management schemes for inter-linked AC-DC microgrids have several operational drawbacks. Some of the existing control schemes are designed with the main objective of sharing power among the interlinked microgrids based on their loading conditions, while other schemes regulate...... the voltage of the interlinked microgrids without considering the specific loading conditions. However, the existing schemes cannot achieve both objectives efficiently. To address these issues, an autonomous power management scheme is proposed, which explicitly considers the specific loading condition...

  7. Offshore windfarm connection with low frequency AC transmission technology

    DEFF Research Database (Denmark)

    Qin, Nan; Xu, Zhao; You, Shi

    2009-01-01

    This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared...... to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...... developed, which consists of three parts, the fixed-speed wind turbine representing a wind farm, the transmission line and the frequency converter. Although the transmission capability is greatly improved by the LFAC system, simulation shows it gives negative influences on the wind turbine operation due...

  8. Indoor Air Pollution in Non Ac Passenger Bus

    Science.gov (United States)

    El Husna, Iksiroh; Unzilatirrizqi, Rizal D. Yan El; Karyanto, Yudi; Sunoko, Henna R.

    2018-02-01

    Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR). The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR) on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.

  9. On-Chip AC self-test controller

    Science.gov (United States)

    Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY

    2009-09-29

    A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

  10. ac power control in the Core Flow Test Loop

    International Nuclear Information System (INIS)

    McDonald, D.W.

    1980-01-01

    This work represents a status report on a development effort to design an ac power controller for the Core Flow Test Loop. The Core Flow Test Loop will be an engineering test facility which will simulate the thermal environment of a gas-cooled fast-breeder reactor. The problems and limitations of using sinusoidal ac power to simulate the power generated within a nuclear reactor are addressed. The transformer-thyristor configuration chosen for the Core Flow Test Loop power supply is presented. The initial considerations, design, and analysis of a closed-loop controller prototype are detailed. The design is then analyzed for improved performance possibilities and failure modes are investigated at length. A summary of the work completed to date and a proposed outline for continued development completes the report

  11. 27-Level DC–AC inverter with single energy source

    International Nuclear Information System (INIS)

    Tsang, K.M.; Chan, W.L.

    2012-01-01

    Highlights: ► This paper reports a novel 27-level DC–AC inverter using only single renewable energy source. ► The efficiency of the inverter is very high. The output waveform is almost sinusoidal. ► The cost is low as the number of power switches required is only 12. - Abstract: A novel design of multilevel DC–AC inverter using only single renewable energy source is presented in this paper. The proposed approach enables multilevel output to be realised by a few cascaded H-bridges and a single energy source. As an illustration, a 27-level inverter has been implemented based on three cascaded H-bridges with a single energy source and two capacitors. Using the proposed novel switching strategy, 27 levels can be realized and the two virtual energy sources can be well regulated. Experimental results are included to demonstrate the effectiveness of the proposed inverter.

  12. Indoor Air Pollution in Non Ac Passenger Bus

    Directory of Open Access Journals (Sweden)

    El Husna Iksiroh

    2018-01-01

    Full Text Available Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR. The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.

  13. Influence of AC external magnetic field perturbation on the guidance force of HTS bulk over a NdFeB guideway

    International Nuclear Information System (INIS)

    Zhang Longcai; Wang Jiasu; Wang Suyu; He Qingyong

    2007-01-01

    Superconducting maglev vehicle system requires that the surface magnetic field of the guideway is uniform along the forward direction. But in practice the surface magnetic field of the NdFeB permanent magnet guideway is not always immutable. So the HTS bulks in this case are exposed to AC external magnetic field, which may induce the energy loss in the bulk and influence the guidance force between the HTS bulks and the NdFeB guideway. In this paper, we experimentally studied the influence of the AC external magnetic field perturbation on the guidance force of a HTS bulk over the NdFeB guideway. The experimental results showed that the guidance force was influenced by the application of the AC external magnetic. The guidance fore hysteresis became more evident with the amplitude of the AC field and was independent of the frequency in the range 90-400 Hz. We attributed the reason to magnetic hysteresis loss in the superconductor

  14. Influence of AC external magnetic field perturbation on the guidance force of HTS bulk over a NdFeB guideway

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Longcai [Applied Superconductivity Laboratory, Southwest Jiaotong University, P.O. Box 152, Chengdu, Sichuan 610031 (China)]. E-mail: zhlcai2000@163.com; Wang Jiasu [Applied Superconductivity Laboratory, Southwest Jiaotong University, P.O. Box 152, Chengdu, Sichuan 610031 (China); Wang Suyu [Applied Superconductivity Laboratory, Southwest Jiaotong University, P.O. Box 152, Chengdu, Sichuan 610031 (China); He Qingyong [Applied Superconductivity Laboratory, Southwest Jiaotong University, P.O. Box 152, Chengdu, Sichuan 610031 (China)

    2007-08-01

    Superconducting maglev vehicle system requires that the surface magnetic field of the guideway is uniform along the forward direction. But in practice the surface magnetic field of the NdFeB permanent magnet guideway is not always immutable. So the HTS bulks in this case are exposed to AC external magnetic field, which may induce the energy loss in the bulk and influence the guidance force between the HTS bulks and the NdFeB guideway. In this paper, we experimentally studied the influence of the AC external magnetic field perturbation on the guidance force of a HTS bulk over the NdFeB guideway. The experimental results showed that the guidance force was influenced by the application of the AC external magnetic. The guidance fore hysteresis became more evident with the amplitude of the AC field and was independent of the frequency in the range 90-400 Hz. We attributed the reason to magnetic hysteresis loss in the superconductor.

  15. Spectroscopic AC susceptibility imaging (sASI) of magnetic nanoparticles

    International Nuclear Information System (INIS)

    Ficko, Bradley W.; Nadar, Priyanka M.; Diamond, Solomon G.

    2015-01-01

    This study demonstrates a method for alternating current (AC) susceptibility imaging (ASI) of magnetic nanoparticles (mNPs) using low cost instrumentation. The ASI method uses AC magnetic susceptibility measurements to create tomographic images using an array of drive coils, compensation coils and fluxgate magnetometers. Using a spectroscopic approach in conjunction with ASI, a series of tomographic images can be created for each frequency measurement set and is termed sASI. The advantage of sASI is that mNPs can be simultaneously characterized and imaged in a biological medium. System calibration was performed by fitting the in-phase and out-of-phase susceptibility measurements of an mNP sample with a hydrodynamic diameter of 100 nm to a Brownian relaxation model (R 2 =0.96). Samples of mNPs with core diameters of 10 and 40 nm and a sample of 100 nm hydrodynamic diameter were prepared in 0.5 ml tubes. Three mNP samples were arranged in a randomized array and then scanned using sASI with six frequencies between 425 and 925 Hz. The sASI scans showed the location and quantity of the mNP samples (R 2 =0.97). Biological compatibility of the sASI method was demonstrated by scanning mNPs that were injected into a pork sausage. The mNP response in the biological medium was found to correlate with a calibration sample (R 2 =0.97, p<0.001). These results demonstrate the concept of ASI and advantages of sASI. - Highlights: • Development of an AC susceptibility imaging model. • Comparison of AC susceptibility imaging (ASI) and susceptibility magnitude imaging (SMI). • Demonstration of ASI and spectroscopic ASI (sASI) using three different magnetic nanoparticle types. • SASI scan separation of three different magnetic nanoparticles samples using 5 spectroscopic frequencies. • Demonstration of biological feasibility of sASI

  16. AC electrical conductivity in amorphous indium selenide thin films

    International Nuclear Information System (INIS)

    Di Giulio, H.; Rella, R.; Tepore, A.

    1987-01-01

    In order to obtain additional information about the nature of the conduction mechanism in amorphous InSe films results of an experimental study concerning the frequency and temperature dependence of the ac conductivity are reported. The measurements were performed on specimens of different thickness and different electrode contact areas. The results can be explained assuming that conduction occurs by phonon-assisted hopping between localized states near the Fermi level

  17. DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-05-01

    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  18. AC system stabilization via phase shift transformer with thyristor commutation

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Jose Carlos de; Guimaraes, Geraldo Caixeta; Moraes, Adelio Jose [Uberlandia Univ., MG (Brazil); Abreu, Jose Policarpo G. de [Escola Federal de Engenharia de Itajuba, MG (Brazil); Oliveira, Edimar Jose de [Juiz de Fora Univ., MG (Brazil)

    1994-12-31

    This article aims to present initially the constructive and operative forms of a phase-shift autotransformer which provides both magnitude and phase angle change through thyristor commutation, including a technic to reduce the number of thyristors. Following, it is proposed a control system to make such equipment an efficient AC system stabilizing tool. It is presented some simulation results to show the operation of this transformer in an electrical system. (author) 3 refs., 11 figs., 3 tabs.

  19. Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis

    International Nuclear Information System (INIS)

    Hossan, Mohammad Robiul; Dillon, Robert; Dutta, Prashanta

    2014-01-01

    Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface–immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices

  20. MD 349: Impedance Localization with AC-dipole

    CERN Document Server

    Biancacci, Nicolo; Metral, Elias; Salvant, Benoit; Papotti, Giulia; Persson, Tobias Hakan Bjorn; Tomas Garcia, Rogelio; CERN. Geneva. ATS Department

    2016-01-01

    The purpose of this MD is to measure the distribution of the transverse impedance of the LHC by observing the phase advance variation with intensity between the machine BPMs. Four injected bunches with different intensities are excited with an AC dipole and the turn by turn data is acquired from the BPM system. Through post-processing analysis the phase variation along the machine is depicted and, from this information, first conclusions of the impedance distribution can be drawn.

  1. Travel Support for Scientists to Participate in ACS Symposium

    Science.gov (United States)

    2017-08-31

    ESPCI- Paris , France) at the 252nd ACS National Meeting in Philadelphia, Aug 21-25, 2016. In this two-day event, we have 30 oral presentations (17...Scott Grayson (Tulane University), Prof. Jemeriah Johnson (MIT), Prof. Julien Nicolas (Université Paris -Sud). Training Opportunities: Among the 30...polymer catalysts, to self-healing materials and pollution salvation materials. On this aspect, both academia and industrial laboratories have reached

  2. New Subarray Readout Patterns for the ACS Wide Field Channel

    Science.gov (United States)

    Golimowski, D.; Anderson, J.; Arslanian, S.; Chiaberge, M.; Grogin, N.; Lim, Pey Lian; Lupie, O.; McMaster, M.; Reinhart, M.; Schiffer, F.; Serrano, B.; Van Marshall, M.; Welty, A.

    2017-04-01

    At the start of Cycle 24, the original CCD-readout timing patterns used to generate ACS Wide Field Channel (WFC) subarray images were replaced with new patterns adapted from the four-quadrant readout pattern used to generate full-frame WFC images. The primary motivation for this replacement was a substantial reduction of observatory and staff resources needed to support WFC subarray bias calibration, which became a new and challenging obligation after the installation of the ACS CCD Electronics Box Replacement during Servicing Mission 4. The new readout patterns also improve the overall efficiency of observing with WFC subarrays and enable the processing of subarray images through stages of the ACS data calibration pipeline (calacs) that were previously restricted to full-frame WFC images. The new readout patterns replace the original 512×512, 1024×1024, and 2048×2046-pixel subarrays with subarrays having 2048 columns and 512, 1024, and 2048 rows, respectively. Whereas the original square subarrays were limited to certain WFC quadrants, the new rectangular subarrays are available in all four quadrants. The underlying bias structure of the new subarrays now conforms with those of the corresponding regions of the full-frame image, which allows raw frames in all image formats to be calibrated using one contemporaneous full-frame "superbias" reference image. The original subarrays remain available for scientific use, but calibration of these image formats is no longer supported by STScI.

  3. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-04-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

  4. AC Electric Field Communication for Human-Area Networking

    Science.gov (United States)

    Kado, Yuichi; Shinagawa, Mitsuru

    We have proposed a human-area networking technology that uses the surface of the human body as a data transmission path and uses an AC electric field signal below the resonant frequency of the human body. This technology aims to achieve a “touch and connect” intuitive form of communication by using the electric field signal that propagates along the surface of the human body, while suppressing both the electric field radiating from the human body and mutual interference. To suppress the radiation field, the frequency of the AC signal that excites the transmitter electrode must be lowered, and the sensitivity of the receiver must be raised while reducing transmission power to its minimally required level. We describe how we are developing AC electric field communication technologies to promote the further evolution of a human-area network in support of ubiquitous services, focusing on three main characteristics, enabling-transceiver technique, application-scenario modeling, and communications quality evaluation. Special attention is paid to the relationship between electro-magnetic compatibility evaluation and regulations for extremely low-power radio stations based on Japan's Radio Law.

  5. DC response of dust to low frequency AC signals

    Science.gov (United States)

    McKinlay, Michael; Konopka, Uwe; Thomas, Edward

    2017-10-01

    Macroscopic changes in the shape and equilibrium position of clouds of charged microparticles suspended in a plasma have been observed in response to low frequency AC signals. In these experiments, dusty plasmas consisting of 2-micron diameter silica microspheres suspended between an anode and cathode in an argon, DC glow discharge plasma are produced in a grounded, 6-way cross vacuum chamber. An AC signal, produced by a function generator and amplified by a bipolar op-amp, is superimposed onto the potential from the cathode. The frequencies of the applied AC signals, ranging from tens to hundreds of kHz, are comparable to the ion-neutral collision frequency; well below the ion/electron plasma frequencies, but also considerably higher than the dust plasma frequency. This presentation will detail the experimental setup, present documentation and categorization of observations of the dust response, and present an initial model of the response. This work is supported by funding from the US Dept. of Energy, Grant Number DE-SC0016330, and by the National Science Foundation, Grant Number PHY-1613087.

  6. AC Conductivity and Dielectric Properties of Borotellurite Glass

    Science.gov (United States)

    Taha, T. A.; Azab, A. A.

    2016-10-01

    Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.

  7. The ACS-NUCL Division 50th Anniversary: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-01-10

    The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.

  8. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan; Cha, Min; Chung, Suk-Ho

    2014-01-01

    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  9. Simulation of the AC corona phenomenon with experimental validation

    International Nuclear Information System (INIS)

    Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R

    2017-01-01

    The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)

  10. AC-600 passive containment cooling system performance research

    International Nuclear Information System (INIS)

    Jia Baoshan; Yu Jiyang; Shi Junying

    1997-01-01

    a code named PCCSAC which is able to predict both the evaporating film on the outside surface of the vessel and the condensed film on its inside is developed successfully. It is a special software tool to analyze the passive containment cooling system (PCCS) performance in the design of AC-600. The author includes the establishment of physical models, selection of numerical methods, debugging and verification of the code and application of the code in the AC-600 PCCS. In physical models, the fundamental conservation equations about various areas and heat conduction equations are established. In order to make the equations to meet the closed form of solution, a lot of structure formulae are complemented. After repeated selection and demonstration of the numerical methods, the backward difference method Gear which is generally used for stiff problem is chosen for the solution of ordinary differential equations derived from the physical models. The results of standard example calculated by the PCCSAC code and the COMMIX code which is used to analyze westinghouse AP-600 are same in the main. The reliability and validity are verified from the calculations. The PCCSAC code is applied in the calculations of two important LOCA used in the containment safety analyses. The sensitivity of main parameters in the system based on LOCA are studied. All the results are reasonable and in agreement with the theoretical analyses. It can be concluded that the PCCSAC code is able to be used for the analyses of AC-600 PCCS performance

  11. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan

    2014-09-22

    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  12. Telogen Effluvium Hair Loss

    Science.gov (United States)

    ... Category: Share: Yes No, Keep Private Telogen Effluvium Hair Loss Share | It is normal to lose up to ... months after the "shock". This sudden increase in hair loss, usually described as the hair coming out in ...

  13. Recurrent pregnancy loss

    DEFF Research Database (Denmark)

    Egerup, P; Kolte, A M; Larsen, E C

    2016-01-01

    STUDY QUESTION: Is there a different prognostic impact for consecutive and non-consecutive early pregnancy losses in women with secondary recurrent pregnancy loss (RPL)? SUMMARY ANSWER: Only consecutive early pregnancy losses after the last birth have a statistically significant negative prognostic...... impact in women with secondary RPL. WHAT IS KNOWN ALREADY: The risk of a new pregnancy loss increases with the number of previous pregnancy losses in patients with RPL. Second trimester losses seem to exhibit a stronger negative impact than early losses. It is unknown whether the sequence of pregnancy...... losses plays a role for the prognosis in patients with a prior birth. STUDY DESIGN, SIZE, DURATION: This retrospective cohort study of pregnancy outcome in patients with unexplained secondary RPL included in three previously published, Danish double-blinded placebo-controlled trials of intravenous...

  14. Genes and Hearing Loss

    Science.gov (United States)

    ... ENTCareers Marketplace Find an ENT Doctor Near You Genes and Hearing Loss Genes and Hearing Loss Patient ... mutation may only have dystopia canthorum. How Do Genes Work? Genes are a road map for the ...

  15. Menopause and Bone Loss

    Science.gov (United States)

    Fact Sheet & Menopause Bone Loss How are bone loss and menopause related? Throughout life your body keeps a balance between the ... lose bone faster than it can be replaced. Menopause—the time when menstrual periods end, which usually ...

  16. OI Issues: Hearing Loss

    Science.gov (United States)

    ... signals normally to the brain. In addition, hearing losses are classified according to the degree of severity: • Mild, • Moderate, • Severe, • Profound. Hearing losses are also classified according to the sound frequency ...

  17. Early Pregnancy Loss

    Science.gov (United States)

    ... go on to have successful pregnancies. Repeated pregnancy losses are rare. Testing and evaluation can be done ... find a cause if you have several pregnancy losses. Even if no cause is found, most couples ...

  18. Occupational hearing loss

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/001048.htm Occupational hearing loss To use the sharing features on this page, please enable JavaScript. Occupational hearing loss is damage to the inner ear from noise ...

  19. Pregnancy Loss and Miscarriage

    Science.gov (United States)

    ... D linked to miscarriage among women with prior pregnancy loss Release: Anti-HIV drug combination does not increase preterm birth risk, study suggests Release: Elevated blood pressure before pregnancy may increase chance of pregnancy loss All related ...

  20. Coping with Memory Loss

    Science.gov (United States)

    ... Consumers Home For Consumers Consumer Updates Coping With Memory Loss Share Tweet Linkedin Pin it More sharing ... be evaluated by a health professional. What Causes Memory Loss? Anything that affects cognition—the process of ...

  1. Weight Loss Surgery

    Science.gov (United States)

    Weight loss surgery helps people with extreme obesity to lose weight. It may be an option if you cannot lose weight ... obesity. There are different types of weight loss surgery. They often limit the amount of food you ...

  2. Myopic loss aversion revisited

    OpenAIRE

    Blavatskyy, Pavlo; Pogrebna, Ganna

    2009-01-01

    In this paper we reexamine several experimental papers on myopic loss aversion by analyzing individual rather than aggregate choice patterns. We find that the behavior of the majority of subjects is inconsistent with the hypothesis of myopic loss aversion.

  3. ac conductivity and dielectric properties of amorphous Se80Te20-xGex chalcogenide glass film compositions

    International Nuclear Information System (INIS)

    Hegab, N.A.; Afifi, M.A.; Atyia, H.E.; Farid, A.S.

    2009-01-01

    Thin films of the prepared Se 80 Te 20-x Ge x (x = 5, 7 and 10 at.%) were prepared by thermal evaporation technique. X-ray diffraction patterns showed that the films were in amorphous state. The ac conductivity and dielectric properties of the investigated film compositions were studied in the frequency range 0.1-100 kHz and in temperature range (303-373 K). The experimental results indicated that the ac conductivity and the dielectric properties depended on the temperature and frequency. The ac conductivity is found to obey the ω s law, in accordance with the hopping model, s is found to be temperature dependent (s 1 and dielectric loss ε 2 were found to decrease with frequency and increase with temperature. The maximum barrier height W m , calculated from dielectric measurements according to Guintini equation, agrees with that proposed by the theory of hopping over potential barrier as suggested by Elliott in case of chalcogenide glasses. The density of localized states was estimated for the studied film compositions. The variation of the studied properties with Ge content was also investigated.

  4. Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Rudy Ariyanto

    2017-11-01

    Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

  5. Help! It's Hair Loss!

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español Hair Loss KidsHealth / For Kids / Hair Loss What's in this ... head are in the resting phase. What Causes Hair Loss? Men, especially older men, are the ones who ...

  6. Proven Weight Loss Methods

    Science.gov (United States)

    Fact Sheet Proven Weight Loss Methods What can weight loss do for you? Losing weight can improve your health in a number of ways. It can lower ... at www.hormone.org/Spanish . Proven Weight Loss Methods Fact Sheet www.hormone.org

  7. The Use of AC-DC-AC Methods in Assessing Corrosion Resistance Performance of Coating Systems for Magnesium Alloys

    Science.gov (United States)

    McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante

    The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.

  8. A direct power conversion topology for grid integrations of hybrid AC/DC resources

    DEFF Research Database (Denmark)

    Liu, Xiong; Loh, Poh Chiang; Wang, Peng

    2012-01-01

    and modulation schemes are proposed to extract the commanded current from the input ac/dc sources to the grid and guarantee high quality ac/dc inputs and ac output current waveforms with unity power factors. The proposed modulation scheme for sinusoidal outputs of the VMC is mathematically proved...

  9. Risk prediction of ventricular arrhythmias and myocardial function in Lamin A/C mutation positive subjects

    DEFF Research Database (Denmark)

    Hasselberg, Nina E; Edvardsen, Thor; Petri, Helle

    2014-01-01

    Mutations in the Lamin A/C gene may cause atrioventricular block, supraventricular arrhythmias, ventricular arrhythmias (VA), and dilated cardiomyopathy. We aimed to explore the predictors and the mechanisms of VA in Lamin A/C mutation-positive subjects.METHODS AND RESULTS: We included 41 Lamin A/C...

  10. 21 CFR 880.5100 - AC-powered adjustable hospital bed.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...

  11. Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly

    International Nuclear Information System (INIS)

    Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production

  12. Pantallas acústicas submarinas de material compuesto multilaminar con matriz metálica

    OpenAIRE

    Gallego, V.; Laguna, M.; Vázquez, A. J.

    1999-01-01

    7 pp.-- PACS nr.: 43.30.Ky.-- Comunicación presentada en los siguientes congresos: XXX Jornadas Nacionales de Acústica – TecniAcústica 1999. Encuentro Ibérico de Acústica (Ávila, 20-22 Octubre 1999).

  13. Energy losses in switches

    International Nuclear Information System (INIS)

    Martin, T.H.; Seamen, J.F.; Jobe, D.O.

    1993-01-01

    The authors experiments show energy losses between 2 and 10 times that of the resistive time predictions. The experiments used hydrogen, helium, air, nitrogen, SF 6 polyethylene, and water for the switching dielectric. Previously underestimated switch losses have caused over predicting the accelerator outputs. Accurate estimation of these losses is now necessary for new high-efficiency pulsed power devices where the switching losses constitute the major portion of the total energy loss. They found that the switch energy losses scale as (V peak I peak ) 1.1846 . When using this scaling, the energy losses in any of the tested dielectrics are almost the same. This relationship is valid for several orders of magnitude and suggested a theoretical basis for these results. Currents up to .65 MA, with voltages to 3 MV were applied to various gaps during these experiments. The authors data and the developed theory indicates that the switch power loss continues for a much longer time than the resistive time, with peak power loss generally occurring at peak current in a ranging discharge instead of the early current time. All of the experiments were circuit code modeled after developing a new switch loss version based on the theory. The circuit code predicts switch energy loss and peak currents as a function of time. During analysis of the data they noticed slight constant offsets between the theory and data that depended on the dielectric. They modified the plasma conductivity for each tested dielectric to lessen this offset

  14. Beam Loss in Linacs

    CERN Document Server

    Plum, M.A.

    2016-01-01

    Beam loss is a critical issue in high-intensity accelerators, and much effort is expended during both the design and operation phases to minimize the loss and to keep it to manageable levels. As new accelerators become ever more powerful, beam loss becomes even more critical. Linacs for H- ion beams, such as the one at the Oak Ridge Spallation Neutron Source, have many more loss mechanisms compared to H+ (proton) linacs, such as the one being designed for the European Spallation Neutron Source. Interesting H- beam loss mechanisms include residual gas stripping, H+ capture and acceleration, field stripping, black-body radiation and the recently discovered intra-beam stripping mechanism. Beam halo formation, and ion source or RF turn on/off transients, are examples of beam loss mechanisms that are common for both H+ and H- accelerators. Machine protection systems play an important role in limiting the beam loss.

  15. Emergency ac power systems operating experience at U.S. nuclear power plants - 1976 through 1983

    Energy Technology Data Exchange (ETDEWEB)

    Battle, R. E. [Oak Ridge National Laboratory, Oak Ridge, Tennessee (United States)

    1986-02-15

    Success and failure data of test and emergency starts of emergency ac power sources (diesel generators) at U.S. nuclear power plants were collected and evaluated to estimate diesel generator reliability parameters. A regression analysis of the estimates of the probability of failure to start based on surveillance test data from 1976 through 1983 indicates that the probability of failure to start has been decreasing. However, the reliability of diesel generator performance during losses of off-site power for 1981 through 1983 was less than expected based on the test data estimates. The failures that occurred during losses of off-site power were reviewed to determine why the calculated failure to start was greater than expected, and possible explanations for this high value are presented. The subsystems involved In diesel generator subsystem failures were categorized to determine whether there were any dominant failure modes. The results indicate that further significant Improvement in diesel generator reliability will require improvement of many subsystems. (author)

  16. PWM CONTROLLER'S MODELS FOR INVESTIGATION ACS IN SPICEFAMILY ECAD PROGRAMS

    Directory of Open Access Journals (Sweden)

    O. V. VASYLENKO

    2018-05-01

    Full Text Available Purpose. To improve simulation and design of Automatic Control Systems in the SPICE-compatible programs and to obtain separate economic and universal macromodels of PWM controller. Development of an PWM controller economical macromodel for the study of automatic control systems (ACS in computer-aided design (ECAD  programs, which does not generate algorithmic failures in comparison with the existing models of PWM. Findings. Analysis of SPICE-family applications’ mathematical basis allowed to classifying existing models of PWM-controllers, defining their suitability for ACS simulation. The criteria for the synthesis of new models have been defined. For the SPICE 3G algorithms, the Switch and Averaged models based on behavioral elements has been developed. Universal and economical PWM controller macromodel based on the simple algorithm for determining the output signal with minimum numbers of input parameters has been designed. For the Automated Measuring magnetic susceptibility System, the macromodel of quasi-PWM signal generator have been designed, which is used in the compensation subsystem. This model is different from the existing ones: it synthesizes the staircase output signal instead the pulse one, thus, there is direct control of the amplitude of the output signal, which is taken averaged. The adequacy of the models is confirmed as comparison of the simulation results during investigations of the model already existing in the SPICE program, as well as the results of experiments with real ACS. The modeling of the PWM controller was carried out on the basis of behavioral elements from the ECAD library, simulation (solution of algebra-differential equations systems with programming elements is based on SPICE algorithms. The object of the study was the simulation process of ACS with the pulse-width principle of adjusting the output value. The subject of the research are the models of PWM controllers. Originality. The new macromodel of PWM

  17. Aislamiento acústico a ruido aéreo en acristalamientos de vidrio

    Directory of Open Access Journals (Sweden)

    Escuder Silla, E.

    2007-08-01

    Full Text Available In this paper, the Ookura & Saito model is applied to determine the Airborne Sound Insulation of glazing systems. In particular, the calculations that appear are for monolithic glasses of different thicknesses and laminated glasses from different types. There are different prediction models of the airborne acoustic behaviour of multilayer panels (and the laminated glasses can be considered like such. In all of them, the input data are the elastic constants and the loss factor. The monolithic glasses and the intermediate layer have been characterized according to different Standards. The results are compared with experimental measurements and data of the study of Marsh (1, obtaining a range of acceptable adjustment.

    En este artículo se aplica el modelo de Ookura & Saito para determinar el aislamiento acústico a ruido aéreo de sistemas constructivos basados en vidrios. En concreto, los cálculos que se presentan son para vidrios monolíticos de distintos espesores y para vidrios laminados de diferentes tipos. Existen diferentes modelos de predicción del comportamiento acústico a ruido aéreo de estructuras multicapa (y los vidrios laminados pueden considerarse como tales. En todos ellos, los datos de entrada son las constantes elásticas y el factor de pérdidas. Tanto los vidrios monolíticos como la capa intermedia se han caracterizado siguiendo diferentes normativas. Los resultados se comparan con medidas experimentales y con datos recogidos del estudio de Marsh (1, obteniéndose un grado de ajuste aceptable.

  18. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  19. Working with the American Community Survey in R a guide to using the acs package

    CERN Document Server

    Glenn, Ezra Haber

    2016-01-01

    This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

  20. ELECTRONIC SYSTEM FOR EXPERIMENTATION IN AC ELECTROGRAVIMETRY II: IMPLEMENTED DESIGN

    Directory of Open Access Journals (Sweden)

    Robinson Torres

    2007-06-01

    Full Text Available A detailed description of the electronic system designed to improve the measurements in an experimental AC electrogravimetry setup is presented. This system is committed to acquire appropriated data for determining the Electrogravimetric Transfer Function (EGTF and provide information regarding the mass transfer in an electrochemical cell in the AC Electrogravimetry Technique, but maintaining a good trade-off between the locking frequency bandwidth and the resolution in the frequency tracking, that is, enlarging the bandwidth of the system to follow signals with frequency as higher as 1 kHz, but maintaining an accurate and continuous tracking of this signal. The enlarged bandwidth allows the study of fast kinetic process in electrochemical applications and the continuous tracking let to achieve a precise measurement with good resolution rather than average frequency records obtained by conventional frequency meters. The system is based on an Analogue-Digital Phase Locked Loop (A-D PLL.En este artículo se presenta una descripción detallada del sistema electrónico diseñado para mejorar las medidas en un sistema experimental de electrogravimetría AC. El sistema diseñado se encarga de adquirir los datos adecuados para determinar la función de transferencia electrogravimétrica (EGTF y proveer información relacionada con la transferencia de masa en una celda electroquímica en la técnica de electrogravimetría AC, pero manteniendo un buen compromiso entre el ancho de banda de enganche y la resolución en el seguimiento de la frecuencia, es decir, el sistema incrementa el ancho de banda para permitir el seguimiento de señales con frecuencias hasta de 1 kHz, pero conservando un exacto y continuo seguimiento de esta señal. El aumento del ancho de banda permite el estudio de procesos con una cinética rápida en aplicaciones electroquímicas y el seguimiento continuo de la señal permite la obtención de medidas precisas con buena resoluci