WorldWideScience

Sample records for ac losses

  1. CEC/ICMC'99. Superconduction. AC loss; Koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Amamiya, Naoyuki [Yokohama National University, Yokohama (Japan)

    1999-09-25

    Ten presentations of studies on AC loss of superconductive materials are outlined, which include theoretical expression for AC loss analysis in superconducting cable, frequency dependency of AC loss, effect of aspect ratio and sectional structure by magnetising loss measurement, and effect of base metal resistivity and twist pitch by numerical analysis. Presentations on AC superconduction for commercial frequency were almost all ones concerning to oxide superconductors. (NEDO)

  2. Development of YBCO HTS cable with low AC loss

    Energy Technology Data Exchange (ETDEWEB)

    Yagi, M. [Energy Transmission Research Department Ecology and Energy Laboratory, Furukawa Electric Co., Ltd., 6, Yawata-Kaigandori, Ichihara, Chiba 290-8555 (Japan)], E-mail: m-yagi@ch.furukawa.co.jp; Mukoyama, S. [Energy Transmission Research Department Ecology and Energy Laboratory, Furukawa Electric Co., Ltd., 6, Yawata-Kaigandori, Ichihara, Chiba 290-8555 (Japan); Amemiya, N. [Yokohama National University, 79-5, Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Nagaya, S.; Kashima, N. [Chubu Electric Power Co., Inc., 20-1, Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan); Shiohara, Y. [Superconductivity Research Laboratory, 1-10-13, Shinonome, Koto-ku, Tokyo 135-0062 (Japan)

    2008-09-15

    High temperature superconducting (HTS) cables using YBCO tapes are expected to be more economical because AC losses will be much smaller than conventional cables. To reduce AC loss, 10 mm wide YBCO tapes were divided into five strips using a YAG laser. Using narrower strips and optimizing the space between the strips were effective in reducing AC loss. A 1 m conductor was fabricated, and AC loss was 0.048 W/m at 1 kA and 50 Hz. Based on the successful AC loss reduction in the 1 m conductor, we will fabricate a 10 m HTS cable with a three-layer HTS conductor, electrical insulation, and a one-layer HTS shield and cupper protection layer for overcurrent. In addition, we have developed a prototype of the HTS cable joint that can withstand an overcurrent condition of 31.5 kA for 2 s.

  3. Calibration free method for measurement of the AC magnetization loss

    Energy Technology Data Exchange (ETDEWEB)

    Souc, Jan [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Goemoery, Fedor [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Vojenciak, Michal [Department of Power Electrical Systems, University of Zilina, Vel' ky diel, 010 26 Zilina (Slovakia)

    2005-05-01

    A calibration free measurement method for determination of the magnetization loss of superconducting samples exposed to the external AC magnetic field is presented. The idea is based on the measurement of the part of the power which is supplied by the AC source to the AC magnet generating the magnetic field, in which the sample is located. It uses a coil wound in parallel to the AC field magnet as the measurement coil. To achieve the necessary sensitivity, two identical systems are used, each consisting of an AC magnet and a measurement coil, one of them containing the sample and the other left empty. No measurement and/or calculation of the calibration constant is required. To confirm the suitability of this method, the loss of a Cu sample with known dissipation was measured. The applicability to the AC magnetization loss measurements of superconducting tapes is presented.

  4. Investigation of AC losses in horizontally parallel HTS tapes

    Science.gov (United States)

    Shen, Boyang; Li, Jing; Geng, Jianzhao; Fu, Lin; Zhang, Xiuchang; Zhang, Heng; Li, Chao; Grilli, Francesco; Coombs, T. A.

    2017-07-01

    This paper presents an AC loss study of horizontally parallel HTS tapes. We proposed to use three parallel HTS tapes as an example. The AC losses of the middle and end tape of three parallel tapes have been measured using the electrical method and compared to those of an individual tape. The effect of the interaction between tapes on AC losses has been analysed, and compared with finite-element method (FEM) simulations using the 2D H -formulation implemented in COMSOL Multiphysics. By using FEM simulations, the cases of increasing number of parallel tapes have been considered, and the normalised ratio between the total average AC losses per tape and the AC losses of an individual single tape has been calculated for different gap distances. We proposed a new parameter, Ns , a turning point for number of tapes, to divide Stage 1 and Stage 2 for the AC loss study of horizontally parallel tapes. For Stage 1, N Ns , the total average losses per tape decrease with the increasing number of tapes. The analysis demonstrates that horizontally parallel HTS tapes could be potentially used in superconducting devices like HTS transformers, which could retain or even reduce the total average AC losses per tape with large number of parallel tapes.

  5. Measurement of AC loss of superconductors by vaporizing method

    Energy Technology Data Exchange (ETDEWEB)

    Wakabayashi, Hiroshi; Isono, Takaaki; Matsui, Kunihiro; Fujisaki, Reishi; Nunoya, Yoshihiko; Koizumi, Norikiyo; Takahashi, Yoshikazu; Tsuji, Hiroshi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1995-07-01

    In Japan Atomic Energy Research Institute, the development of superconducting pulse conductors for next period nuclear fusion reactors has been carried out. For these conductors, the rated current of 46 kA and the rated magnetic field of 13T are demanded. When the pulse excitation of superconductors is carried out, AC loss arises, and the temperature of the superconductors rises, and when it exceeds a certain value, the superconducting state cannot be maintained. Therefore, the AC loss of pulse conductors must be limited to a low value. It is difficult to evaluate the AC loss of superconductors by calculation, therefore, it is evaluated by actual measurement. There are magnetizing method and vaporizing method for measuring the AC loss. This time, the equipment for measuring the AC loss of 40 kA class superconductors by vaporizing method which measures the helium gas quantity vaporizing at the time of AC loss occurrence was designed and manufactured for the first time. The method of measuring the AC loss, the structure of the measuring equipment, the helium gas recovering part and the measuring part, the countermeasures for preventing helium gas leakage, the resistance heater for calibration, and the results of measurement are reported. (K.I.)

  6. AC loss of Bi-2212 superconducting ring for limiter

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Y.N.; Wang, J.X.; Li, J.H.; Zong, X.H.; Sun, J

    2003-04-15

    A wattmeter technique is used to measure alternating field loss in Bi-2212 superconducting ring as an element of inductive fault current limiter. Experiment is performed at 77 K. Measurement results show that AC loss P vs. amplitude of sweeping field P follows a power law, P{proportional_to}H{sup n}. When sweeping field is lower than H{sub p} we observe the cubic dependence as predicted by the Bean-London critical state model. With increasing field the exponent initially increases, reaches the maximum of 4 as predicted by the Kim-Anderson critical state model. When the field is higher than H{sub p} the exponent decrease to 1. But AC loss per cycle decreases with the increase of frequency of field when the field is high. This can be explained by heating effect of AC loss. Furthermore, we calculate the AC loss of a full-scale inductive superconductor fault current limiter based on our measurement result. We found that the AC loss of this device is acceptable.

  7. AC losses of the 5 m BSCCO cables with shield

    Science.gov (United States)

    Ryu, K.; Ma, Y. H.; Li, Z. Y.; Hwang, S. D.; Song, H. J.

    2010-11-01

    In order to research the AC loss characteristics of a multi-layered conductor and a shield in a high temperature superconductor (HTS) cable, we prepared two short cable samples, which are the same as the 22.9 kV/50 MVA HTS-cable installed at Gochang test yard of Korea Electric Power Corporation, and attached voltage-leads to both the conductor and the shield. To investigate the effect of transport period on their AC losses, we also applied current with the same magnitude and opposite direction to the conductor and the shield from a few cycles to several minutes. The tests show that the AC loss measured from the lead attached to the shield (shield-lead) is constant regardless of transport period. But the measured loss from the lead attached to the conductor (conductor-lead) is greatly dependent on transport period. It seems to be caused by difficulty in heat transfer to the surrounding coolant due to thick insulator around the conductor. As transport period becomes longer, the conductor's temperature rises and thus the AC loss measured from the conductor-lead increases. In addition, the measured loss from the conductor-lead is 1.5 times larger than that from the shield-lead, particularly for the transport period of a few cycles.

  8. Measured losses in superconductor magnets for 60-Hertz ac operation.

    Science.gov (United States)

    Hamlet, I. L.; Kilgore, R. A.

    1971-01-01

    Results of an experimental study of electrical losses in superconductor magnets. Preliminary 60-Hz ac loss data are presented for coils constructed of Nb3Sn ribbon, Nb-Ti cable, and multifilament Nb-Ti. Losses have been measured for different size coils up to approximately 20 cm in diameter. Of the conductor types tested, Nb3Sn ribbon has the lowest losses for ac operation. In Nb3Sn-ribbon coils of different sizes, the loss per unit length of conductor is shown to decrease with a decrease in the rate of change of current and to increase, in general, with increase in coil size. An important aspect of the study is the high degree of repeatability of the data.

  9. AC losses in circular arrangements of parallel superconducting tapes

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred

    1998-01-01

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  10. AC loss calculation of central solenoid model coil

    Energy Technology Data Exchange (ETDEWEB)

    Gilanyi, A. [Technical University of Budapest, Budapest (Hungary); Akiba, Masato; Okumura, Yoshikazu; Sugimoto, Makoto; Takahashi, Yoshikazu; Tsuji, Hiroshi

    1999-03-01

    The AC loss of Central Solenoid Model Coil of ITER is calculated in order to be able to determine the allowable excitation current shape in time with respect to the available cooling capacity at liquid helium temperature. In Part A the theory is summarized essential to present calculation. This covers a semianalytical integral formulation to calculate the magnetic field distribution in the cross-section of a coil and also 2D and 3D differential formulations for eddy current calculation of jackets and structural steel components, respectively. In Part B the conditions and results of calculation are described in detail. Losses are calculated separately in different components. Also the different types of losses are separated, and only one of the followings is considered in the same time; eddy current loss, ferromagnetic hysteresis loss, superconducting hysteresis loss, coupling loss. The followings are concluded. The coupling loss was found to be the largest 83% of the total AC loss supposing 50 msec characteristic time constant. Also significant amount of heat is generated in structural steels, cooling is required for stainless steel structural components. The loss of joints is not large, however concentrated, therefore joints should receive attention. Specially Lap-type joints are critical components. The eddy current and coupling power losses can be significantly decreased by increasing the ramp-up time since they are proportional to the square of flux change rate, while superconducting and ferromagnetic hysteresis power losses decrease linearly with decreasing flux change rate. Joule losses are produced in joints even after the energizing process of the magnet, when it is driven by a constant excitation current. This propose us to keep the time of full power operation short. (J.P.N.)

  11. Superconducting shielded core reactor with reduced AC losses

    Science.gov (United States)

    Cha, Yung S.; Hull, John R.

    2006-04-04

    A superconducting shielded core reactor (SSCR) operates as a passive device for limiting excessive AC current in a circuit operating at a high power level under a fault condition such as shorting. The SSCR includes a ferromagnetic core which may be either closed or open (with an air gap) and extends into and through a superconducting tube or superconducting rings arranged in a stacked array. First and second series connected copper coils each disposed about a portion of the iron core are connected to the circuit to be protected and are respectively wound inside and outside of the superconducting tube or rings. A large impedance is inserted into the circuit by the core when the shielding capability of the superconducting arrangement is exceeded by the applied magnetic field generated by the two coils under a fault condition to limit the AC current in the circuit. The proposed SSCR also affords reduced AC loss compared to conventional SSCRs under continuous normal operation.

  12. Measurement of AC losses in different former materials

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa

    1998-01-01

    A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...... candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible...

  13. Investigation and comparison of AC losses on stabilizer-free and copper stabilizer HTS tapes

    Science.gov (United States)

    Shen, Boyang; Li, Jing; Geng, Jianzhao; Fu, Lin; Zhang, Xiuchang; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Coombs, T. A.

    2017-10-01

    This paper presents the measurement and simulation of Alternating Current (AC) losses on the Stabilizer-free and Copper Stabilizer High Temperature Superconducting (HTS) Tapes: SuperPower SF12100 and SCS12050. The AC loss measurement utilised electrical method to obtain overall losses with AC transport currents. The 2D H-formulation by COMSOL Multiphysics has been used to simulate the real geometry and multi-layer HTS tapes. Ferromagnetic AC losses of substrate have been assumed to be ignored as the substrates of SF12100 and SCS12050 are non-magnetic. Hysteresis AC losses in the superconducting layer, and eddy-current AC losses in copper stabilizer, silver overlayer and substrate were concerned in this investigation. The measured AC losses were compared to the AC losses from simulation, with 3 cases of different AC frequency 10, 100, and 1000 Hz. The eddy-current AC losses of copper stabilizer at frequency 1000 Hz were determined from both experiment and simulation. The estimation of AC losses with frequency at 10,000 Hz was also carried out using simulation method. Finally, the frequency dependence of AC losses from Stabilizer-free Tape and Copper Stabilizer Tape were compared and analysed.

  14. AC loss properties of MgB{sub 2} multifilament wires

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Kazuhide; Funaki, Kazuo; Sueyoshi, Takahiro; Sasashige, Yushi; Kajikawa, Kazuhiro; Iwakuma, Masataka [Kyushu University Graduate School of Information Science and Electrical Engineering, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan); Okada, Michiya [HRL Hitachi, Ltd, 7-1-1 Oomika, Hitachi 319-1292 (Japan); Kumakura, Hiroaki [National Institute for Materials Science, 1-2-1 Sengen, Tsukuba 305-0047 (Japan); Hayashi, Hidemi [Kyushu Electric Power Co., Incorporated, 2-1-47 Shiobaru, Minami-ku, Fukuoka 815-8520 (Japan)], E-mail: kazuhide.tanaka.je@hitachi.com

    2008-09-15

    We designed and fabricated two types of composite wires with 6 MgB{sub 2} filaments. One is a Cu-sheathed Nb-barrier wire and the other is a CuNi-sheathed Ta-barrier wire. The transverse-field losses of the trial wires were measured with a standardized pickup coil system in liquid helium. We evaluated the observed AC losses using two structural models, a multifilament conductor model and a hollow-cylindrical one. For the CuNi-sheathed Ta-barrier wire, the AC loss property can be explained by the usual model of multifilament conductors. Further reductions in AC loss can be expected by making the filaments thinner. For the Cu-sheathed Nb-barrier wire, theoretical considerations suggest the multifilament structure behaves as a hollow-cylindrical superconductor in the AC loss property. Thus, we need to pay particular attention to designing the barrier material for reduction in the AC loss.

  15. Irregular AC loss in a large SMES coil; Ogata SMES koiru no fukisoku koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Hamajima, T.; Yoshida, M.; Shimamura, T.; Harada, N.; Tsuda, M. [Yamaguchi Univ., Yamaguchi (Japan); Hanai, S. [Toshiba Corp., Tokyo (Japan); Hirano, N. [Chubu Electric Power Co., Inc., Aichi (Japan); Sato, T. [National Inst. for Fusion Science, Nagoya (Japan)

    2000-05-29

    From the results of a series of tests on SMES model coil, it was confirmed that, in AC loss of large SMES wound with large current capacity cable in conduit (CIC) conductor, there was regular AC loss estimated from the short sample test results of conductor and irregular AC loss observed in a coil condition. Irregular AC loss was estimated being caused by many loops with long time constant between several seconds and about 100 seconds composed inside conductor. The analysis results on loss of each elementary wire in cable showed that number of loops was about 20,000 and there was an existing possibility of many loops. An average value of time constant spectrum was about 18 seconds and is a little shorter than of an average time constant 30 seconds obtained from frequency analysis of AC loss. The maximum value was 150 seconds, and indicated an existing possibility of time constant of about 100 seconds obtained by the test. (NEDO)

  16. Low ac loss geometries in YBCO coated conductors and impact on conductor stability

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.

  17. Analysis of AC loss in superconducting power devices calculated from short sample data

    NARCIS (Netherlands)

    Rabbers, J.J.; ten Haken, Bernard; ten Kate, Herman H.J.

    2003-01-01

    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile

  18. Measurement of AC losses in a racetrack superconducting coil made from YBCO coated conductor

    DEFF Research Database (Denmark)

    Seiler, Eugen; Abrahamsen, Asger Bech; Kovac, Jan

    2012-01-01

    to reinforce it. The AC loss is measured versus the transport current Ia with the coil immersed in liquid nitrogen. Measurements at frequencies 21 Hz, 36 Hz and 72 Hz are compared. The AC losses follow I2 a dependence at low current amplitudes and I3 a at high amplitudes. After cutting the inner steel frame...

  19. Measuring ac-loss in high temperature superconducting cable-conductors using four probe methods

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Olsen, Søren Krüger

    1999-01-01

    Measuring the ac-loss of superconducting cable conductors have many aspects in common with measuring the ac-loss of single superconducting tapes. In a cable conductor all tapes are connected to each other and to the test circuit through normal metal joints in each end. This makes such measurements...

  20. AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines

    DEFF Research Database (Denmark)

    Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan

    2016-01-01

    In transient operations or fault conditions, hightemperature superconducting (HTS) machines suffer ac losses, which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate ac losses and their thermal effect in HTS machines is presented....... The method consists of three submodels that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an ac loss model that has a homogeneous...... approximation and solves the H formulation. Afterward, the computed ac losses are considered as the heat source in a thermal model to study the temperature profile in HTS windings. The method proposed is able to evaluate ac losses and their thermal effect, thus providing a reference to design an HTS machine...

  1. Computations of AC Loss in the ITER Magnets during Fast Field Transients

    CERN Document Server

    Bottura, Luca; Lister, Jonathan B; Marinucci, Claudio; Portone, Alfredo

    2007-01-01

    The calculation of AC loss due to the control currents in ITER is a cumbersome task. The reason is that control transients require small field changes (0.1 T or less) at moderate frequency (up to 10 Hz), where effects of partial penetration of the filaments and shielding are important and need to be taken into account to produce sound AC loss estimates. In this paper we describe models developed for AC loss calculation, in particular hysteresis and coupling current loss, that are suitable for the above regime. Both hysteresis and coupling loss models are adapted to the conductor analyzed through few parameters (the effective filament diameter and time constants) that can be derived from measurement of loss on short samples. We report an example of calculations of AC loss in the ITER TF and PF coils for two vertical control scenarios (VS1 and VS2) during high beta operation at flattop.

  2. AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications

    Science.gov (United States)

    Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.

    2017-12-01

    This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.

  3. Calorimetric method of ac loss measurement in a rotating magnetic field.

    Science.gov (United States)

    Ghoshal, P K; Coombs, T A; Campbell, A M

    2010-07-01

    A method is described for calorimetric ac-loss measurements of high-T(c) superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  4. Numerical study on AC loss reduction of stacked HTS tapes by optimal design of flux diverter

    Science.gov (United States)

    Liu, Guole; Zhang, Guomin; Jing, Liwei; Yu, Hui

    2017-12-01

    High temperature superconducting (HTS) coils are key parts of many AC applications, such as generators, superconducting magnetic energy storage and transformers. AC loss reduction in HTS coils is essential for the commercialization of these HTS devices. Magnetic material is generally used as the flux diverter in an effort to reduce the AC loss in HTS coils. To achieve the greatest reduction in the AC loss of the coils, the flux diverter should be made of a material with low loss and high saturated magnetic density, and the optimization of the geometric size and location of the flux diverter is required. In this paper, we chose Ni-alloy as the flux diverter, which can be processed into a specific shape and size. The influence of the shape and location of the flux diverter on the AC loss characteristics of stacked (RE)BCO tapes is investigated by use of a finite element method. Taking both the AC loss of the (RE)BCO coils and the ferromagnetic loss of the flux diverter into account, the optimal geometry of the flux diverter is obtained. It is found that when the applied current is at half the value of the critical current, the total loss of the HTS stack with the optimal flux diverter is only 18% of the original loss of the HTS stack without the flux diverter. Besides, the effect of the flux diverter on the critical current of the (RE)BCO stack is investigated.

  5. Study on AC loss measurements of HTS power cable for standardizing

    Science.gov (United States)

    Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi

    2017-09-01

    High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..

  6. AC Losses and Their Thermal Effect in High Temperature Superconducting Machines

    DEFF Research Database (Denmark)

    Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan

    2015-01-01

    In transient operations or fault conditions, high temperature superconducting (HTS) machines suffer AC losses which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate AC losses and their thermal effect in HTS machines is presented....... The method consists of three sub-models that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an AC loss model which has...... an HTS machine and its cooling system....

  7. AC loss in superconducting wires operating in a wind turbine like generator

    DEFF Research Database (Denmark)

    Seiler, Eugen; Zirngibl, Thomas; Mijatovic, Nenad

    2010-01-01

    We have manufactured a small circular superconducting coil impregnated with epoxy fibreglass. The coil was wound from a Bi-2223/Ag superconducting wire and it was tested in liquid nitrogen at 77 K. Current-voltage characteristic and the AC losses of the coil were measured and compared with the me...... resulted in the same AC loss characteristic. This work was done as a part of the Superwind project which aims to build a series of test coils and a spinning model of a generator to investigate AC loss and stability of the coils in wind turbine like conditions....

  8. AC losses of LHD poloidal coils; LHD poroidaru koiru no koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Takahata, K.; Mito, T.; Sato, T.; Sato, S.; Motojima, O. [National Inst. for Fusion Science, Nagoya (Japan)

    1999-11-10

    The poloidal field coil of large helical device is forced cooling type coil using the cable back nine-conduit conductor. We carry out the stable operation in which LHD does excitation and demagnetization in morning and evening at present. Therefore, being bigger than the estimate, when the ac loss is evaluated from the coil exit refrigerant temperature, as that ac loss becomes a problem are excitation and demagnetization, is clarifying. We specially carried out the energization test for measuring the ac loss in order to grasp this cause, this time. And, we tried the information collection on time constant by observing time change of outlet temperature. (NEDO)

  9. Basic AC loss properties of IBAD/CVD-YBCO tapes for pancake-type coils

    Energy Technology Data Exchange (ETDEWEB)

    Funaki, K. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan)], E-mail: funaki@sc.kyushu-u.ac.jp; Sueyoshi, T.; Iwakuma, M. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan); Shikimachi, K.; Hirano, N.; Nagaya, S. [Chubu Electric Power Co., Inc., 20-1 Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan)

    2008-09-15

    We are experimentally studying basic AC loss properties of IBAD/CVD-YBCO coated conductors with a copper layer for stabilizing, especially the temperature dependence of perpendicular field loss in alternating electromagnetic environments. We prepared two types of short specimens with and without a copper layer and measured AC losses by a saddle-shaped pickup coil in an alternating magnetic field perpendicular to the wide surfaces at liquid helium temperature. In the ranges of the amplitude up to 4 T and the frequency up to 0.2 Hz, the AC losses both of the two specimens are hardly dependent upon the frequency. The results show that hysteresis loss is a major component of the AC loss in the specimens and the effects of the copper layer can be negligible. We also measured AC losses for the specimens with the copper layer at liquid nitrogen temperature to estimate the dependence on measurement temperature. The results suggested that the AC loss vs. the amplitude of applied field can be scaled by a critical current at a zero magnetic field.

  10. Calculation of AC losses in large HTS stacks and coils

    DEFF Research Database (Denmark)

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad

    2012-01-01

    In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting and su...

  11. DC performance and AC loss of cable-in-conduit conductors for International Thermonuclear Experimental Reactor

    National Research Council Canada - National Science Library

    Zhou, Wei; Fang, Xin-Yu; Fang, Jin; Liu, Bo

    2016-01-01

    ...) cable-in-conduit conductors(CICCs);however,the calculation of AC loss of ITER CICCs is a cumbersome task due to the complicated geometry of the multistage cables and the extreme operating conditions...

  12. Measurement of AC Loss and Magnetic Field during Ramps in the LHC Model Dipoles

    CERN Document Server

    Ang, Z; Bottura, L; Richter, D; Sheehan, M; Walckiers, L; Wolf, R

    1998-01-01

    We describe the systems for AC loss and magnetic field measurements developed for the LHC superconducting magnets. AC loss measurements are performed using an electric method, while field measurements are performed using either fixed pick-ups or rotating coils. We present results obtained on 1-m long model dipoles, and compare the results of the different methods in terms of average inter-strand resistance and low order field harmonics.

  13. An engineering formula to describe the AC loss of BSCCO/Ag tape

    NARCIS (Netherlands)

    Rabbers, J.J.; ten Haken, Bernard; Chevtchenko, O.A.; ten Kate, Herman H.J.

    2001-01-01

    An engineering function to describe the AC loss of BSCCO/Ag tape conductors is developed. For a wide range of transport currents and magnetic fields (with different orientation) the loss is described with an uncertainty of 10%. The equation is based on the analytical expressions available, BSCCO/Ag

  14. Ac loss measurements on a superconducting transformer for a 25 kA superconducting rectifier

    NARCIS (Netherlands)

    ten Kate, Herman H.J.; Mulders, J.M.; de Reuver, J.L.; van de Klundert, L.J.M.

    1984-01-01

    Ac loss measurements have been performed on a superconducting transformer. The transformer is a part of a 25 kA thermally switched superconducting rectifier operating at a frequency of 0.1 Hz. The loss measurements have been automatized by means of a microcomputer sampling four relevant signals and

  15. AC losses in Bi2212 ROSAT wires exposed to an AC magnetic field(2); Bi2212 ROSAT senzai no koryu sonshitsu (2)

    Energy Technology Data Exchange (ETDEWEB)

    Fukuda, Y.; Matsumura, K.; Kajikawa, K.; Iwakuma, M.; Funaki, K. [Kyushu Univ., Fukuoka (Japan); Okada, M. [Hitachi Ltd., Tokyo (Japan)

    1999-11-10

    The wire rod the anisotropy is big for the Bi system superconductor, and it is processed in order to level the orientation of the superconductive crystal, thin tapelike. Therefore, wire rod itself of the rectangular cross section also has the anisotropy for critical current and ac loss characteristics. This time, the base metal was alloyed, and the ac loss was measured on improvement of mechanical strength and Bi2212ROSAT wire rod with the aim of making into low-loss, and it was compared and was examined with the ac loss of theoretical value and pure silver base metal ROSAT wire rod. (NEDO)

  16. AC losses of high T{sub c} superconducting coils; Koon chodendo koiru no koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Yokoyama, S.; Fukuda, M.; Kawagoe, A.; Sumiyoshi, F. [Kagoshima Univ., Kagoshima (Japan); Hayashi, H.; Irie, F. [Kyushu Electric Power Co., Inc., Fukuoka (Japan)

    2000-05-29

    High temperature superconductive coil expected for future application to electric power equipment has a defect of large AC loss that is a large obstacle for future practicalization. In this study, 13 double pancake coils were experimentally manufactured using Bi-2223 multicore tape wire, and their AC loss characteristics in liquid nitrogen were evaluated. In loss measurement, sample coils were placed in liquid nitrogen, and pure loss components contained in voltage between terminals were detected by lock-in amplifier. Loss characteristics of 3 coils tested all had strong frequency dependency. Though characteristic curve of overcurrent loss of silver which was normal conductive in low current region was conspicuously observed, their absolute values and critical frequency were different depending on coil. (NEDO)

  17. Ripple Field AC Losses in 10-MW Wind Turbine Generators With a MgB2 Superconducting Field Winding

    DEFF Research Database (Denmark)

    Liu, Dong; Polinder, Henk; Magnusson, Niklas

    2016-01-01

    and an excessive cooling budget. To determine the applicability of different design solutions in terms of ac losses, this paper estimates the ac loss level of 10-MW wind generator designs employing a MgB2 SC field winding. The effects on ac losses are compared between nonmagnetic and ferromagnetic teeth...... with different numbers of slots per pole per phase. The necessity of an electromagnetic shield is then discussed based on the obtained loss levels. The results show that the total ac loss is so small that ferromagnetic teeth can be applied in the generator design without using an electromagnetic shield....

  18. AC losses in superconductors with a power-law constitutive relation

    Energy Technology Data Exchange (ETDEWEB)

    Agassi, Y.D., E-mail: yehoshua.agassi@navy.mil

    2015-10-15

    Highlights: • Derivation of power-law constitutive-relation from distributed Anderson–Kim theory. • The electric-field for HTS constitutive-relation satisfies nonlinear heat-equation. • For slab, AC losses scale as B{sub 0}{sup m}, m = 3–4 and I{sup 3} with field-amplitude and current, respectively. • Calculated pinning potential, AC-losses scaling is consistent with BSCCO data. - Abstract: The observed constitutive relation between the electrical field and current density in cuprates high temperature superconductors is a power-law of the current. This functional dependence is presumably related to the giant flux-creep domain. It is shown that this constitutive relation reflects the statistical spread of the pinning potential associated with creep motion of vortex bundles. The AC losses emanating from a power-law constitutive relation are calculated in an approach focused on the superconductor’s electric field. For a slab geometry in the presence of a parallel AC magnetic field or transport current, the calculated AC-loss scaling laws are consistent with BSCCO data and the critical state model. Extensions of the approach are briefly discussed.

  19. AC Loss Analysis of MgB2-Based Fully Superconducting Machines

    Science.gov (United States)

    Feddersen, M.; Haran, K. S.; Berg, F.

    2017-12-01

    Superconducting electric machines have shown potential for significant increase in power density, making them attractive for size and weight sensitive applications such as offshore wind generation, marine propulsion, and hybrid-electric aircraft propulsion. Superconductors exhibit no loss under dc conditions, though ac current and field produce considerable losses due to hysteresis, eddy currents, and coupling mechanisms. For this reason, many present machines are designed to be partially superconducting, meaning that the dc field components are superconducting while the ac armature coils are conventional conductors. Fully superconducting designs can provide increases in power density with significantly higher armature current; however, a good estimate of ac losses is required to determine the feasibility under the machines intended operating conditions. This paper aims to characterize the expected losses in a fully superconducting machine targeted towards aircraft, based on an actively-shielded, partially superconducting machine from prior work. Various factors are examined such as magnet strength, operating frequency, and machine load to produce a model for the loss in the superconducting components of the machine. This model is then used to optimize the design of the machine for minimal ac loss while maximizing power density. Important observations from the study are discussed.

  20. Influences of surface barrier on AC loss in Ag-Bi2223 tapes by simulation

    Science.gov (United States)

    Liu, G. H.; Zhang, L.; Li, Y. B.; Yu, J. Y.; Deng, Y.; Tang, Z.; Ding, S. Y.

    2013-12-01

    Influences of surface barrier in Ag-Bi2223 tapes on AC loss are studied. The Ag-Bi2223 tape is described by a surface region (near to the silver) and a bulk region, which are depicted by different critical current densities jcs and jcb, respectively. Simulations using the flux creep model indicate that with surface barrier increasing, a kink then a dip appear in the AC loss and the peak and dip positions move to higher magnetic fields. The results can be used as an effective method to qualitatively estimate the surface barrier strength.

  1. AC-loss properties of Bi-2223 multifilamentary taped wires with a central insulation layer

    Energy Technology Data Exchange (ETDEWEB)

    Funaki, K., E-mail: funaki@sc.kyushu-u.ac.jp [Kyushu University, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan); Nogami, K.; Kawasaki, M.; Iwakuma, M. [Kyushu University, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan); Ayai, N.; Kobayashi, S.; Kikuchi, M.; Hayashi, K. [Sumitomo Electric Industries Ltd., 1-1-3, Shimaya, Konohana-ku, Osaka 554-0024 (Japan)

    2011-11-15

    We develop twisted Bi-2223 multifilamentary taped wires with a central insulator layer. We measure the AC losses in a perpendicular magnetic field configuration. The coupling loss will be decreased by effects of twisting and the central insulator layer. The hysteresis loss in filaments will be also decreased by effects of twisting. Further efforts will be expected for increase in the current capacity. We have been developing twisted Bi-2223 multifilamentary taped wires to suppress the AC losses in perpendicular-field configuration for industrial-production process. It is confirmed that the hysteretic losses in the filamentary region can be reduced by twisting in a same manner as in situ Nb{sub 3}Sn multifilamentary ones, while the coupling loss remains in unsatisfactory situation for commercial frequency uses. As one of practical methods for further reduction of the coupling loss, we propose an advanced multifilamentary structure of the taped wires in which an insulation layer is arranged in the central region of the tape to effectively restrict the main part of the coupling current in the perpendicular-field configuration instead of an insulation barrier around each filament that may be not usually suitable to the practical production process. We have designed and fabricated prototype wires with the proposed structure, and measured the AC loss properties in the perpendicular-field configuration. The experimental results suggest that the central insulation barrier has a function to suppress the coupling loss remarkably. We also discuss improvement in the structural design for the further reduction of the AC losses.

  2. First resultst of AC loss test on ITER TF conductors with transverse load cycling

    NARCIS (Netherlands)

    Miyoshi, Y.; Rolando, G.; Nijhuis, Arend; Vostner, A.; Nabara, Y.

    2012-01-01

    The influence of the expected Lorentz loading and time dependent operating conditions of a magnet on the conductor AC loss is experimentally simulated by a cryogenic cable press that applies cyclic mechanical loading. A series of ITER conductor tests with the press have commenced and we report on

  3. Development of an automatic measurement for ac losses in superconductors; Jido koryu sonshitsu sokutei sochi no kaihatsu (5)

    Energy Technology Data Exchange (ETDEWEB)

    Tsumura, K.; Tanaka, H.; Kajikawa, K.; Iwakuma, M.; Funaki, K. [Kyushu Univ., Fukuoka (Japan)

    2000-05-29

    An automatic measuring equipment for AC loss which was an important factor of superconducting conductor and winding was developed, and was already successfully tested on measurement of AC loss of superconducting winding. In this study, AC loss of 1000 kVA-22 kV/ 6.9 kV oxide superconducting transformer was electrically measured using this equipment. The primary side of transformer was short cut, 60 Hz current was applied from the secondary side winding, and AC loss of the both windings was obtained from secondary voltage and primary current. In order to detect loss components accurately, canceling treatment of induced components is necessary. For automation of canceling, an automatic canceling circuit was manufactured using photo-MOS relay as a switching element capable of electronic control. AC loss could be measured with this equipment even if power ratio was small. (NEDO)

  4. Measuring ac losses in superconducting cables using a resonant circuit:Resonant current experiment (RESCUE)

    DEFF Research Database (Denmark)

    Däumling, Manfred; Olsen, Søren Krüger; Rasmussen, Carsten

    1998-01-01

    A simple way to obtain true ac losses with a resonant circuit containing a superconductor, using the decay of the circuit current, is described. For the measurement a capacitor is short circuited with a superconducting cable. Energy in the circuit is provided by either charging up the capacitors...... the superconductor. The method has been successfully applied for the measurement of the ac loss in a 1 m long superconducting cable model....... be recorded using, for example, a digital oscilloscope. The amplitude decay of the periodic voltage or current accurately reflects the power loss in the system. It consists of two components-an ohmic purely exponential one (from leads, contacts, etc.), and a nonexponential component originating from...

  5. AC loss measurements of model and full size 50mm SSC collider dipole magnets at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Ozelis, J.P.; Delchamps, S.W.; Gourlay, S.; Jaffery, T.; Kinney, W.; Koska, W.; Kuchnir, M.; Lamm, M.J.; Mazur, P.O.; Orris, D.; Strait, J.; Wake, M. [Fermi National Accelerator Lab., Batavia, IL (United States); Dimarco, J.; Kuzminski, J.; Zheng, H. [Superconducting Super Collider Lab., Dallas, TX (United States)

    1992-09-01

    Tests have recently been performed at Fermilab in order to measure the energy losses due to eddy currents and iron and superconductor magnetization. These measurements were performed on six 1.5m long model magnets and eight 15m long full scale collider dipole magnets. AC losses were measured as a function of ramp rate using sawtooth ramps from 500, to 5000 Amps for both types of magnets, while bipolar studies were additionally performed on some of the short magnets. The measured magnet voltage and current for a complete cycle are digitally integrated to yield the energy loss per cycle. Measurement reproducibility is typically 5%, with good agreement between long magnet measurements and extrapolations from short magnet measurement results. Magnetization loss measurements among similar magnet types agree to within experimental error, while eddy current losses correlate strongly with the observed dependence of quench current on ramp rate.

  6. The Effect of Temperature Dependence of AC Losses in a Bi-2223/Ag Insert of an 8-T Superconducting Magnet

    DEFF Research Database (Denmark)

    Wang, Lei; Wang, Qiuliang; Wang, Hui

    2016-01-01

    -temperature superconducting tape, there will be large ac losses when the magnet is ramped up and down. An accurate estimation of the total ac losses in the high-temperature superconducting coils is essential for the cryogenic system design. In the Bi-2223/Ag coils, the total ac losses mainly originate from two parts: One......A conduction-cooled split-gap superconducting magnet system with a center field of 8 T has been designed and fabricated in the Institute of Electrical Engineering, Chinese Academy of Sciences. The system consists of two Bi-2223/Ag coils and six NbTi coils. Due to a large aspect ratio of the high...... is transport loss caused by the variation of transport current with respect to time, and the other is magnetization loss due to alternating external magnetic field. In this paper, the effect of temperature variation on ac losses generated in the Bi-2223/Ag coils is studied. The magnetic field and temperature...

  7. Low AC Loss in a 3 kA HTS Cable of the Dutch Project

    DEFF Research Database (Denmark)

    Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan

    2012-01-01

    in the cable, potentially affecting public acceptance of the project. A way out would be to substantially reduce AC losses from 1 down to about 0.1W/m per phase at rated current of 3 kArms, frequency of 50Hz and temperature of 77K. In this paper we discuss a strategy towards this ambitious goal, a concept......Requirements for a 6km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop...... design of the single phase cable 3 kA conductor made of YBCO tapes and present corresponding experimental and simulation data supporting the developed approach leading directly to this goal. HTS cable model was made that show a drastically reduced AC loss. The low loss was achieved by using appropriate...

  8. Evaluation of Core Loss in Magnetic Materials Employed in Utility Grid AC Filters

    DEFF Research Database (Denmark)

    Beres, Remus Narcis; Wang, Xiongfei; Blaabjerg, Frede

    2016-01-01

    in the core, depending on the magnetic material of choice and current ripple specifications. Additionally, shunt or series reactors that exists in LCL or trap filters and which are subjected to sinusoidal excitations have different specifications and requirements. Therefore, the core losses of different...... magnetic materials adopted in utility grid ac filters have been investigated and measured for both sinusoidal and rectangular excitation, with and without dc bias condition. The core loss information can ensure cost effective passive filter designs and may avoid trial-error design procedures of the passive...

  9. Ac45 silencing mediated by AAV-sh-Ac45-RNAi prevents both bone loss and inflammation caused by periodontitis.

    Science.gov (United States)

    Zhu, Zheng; Chen, Wei; Hao, Liang; Zhu, Guochun; Lu, Yun; Li, Sheng; Wang, Lin; Li, Yi-Ping

    2015-07-01

    Periodontitis induced by oral pathogens leads to severe periodontal tissue damage and osteoclast-mediated bone resorption caused by inflammation. On the basis of the importance of Ac45 in osteoclast formation and function, we performed this study to evaluate the therapeutic potential of periodontitis by local adeno-associated virus (AAV)-mediated Ac45 gene knockdown. We used AAV-mediated short hairpin RNAi knockdown of Ac45 gene expression (AAV-sh-Ac45) to inhibit bone erosion and gingival inflammation simultaneously in a well-established periodontitis mouse model induced by Porphyromonas gingivalis W50. Histological studies were performed to evaluate the bone protection of AAV-sh-Ac45. Immunochemistry, ELISA and qRT-PCR were performed to reveal the role of Ac45 knockdown on inflammation, immune response and expression of cytokine. We found that Ac45 knockdown impaired osteoclast-mediated extracellular acidification and bone resorption in vitro and in vivo. Furthermore, local administration of AAV-sh-Ac45 protected mice from bone erosion by >85% and attenuated inflammation and decreased infiltration of T cells, dendritic cells and macrophages in the periodontal lesion. Notably, the expression of pro-inflammatory cytokines was also reduced. Local AAV-sh-Ac45 gene therapy efficiently protects against periodontal tissue damage and bone erosion through both inhibition of osteoclast function and attenuating inflammation, and may represent a powerful new treatment strategy for periodontitis. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  10. Sensitivity Analysis of Core Damage by Loss of Auxiliary Feed Water during the Extended Loss of All AC Power

    Energy Technology Data Exchange (ETDEWEB)

    Jeon, Woo Jae; Chung, Soon Il; Hwang, Su Hyun; Lee, Kyung Jin; Lee, Byung Chul [FNC Tech., Yongin (Korea, Republic of); Yun, Duk Joo; Lee, Seung Chan [Korea Hydro and Nuclear Power Co. Ltd., Daejeon (Korea, Republic of)

    2015-10-15

    In this study, the reactor core damage time for OPR1000 type Nuclear Power Plant (NPP) was analyzed to develop a strategy to handle ELAP and to apply to the EOP. The reactor core damage time in the ELAP condition was calculated according to the time of Auxiliary Feedwater (AFW) loss. Fukushima accident was caused by long hours of Station Black Out (SBO) caused by natural disaster beyond Design Based Accident (DBA) criteria. It led to the reactor core damage. After the accident, the regulatory authorities of each country (Japan, US, EU, IAEA, and etc.) recommended developing the necessary systems and strategies in order to cover up the Extended Loss of All AC Power (ELAP) such as one occurred in the Fukushima accident. And the need of procedure or guideline to cope with ELAP has been raised through the stress test for Wolsong Nuclear Power Plant unit 1. Current Emergency Operating Procedures (EOP) used in domestic nuclear power plant are seemed to be insufficient to cope with ELAP. Therefore, it has been required to be improved. As the result, the time of AFW loss in the ELAP condition influences greatly on core damage time.

  11. Development of a laser scribing process of coated conductors for the reduction of AC losses

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki, K [Superconductivity Research Laboratory, ISTEC, Division of Superconducting Tapes and Wires, 1-10-13 Shinonome, Koto-ku, Tokyo 135-0062 (Japan); Matsuda, J [Superconductivity Research Laboratory, ISTEC, Division of Superconducting Tapes and Wires, 1-10-13 Shinonome, Koto-ku, Tokyo 135-0062 (Japan); Yoshizumi, M [Superconductivity Research Laboratory, ISTEC, Division of Superconducting Tapes and Wires, 1-10-13 Shinonome, Koto-ku, Tokyo 135-0062 (Japan); Izumi, T [Superconductivity Research Laboratory, ISTEC, Division of Superconducting Tapes and Wires, 1-10-13 Shinonome, Koto-ku, Tokyo 135-0062 (Japan); Shiohara, Y [Superconductivity Research Laboratory, ISTEC, Division of Superconducting Tapes and Wires, 1-10-13 Shinonome, Koto-ku, Tokyo 135-0062 (Japan); Iwakuma, M [Research Institute of Superconductor Science and Systems, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Ibi, A [Superconductivity Research Laboratory, ISTEC, Nagoya Coated Conductor Center, 2-4-1 Mutsuno, Atsuta-ku, Nagoya, Aichi 456-8587 (Japan); Miyata, S [Superconductivity Research Laboratory, ISTEC, Nagoya Coated Conductor Center, 2-4-1 Mutsuno, Atsuta-ku, Nagoya, Aichi 456-8587 (Japan); Yamada, Y [Superconductivity Research Laboratory, ISTEC, Nagoya Coated Conductor Center, 2-4-1 Mutsuno, Atsuta-ku, Nagoya, Aichi 456-8587 (Japan)

    2007-08-15

    Expectations are high for using coated conductors for electric power applications not only because of better cost performance but also higher J{sub c}-B properties compared with Bi{sub 2}Sr{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10} (BSCCO) tapes. Furthermore, the coated conductors could also reduce AC losses by the use of various methods in post-treatment. When a YAG laser was used for scribing the superconductive layer, an AC loss reduction due to a decrease in the width of the superconductivity layer could be confirmed in short samples. In the case of AC applications using long tapes, high resistance between scribed filaments is necessary. However, the resistance between the filaments scribed by a laser was as low as 10{sup -3} {omega} cm{sup -1}. The reason for the low resistance was the existence of dross in the filament spacings, which was confirmed by a cross-sectional compositional mapping observation. Although the superconductivity layer was divided by the laser, the dross of the metal substrate made a bridge over the superconductivity filaments. Post-annealing in an O{sub 2} atmosphere to oxidize the dross was carried out in order to increase the resistance. Consequently, the resistance between the filaments was improved to be as high as 50 {omega} cm{sup -1}. We succeeded in controlling the resistance value between filaments in a range five orders of magnitude higher than that of the as-scribed YBCO film, through oxygen atmosphere post-annealing.

  12. AC losses in parallel conductors (4). Frequency dependence; Chodendo heiretsu dotai ni okeru koryu sonshitsu (4). shuhasu izonsei

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, H.; Nagasawa, M.; Kajikawa, K. [and others

    1999-11-10

    As a constitution method of superconductive conductor for large current capacity oxide alternating current, which moves at liquid nitrogen temperature, we proposed that it constitutes the parallel conductor using tapelike polycore line with rectangular cross section and conducts the transposition as well as the normal conduction equipment on the way of the winding process. In the report by last time, it was shown that the ac loss density was kept to the wire level by conducting the transposition in the optimum position. And, it was confirmed that that the frequency in which the additive ac loss with the slippage of the transposition position takes the peak changes was possible by the change of attenuation time constant {tau} which is decided by overall length L of the parallel conductor and contact resistance R of the double end. This time, frequency characteristics of the additive ac loss were examined more and more well informed. (NEDO)

  13. Analytical model for frequency dependent AC transport current loss of YBCO conductor; YBCO hakumaku dotai no koryu tsuden sonshitsu shuhasu izonsei kaiseki moderu

    Energy Technology Data Exchange (ETDEWEB)

    Miyagi, D.; Tsukamoto, O. [Yokohama National University, Kanagawa (Japan)

    2000-05-29

    YBCO film with thickness of about 1 {mu}m on LaAlO{sub 3} single crystal substrate was grown and AC transport current loss was measured over 30-960 Hz. As the result, AC loss showed frequency dependence and Norris model could not explain this fact. Model in which normal conductive zone with cross section of 21 % was formed in outermost layer of wire, could explain frequency dependence of AC loss. (NEDO)

  14. AC loss characteristics of HTS tapes and their operating electromagnetic conditions; Koon chodendo tepu senzai no koryu sonshitsu tokusei to unten denji joken

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, N. [Yokohama National Univ., Yokohama (Japan)

    2000-05-25

    AC losses in multifilamentary HTS tapes can be classified into hysteresis loss, coupling loss, and eddy current loss from the viewpoint of their generation mechanism. Operating electromagnetic conditions significantly influence their AC loss characteristics. From the viewpoint of the major magnetic field component generating them, they can be classified into magnetization loss, transport loss, and total loss. Dividing a superconductor into fine filaments, twisting the filament bundle and increasing transverse resistivity effectively reduce magnetization loss and total loss when the external magnetic field is relatively large, while they do not effectively reduce transport loss. General analytical expressions for the total loss in HTS tapes carrying AC current in an AC magnetic field have not been derived. Numerical electromagnetic field analysis based on the finite element method is a powerful tool to study total loss theoretically. In the magnetic field parallel to the tape's wide face, twisting can reduce the AC loss in Bi2223 tapes with pure silver matrix, while increasing transverse resistivity is required essentially for the AC loss reduction in a perpendicular magnetic field. Recently, twisted multifilamentary Bi2223 tapes with pure silver matrix were fabricated, and the reduction of magnetization loss was proved experimentally in a parallel magnetic field. Furthermore, transverse resistivity was increased successfully by the introduction of a resistive barrier between filaments. (author)

  15. Applicability of simple method in AC loss measurement 1; Kan'i sokutei ho ni yoru koryu sonshitsu sokutei no kakuchosei (1)

    Energy Technology Data Exchange (ETDEWEB)

    Kawasaki, K.; Takenaka, A.; Kajikawa, K.; Iwakuma, M.; Funaki, K. [Kyushu University, Fukuoka (Japan)

    1999-11-10

    In our research group, summary measuring method is proposed as measuring method of ac loss under various and electromagnetic environments of the superconducting wire material. This measuring method measures ac loss by making sample wire rod to be sample coil of the bilayer non-induction, and processing the signal from voltage terminal installed in the double end. Magnetization loss and energization loss by the simultaneous sweep of AC and alternating current transverse field using this measuring method without phase difference by Bi-2223 silver sheath wire rod this time were measured. And, magnetization loss and dynamic ohmic loss by galvanization and alternating current transverse field impression were measured. (NEDO)

  16. Loss of ACS7 confers abiotic stress tolerance by modulating ABA sensitivity and accumulation in Arabidopsis.

    Science.gov (United States)

    Dong, Hui; Zhen, Zhiqin; Peng, Jinying; Chang, Li; Gong, Qingqiu; Wang, Ning Ning

    2011-10-01

    The phytohormones ethylene and abscisic acid (ABA) play essential roles in the abiotic stress adaptation of plants, with both cross-talk of ethylene signalling and ABA biosynthesis and signalling reported. Any reciprocal effects on each other's biosynthesis, however, remain elusive. ACC synthase (ACS) acts as the key enzyme in ethylene biosynthesis. A pilot study on changes in ACS promoter activities in response to abiotic stresses revealed the unique involvement in abiotic stress responses of the only type 3 ACC synthase, ACS7, among all nine ACSs of Arabidopsis. Hence an acs7 mutant was characterized and its abiotic stress responses were analysed. The acs7 mutant germinated slightly faster than the wild type and subsequently maintained a higher growth rate at the vegetative growth stage. Ethylene emission of acs7 was merely one-third of that of the wild type. acs7 exhibited enhanced tolerance to salt, osmotic, and heat stresses. Furthermore, acs7 seeds were hypersensitive to both ABA and glucose during germination. Transcript analyses revealed that acs7 had elevated transcript levels of the stress-responsive genes involved in the ABA-dependent pathway under salt stress. The ABA level was also higher in acs7 following salt treatment. Our data suggest that ACS7 acts as a negative regulator of ABA sensitivity and accumulation under stress and appears as a node in the cross-talk between ethylene and ABA.

  17. Core-suppressed AC loss and strand-moderated contact resistance in a Nb-Sn Rutherford cable

    NARCIS (Netherlands)

    Sumption, M.D.; Collings, E.W.; Scanlan, R.M.; Nijhuis, Arend; ten Kate, Herman H.J.

    1999-01-01

    Calorimetric measurements of AC loss and hence interstrand contact resistance (ICR), have been performed on two types of Rutherford cable wound with unplated Nb3Sn strand. One of the cable types was furnished with a thin core of AISI 316L stainless steel and the other was left uncored. The cables

  18. AC losses of oxide superconducting coils operated in liquid nitrogen; Ekitai chisso reikyaku sankabutsu chodendo koiru no koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Fukushige, K.; Hayashida, T.; Sumiyoshi, F.; Kawabata, S. [Kagoshima Univ., Kagoshima (Japan); Hayashi, H. [Kyushu Electric Power Co., Inc., Fukuoka (Japan)

    1999-06-07

    As a basic research with the aim of practical application of the liquid nitrogen cooling oxide superconductivity coil, the double pancake-shape coil was produced experimentally using Bi system polycore tape wire rod, and the characteristic evaluation was carried out. Especially, it tried to examine the measured value of ac loss in the coil energization using analytical result of magnetic field distribution which is added to coil winding and magnetization loss data of the short length sample. (NEDO)

  19. AC losses in Bi2212 ROSAT wires exposed to an AC magnetic field (1); Bi2212 ROSAT senzai no koryu sonshitsu (1)

    Energy Technology Data Exchange (ETDEWEB)

    Matsumura, K.; Fukuda, Y.; Kajikawa, K.; Iwakuma, M.; Funaki, K. [Kyushu Univ., Fukuoka (Japan); Okada, M. [Hitachi Ltd., Tokyo (Japan)

    1999-11-10

    Bismuth system superconducting wire rod developed until now has been limited tapeline physical property the. However, the ROSAT wire rod in which tape wire rod had rotational symmetry of 3 times in the cross section of the round line recently was developed. The critical current density which is almost equivalent to tape wire rod in 4.2K and 28T by the homogenization of cross-sectional shape has been realized this ROSAT wire rod. This time, the ac loss in outside fluctuation magnetic field of superscription ROSAT wire rod was measured, and it was compared with the theoretical value, which deduced the ideal polycore line by assuming. (NEDO)

  20. Interstrand and AC-loss measurements on Rutherford-type cables for accelerator magnet applications

    CERN Document Server

    Otmani, R; Tixador, P

    2001-01-01

    One of the main issues for particle accelerator magnets is the control of interstrand resistances. Too low resistances result in large coupling currents during ramping, which distort field quality, while too large resistances may prevent current redistribution among cable strands, resulting in degraded quench performance. In this paper, we review a series of interstrand resistance and AC-loss measurements performed on four Rutherford-type cables. The four cables have the same number of strands and similar outer dimensions, corresponding to LHC quadrupole cable specifications. The first cable is made from NbTi strands, coated with silver-tin alloy, the second one is made from bare Nb/sub 3/Sn strands, the third one is made also from bare Nb/sub 3/Sn strands but includes a 25- mu m-thick stainless steel core between the strand layers, and the last one is made from Nb/sub 3/Sn strands plated with chromium. To cross-check the two measurement types and assess their consistency, we compare the coupling-current time...

  1. Behavior and Response Capability of CANDU 6 NPP during Extended Loss of All AC Power

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Kyung Jin; Oh, Seo Bin; Hwang, Su Hyun [FNC Technology Co., Yongin (Korea, Republic of); Yoon, Duck Joo; Lee, Seung Chan [Korea Hydro and Nuclear Power Co., Daejeon (Korea, Republic of)

    2016-10-15

    The purpose of this study is to identify the behavior and response capacity of the CANDU 6 plant during ELAP such as the one occurred in the Fukushima accident. The analysis was performed with CATHENA, which is an Industry Standard Toolset (IST) to simulate thermal-hydraulic phenomena in pressurized heavy water reactor. The disasters brought the long-term Station Black-out (SBO). For these lessons of the Fukushima nuclear accident, the US and, European governments, IAEA and other regulatory agencies around the world have recommended followup measures to build and develop a strategy to cope with the Extended Loss of All AC Power (ELAP). The analysis was performed to estimate behavior and response of CANDU 6 plant during ELAP condition such as the one occurred during the Fukushima accident. Without the operator action during ELAP, the fuel cladding and pressure tubes are damaged within 2 hours. However, if the operator acts appropriately with several available measures, the plant cooling could be maintained without core damage.

  2. Development of the automatic measurement system for ac losses in superconductors; Jido koryu sonshitsu sokutei sochi no kaihatsu (4)

    Energy Technology Data Exchange (ETDEWEB)

    Tsumura, K.; Kajikawa, K.; Iwakuma, M.; Funaki, K. [Kyushu University, Fukuoka (Japan)

    1999-11-10

    The rapid extension of the application field of the superconductive technology is expected by the discovery of the oxide superconductor. Though research and development for the sake is carried out in many research institute, it is quick in order to attempt the efficiency improvement of that research, and it is necessary to develop the equipment which can be evaluated simply and high-precise in respect of characteristics of the superconductive conductor. In this study, by putting the marketing in the future in visual field, it aims even in the characteristic inside of the superconductive conductor at the development of automatic alternating current measuring device of the important ac loss. And, it is possible that this equipment also carries out not only wire rod but also loss measurement of coil winding. Ac loss measurement of superconductive pulse coil of refrigerating machine direct cooling system was carried out using this measuring device this time. (NEDO)

  3. Consideration on AC loss evaluation of oxide superconducting wires (1); Sankabutsu chodendo senzai no koryu sonshitsu hyokaho ni kansuru kosatsu

    Energy Technology Data Exchange (ETDEWEB)

    Fujita, H.; Terasawa, Y.; Kajikawa, K.; Iwakuma, M.; Funaki, K. [Kyushu Univ., Fukuoka (Japan)

    2000-05-29

    In the oxide superconducting wire rod, the gradient of the E-J characteristics compares it with metal system superconducting wire rod, and in the gentle sake, the evaluation of the ac loss using critical current may contain large error. And, it is also possible E-J characteristics n value model numerical calculation loss. It needs the considerable labor in this case for the calculation. It evaluated this junction current numerically under various conditions this time, and it tried the formulation of the junction current. And, it also did the prediction of the energization loss using got evaluation system. (NEDO)

  4. AC current loss of meander-shaped QMG current limiting device; Mianda jo QMG genryu soshi no koryu tsuden sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Otabe, S.; Endo, T. [Kyushu Inst. of Tech, Fukuoka (Japan); Matsushita, T. [Kyushu Inst. of Tech, Fukuoka (Japan); Kyushu Univ., Fukuoka (Japan); Morita, M. [Nippon Steel Co., Ltd., Tokyo (Japan)

    2000-05-29

    It examines that it is applied to the resistive superconductivity current limiter, because Y-123 bulk superconductor produced by the QMG method has the high specific resistance. It examined energization characteristics of the QMG method Y-123 bulk superconductor current-limiting element made into the lengthen by choosing the meander shape until now, by the pulse method. The evaluation of the ac loss in energizing for practical use in respect of steady AC actually is important. In this study, using superconductive transformer which used the Bi-2223 silver sheath polycore line for the secondary roll line, it examined AC of the steady on alternating current call of the QMG current-limiting element of the meander shape in energizing. (NEDO)

  5. Assessment of Coping Capability of KORI Unit 1 under Extended Loss AC Power and Loss of Ultimate Heat Sink Initiated by Beyond Design Natural Disaster

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Chang Hyun; Ha, Sang Jun [KHNP CRI, Daejeon (Korea, Republic of); Han, Kee Soo [Nuclear Engineering Service and Solution (NESS) Co. Ltd., Deajeon (Korea, Republic of); Park, Chan Eok [KEPCO Engineering and Constructd., Deajeon (Korea, Republic of)

    2016-10-15

    In Korea, the government and industry performed comprehensive safety inspection on all domestic nuclear power plants against beyond design basis external events and fifty action items have been issued. In addition to post- Fukushima action items, the stress tests for all domestic nuclear power plants are on the way to enhance the safety of domestic nuclear power plants through finding the vulnerabilities in intentional stress conditions initiated by beyond design natural disaster. This paper presents assessment results of coping capability of KORI Unit 1 under the simultaneous Extended Loss of AC Power (ELAP) and Loss of Ultimate Heat Sink (LUHS) which is a representative plant condition initiated by beyond design natural disaster. The assessment of the coping capability of KORI Unit 1 has been performed under simultaneous the extended loss of AC power and loss of ultimate heat sink initiated by beyond design natural disaster. It is concluded that KORI Unit 1 has the capability, in the event of loss of safety functions by beyond design natural disaster, to sufficiently cool down the reactor core without fuel damage, to keep pressure boundaries of the reactor coolant system in transient condition and to control containment and temperature to maintain the integrity of the containment buildings.

  6. effect of number of rotor poles on ac losses of permanent magnet ...

    African Journals Online (AJOL)

    HOD

    A study on permanent magnet (PM) eddy current and core losses of dual-stator PM machines is investigated in this paper. The analyzed core losses include: the rotor core loss, stator core loss and the total core loss of the machines. Further, the effect of their different rotor pole number is also presented with quantitative ...

  7. Measurements of AC losses in oxide superconducting tapes and coils; Sankabutsu chodendo senzai oyobi koiru no koryu sonshitsu shokutei

    Energy Technology Data Exchange (ETDEWEB)

    Nakagami, M.; Watabe, K.; Kawagoe, A.; Sumiyoshi, F. [Kagoshima Univ., Kagoshima (Japan); Hayashi, H. [Kyushu Electric Power Co., Inc., Fukuoka (Japan)

    1999-06-07

    The application to the electric power equipment is expected oxide superconductivity wire rod, and short length linearity under the operating condition and quantitative evaluation of the ac loss in coil shape are important. Until now, we propose the pointing vector method as loss measuring method of the short length linear sample, and the equipment has been produced experimentally. However, in this measuring method, it was small within the signal of electric field with 10{sup -4}-10{sup -6} at loss component ratio, and there was a problem that the sensitometry was not sufficiently taken, since moreover, they are about number 10nV and weak signal very. Then, noise counterplan method in the measuring circuit, etc. were examined in order to improve the sensitometry this time. In addition, the examination of loss measuring method of the wire rod as coil shape is also reported, because it was done. (NEDO)

  8. Reversible motion of flux lines and AC losses in high-temperature superconducting tapes; Koon chodendo tashin tepu senzai ni okeru jisoku no kagyaku undo to koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Matsushita, T.; Otabe, S. [Kyushu Inst. of Tech., Fukuoka (Japan). Dept. of Computer Science and Electronics

    2000-05-25

    The possibility of reducing AC losses in superconducting Bi-2223 tapes with the aid of the reversible motion of flux lines is investigated. It was found that the AC loss was reduced by reducing the size of superconducting filaments, and the behavior was explained by the theoretical model of Campbell. To get a sufficient reduction of AC losses at 77.3 K from the prediction using the critical state model, it is necessary to reduce the filament thickness below 2.5 {mu}m. (author)

  9. Applicability of simple method in AC loss measurement-2; Kan'i sokutei ho ni yoru koryu sonshitsu sokutei no kakuchosei (2)

    Energy Technology Data Exchange (ETDEWEB)

    Takenaka, A.; Kawasaki, K.; Kajikawa, K.; Iwakuma, M.; Funaki, K. [Kyushu University, Fukuoka (Japan)

    1999-11-10

    In our research group, summary measuring method is proposed as measuring method of ac loss under various and electromagnetic environments of superconducting wire rod. In this measuring method, bilayer non-induction does close coiling of the sample, and the voltage terminal has been installed in the double end. By processing the signal between these terminals, it becomes possible that the ac loss under various and electromagnetic environments is measured. This time, the measurement principle of ac loss in the case in which the phase of flowing current and impression magnetic field swept simultaneously differed was examined. (NEDO)

  10. Loss optimizing low power 50 Hz transformers intended for AC/DC standby power supplies

    DEFF Research Database (Denmark)

    Nielsen, Nils

    2004-01-01

    This paper presents the measured efficiency on selected low power conventional 50 Hz/230 V-AC transformers. The small transformers are intended for use in 1 W@5 V-DC series- or buck-regulated power supplies for standby purposes. The measured efficiency is compared for cheap off-the-self transformer...

  11. A Simplified Model to Calculate AC Losses in Large 2G HTS Coils

    DEFF Research Database (Denmark)

    Song, Xiaowei (Andy); Mijatovic, Nenad; Jensen, Bogi Bech

    2015-01-01

    . The model presented uses H formulation which directly solves magnetic fields, and the general partial differential equations (PDEs) module in Comsol Multiphysics is used to implement the model. Afterwards, the model is used to simulate the excitation stage of a racetrack HTS coil with 350 tapes. The AC...

  12. Development of HTS power cable. Temperature dependence of the AC losses.; Koon chodendo keburu no kaihatsu -koryu sonshitsu no ondo izonsei ni tsuite

    Energy Technology Data Exchange (ETDEWEB)

    Mukoyama, S.; Miyoshi, K.; Tsubouchi, H. [The Furukawa Electric Co., Ltd., Tokyo (JP)] [and others

    2000-05-29

    It requires the result of being efficient (large capacity, low cost) more the underground power transmission line strengthened with the increase in electric power demand in urban area. Therefore, Tokyo Electric Power and Furukawa Electric advance the development of the compact superconductive electric power cable as an efficient transmission line. In one of the technical problems in advancing the development, there is the reduction of the ac loss. This time, it measured the ac loss of cable conductor, which constituted superconducting cable. (NEDO)

  13. AC loss in YBCO coated conductors at high dB/dt measured using a spinning magnet calorimeter (stator testbed environment)

    Science.gov (United States)

    Murphy, J. P.; Gheorghiu, N. N.; Bullard, T.; Haugan, T.; Sumption, M. D.; Majoros, M.; Collings, E. W.

    2017-09-01

    A new facility for the measurement of AC loss in superconductors at high dB/dt has been developed. The test device has a spinning rotor consisting of permanent magnets arranged in a Halbach array; the sample, positioned outside of this, is exposed to a time varying AC field with a peak radial field of 0.566 T. At a rotor speed of 3600 RPM the frequency of the AC field is 240 Hz, the radial dB/dt is 543 T/s and the tangential dB/dt is 249 T/s. Loss is measured using nitrogen boiloff from a double wall calorimeter feeding a gas flow meter. The system is calibrated using power from a known resistor. YBCO tape losses were measured in the new device and compared to the results from a solenoidal magnet AC loss system measurement of the same samples (in this latter case measurements were limited to a field of amplitude 0.1 T and a dB/dt of 100 T/s). Solenoidal magnet system AC loss measurements taken on a YBCO sample agreed with the Brandt loss expression associated with a 0-0.1 T Ic of 128 A. Subsequently, losses for two more YBCO tapes nominally identical to the first were individually measured in this spinning magnet calorimeter (SMC) machine with a Bmax of 0.566 T and dB/dt of up to 272 T/s. The losses, compared to a simplified version of the Brandt expression, were consistent with the average Ic expected for the tape in the 0-0.5 T range at 77 K. The eddy current contribution was consistent with a 77 K residual resistance ratio, RR, of 4.0. The SMC results for these samples agreed to within 5%. Good agreement was also obtained between the results of the SMC AC loss measurement and the solenoidal magnet AC loss measurement on the same samples.

  14. AC transport current loss of high-temperature superconducting film prepared on single-crystal substate; YBCO hakumaku dotai no koryu tsuden sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Miyagi, D.; Ogawa, J.; Tsukamoto, O. [Yokohama National Univ., Yokohama (Japan); Kudo, Y.; Kubota, H.; Yamazaki, M.; Yoshino, H. [Toshiba Corp., Tokyo (Japan)

    1999-06-07

    The high temperature oxidation thing superconductor is operated at the liquid nitrogen temperature, and it is possible to hold the cooling cost low than metal system superconductor such as NbTi. Therefore, the applied research to the AC power equipment is advanced. In the application to the AC power equipment, the reduction of the ac loss of superconducting cable becomes the gist of the practical application. We measured alternating current loss of an YBCO thin film on the LaAlO3 single crystal substrate developed for SN transitional type current limiter. (NEDO)

  15. Technique for reduction of mechanical losses in AC superconducting coils due to thermal expansion properties of various FRP bobbins

    Science.gov (United States)

    Sekine, N.; Tada, S.; Higuchi, T.; Furumura, Y.; Takao, T.; Yamanaka, A.

    2005-10-01

    We reported about reduction of mechanical losses in AC superconducting coils. The method is the use of FRP bobbins fabricated with special fibers. Since their FRPs have negative thermal expansion coefficient to the fiber direction, the FRP bobbins expand to the circumferential direction during cooling down. In case of the superconducting coils with such FRP bobbins, the winding tensions do not decrease during cooling down. Therefore, the mechanical losses are reduced by the suppression of wire's vibration. Their special FRPs are a Dyneema® fiber reinforced plastic (DFRP), a Dyneema and glass fiber reinforced plastic (DGFRP), and a Zylon® fiber reinforced plastic (ZFRP). These materials have negative thermal expansion coefficient to the fiber direction, however, the amplitudes of thermal expansion are various by the quantity or quality of the fiber. In this paper, the values of thermal expansion were actually measured, and it was discussed about the influence on the mechanical losses. At the experimental results, the mechanical loss was small, so that the thermal strain to the circumferential direction on the coil was large. Moreover, in case of the coils with sufficiently strong winding tensions at coil-operating temperature, the mechanical losses vanished.

  16. Technique for reduction of mechanical losses in AC superconducting coils due to thermal expansion properties of various FRP bobbins

    Energy Technology Data Exchange (ETDEWEB)

    Sekine, N. [Tsukamoto Laboratory, Faculty of Engineering, Yokohama National University, 79-5, Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)]. E-mail: n-sekine@tsukalab.dnj.ynu.ac.jp; Tada, S. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Higuchi, T. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Furumura, Y. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Takao, T. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Yamanaka, A. [Research Center, Toyobo, Co., Ltd, 2-1-1, Katata, Otsu, Shiga 520-0292 (Japan)

    2005-10-01

    We reported about reduction of mechanical losses in AC superconducting coils. The method is the use of FRP bobbins fabricated with special fibers. Since their FRPs have negative thermal expansion coefficient to the fiber direction, the FRP bobbins expand to the circumferential direction during cooling down. In case of the superconducting coils with such FRP bobbins, the winding tensions do not decrease during cooling down. Therefore, the mechanical losses are reduced by the suppression of wire's vibration. Their special FRPs are a Dyneema[reg] fiber reinforced plastic (DFRP), a Dyneema and glass fiber reinforced plastic (DGFRP), and a Zylon[reg] fiber reinforced plastic (ZFRP). These materials have negative thermal expansion coefficient to the fiber direction, however, the amplitudes of thermal expansion are various by the quantity or quality of the fiber. In this paper, the values of thermal expansion were actually measured, and it was discussed about the influence on the mechanical losses. At the experimental results, the mechanical loss was small, so that the thermal strain to the circumferential direction on the coil was large. Moreover, in case of the coils with sufficiently strong winding tensions at coil-operating temperature, the mechanical losses vanished.

  17. First AC loss test and analysis of a Bi2212 cable-in-conduit conductor for fusion application

    Science.gov (United States)

    Qin, Jinggang; Shi, Yi; Wu, Yu; Li, Jiangang; Wang, Qiuliang; He, Yuxiang; Dai, Chao; Liu, Fang; Liu, Huajun; Mao, Zhehua; Nijhuis, Arend; Zhou, Chao; Devred, Arnaud

    2018-01-01

    The main goal of the Chinese fusion engineering test reactor (CFETR) is to build a fusion engineering tokamak reactor with a fusion power of 50–200 MW, and plan to test the breeding tritium during the fusion reaction. This may require a maximum magnetic field of the central solenoid and toroidal field coils up to 15 T. New magnet technologies should be developed for the next generation of fusion reactors with higher requirements. Bi2Sr2CaCu2Ox (Bi2212) is considered as a potential and promising superconductor for the magnets in the CFETR. R&D activities are ongoing at the Institute of Plasma Physics, Chinese Academy of Sciences for demonstration of the feasibility of a CICC based on Bi2212 round wire. One sub-size conductor cabled with 42 wires was designed, manufactured and tested with limited strand indentation during cabling and good transport performance. In this paper, the first test results and analysis on the AC loss of Bi2212 round wires and cabled conductor samples are presented. Furthermore, the impact of mechanical load on the AC loss of the sub-size conductor is investigated to represent the operation conditions with electromagnetic loads. The first tests provide an essential basis for the validation of Bi2212 CICC and its application in fusion magnets.

  18. Transient Analysis of Loss of All AC Power While on Shutdown Cooling for WH 2-Loop Nuclear Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    Park, Da Hee; Lee, Kyung Jin; Hwang, Su Hyun [FNC Technology Co., Yongin (Korea, Republic of); Yoon, Duck Joo; Lee, Seung Chan [KHNP, Daejeon (Korea, Republic of)

    2016-10-15

    The analysis was performed to provide useful insights for operator guidelines to maintain critical safety functions during SBO for shutdown modes. For Shutdown State A, if the SG PORV is manually opened at 4,000 sec by operator and secondary external injection by operator was provided at 5hours, the core boiling is not expected and core is cooled well. For Shutdown State C, if RWST gravity feed by operator is provided at 4,000 sec, the core is not uncovered and core is cooled well. This study would be useful for improving a strategy to cope with loss of all AC power while on shutdown cooling. The purpose of this study is to provide strategies for maintaining core cooling and protecting the reactor core in the event of complete loss of all AC power while on Residual Heat Removal (RHR) cooling. In this study, in order to comprehend the Fukushima accident, the transient analysis was performed to provide insights into mitigating strategies for SBO while on a shutdown state using the RELAP5/MOD3.3 code.

  19. Test results of the 100 kWh SMES model coil. AC loss performance; 100 kWh SMES moderu koiru. Koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Hanai, Satoshi; Wachi, Yoshihiro; Kyoto, Makoto [Toshiba Corp., Tokyo (JP)] (and others)

    1999-06-25

    In order to establish a technology needed for a small-scale 100 kWh SMES device, a SMES model coil was fabricated. Performance tests were carried out at the Japan Atomic Energy Research Institute (JAERI) in 1996. After that, the coil was installed in facilities of the Lawrence Livermore National Laboratory (LLNL) and tested in 1998, in collaboration between Japan and the United States. The AC loss results at LLNL were in good agreement with those at JAERI. It was reconfirmed from the results that the coupling loss of the coil consists of two components with short and long time constants. We found out from the signals of Hall probes that the current loops with long decay time constants were induced in the CIC conductor. These loops could enhance additional AC loss in the coil. To reduce the AC loss, we made small-sized CICI conductor of strands having a CuNi surface, a fabricated the small coil. The measured AC loss of the small coil was reduced to about 1/6. The CuNi surface on the strands was demonstrated to be effective to reduce AC loss in the coil. (author)

  20. AC loss characteristics of simulated CIC-type conductors having plastic conduit

    Science.gov (United States)

    Kojo, Y.; Sekine, N.; Tada, S.; Yamaguchi, Y.; Obama, J.; Takao, T.; Miyagi, D.; Yamanaka, A.

    2003-10-01

    When alternating current superconducting coils having cable-in-conduit conductors are fabricated, non-metallic conduit materials are necessary to avoid eddy current losses in the conduits. Using two kinds of non-metallic tapes made of glass fiber reinforced plastics (GFRPs) and Dyneema fiber reinforced plastics (DFRPs), we made the conductors with the GFRP conduits and DFRP conduits, and experimentally studied the total losses of the conductors. The measured results showed that the total loss of the conductor with the GFRP conduit was smaller than that with the DFRP conduit at the same value of the void ratio, the transport current, the external magnetic field, and so on. When the void ratios become high, the superconducting bundle cable can easily move in the conduit. Hence the measured total losses increased with the void ratios of the conductors.

  1. Study of a Modified AC Bridge Technique for Loss Angle Measurement of a Dielectric Material

    Directory of Open Access Journals (Sweden)

    S. C. BERA

    2008-09-01

    Full Text Available A Wheatstone’s bridge network like Schering Bridge, DeSauty Bridge etc measures the loss angle or tangent of loss angle (tanδ of a dielectric material. In high voltage application this loss angle is generally measured by high voltage Schering Bridge. But continuous measurement of tan δ is not possible by these techniques. In the present paper a modified operational amplifiers based Schering Bridge network has been proposed for continuous measurement of tanδ in the form of a bridge network output voltage. Mathematical analysis of the proposed bridge network has been discussed in the paper and experimental work has been performed assuming the lossy dielectric material as a series combination of loss less capacitor and a resistor. Experimental results are reported in the paper. From the mathematical analysis and experimental results it is found that the output of the proposed bridge network is almost linearly related with tanδ.

  2. AC loss characteristics of simulated CIC-type conductors having plastic conduit

    Energy Technology Data Exchange (ETDEWEB)

    Kojo, Y.; Sekine, N.; Tada, S.; Yamaguchi, Y.; Obama, J.; Takao, T.; Miyagi, D.; Yamanaka, A

    2003-10-15

    When alternating current superconducting coils having cable-in-conduit conductors are fabricated, non-metallic conduit materials are necessary to avoid eddy current losses in the conduits. Using two kinds of non-metallic tapes made of glass fiber reinforced plastics (GFRPs) and Dyneema fiber reinforced plastics (DFRPs), we made the conductors with the GFRP conduits and DFRP conduits, and experimentally studied the total losses of the conductors. The measured results showed that the total loss of the conductor with the GFRP conduit was smaller than that with the DFRP conduit at the same value of the void ratio, the transport current, the external magnetic field, and so on. When the void ratios become high, the superconducting bundle cable can easily move in the conduit. Hence the measured total losses increased with the void ratios of the conductors.

  3. AC losses of superconductor for HTS power cables; KOon chodendo keburuyo chodendo dotai no koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Mukoyama, S.; Tsubouchi, H.; Miyoshi, K.; Uno, N.; Yoshida, T. [The Furukawa Electric Co., Ltd, Tokyo (Japan); Honjo, S.; Mimura, T.; Iwata, Y. [Tokyo Electric Power Co., Inc., Tokyo (Japan)

    1999-06-07

    The underground power transportation that is increasing with the increase of power consumption in cities is requested to be more effective (large capacity and low cost). Therefore, the Tokyo Electric Power Co., Inc. and Furukawa Electric Co., Ltd. are developing compact superconducting cables as effective power transportation lines. The most current losses generated in a spiral conductor that is made by spirally twisting plural Bi 2223 multi axial Ag sheathed wires on a former are hysteresis loss. As methods for reducing the hysteresis loss, a method that unifies the currents flowing through each layer and a method that twists filaments inside the wires are being studied. In this study, superconductors using twisted filaments and parent wires having high resistance are experimentally prepared, and reduction effect of alternating losses are evaluated. As a result, in a range of current above 200 Ams, the alternating loss is reduced by the reduction effect of the twist, experimental results agree well with the analysis results below 600 Ams. And, reduction of the alternating loss of 46% in maximum is confirmed. (NEDO)

  4. Magnetic coupling and self-field AC losses of two neighbouring Ag sheathed PbBi2223 tapes

    Science.gov (United States)

    Hughes, T. J.; Yang, Y.; Beduz, C.; Power, A.

    1998-12-01

    The magnetic interaction between two neighbouring superconducting tapes has significant influences on their self-field AC losses. While the two tapes are independent of each other when separated far apart, they are expected to be fully coupled and behave as a single tape when placed very near. One of the consequences of such coupling is the increase in the self-field loss per tape, which is double of that for an uncoupled tape carrying the same current. In order to assess the interactions among tapes in systems such as a power cable, a better understanding is necessary on the critical distance where the coupling becomes important. Experimental measurements on the self-field losses in two neighbouring Ag sheathed PbBi2223 tapes were carried out with the two tapes separated by various distances, while placed either side by side ( side-configuration) or one on top of the other ( top-configuration). The results indicates that the critical coupling distance for the top-configuration is about 5 mm, where the increase in loss per tape is about 10%. The critical length for the side-configuration is found to be of the same order of magnitude.

  5. AC losses in a prototype NbTi cable for LHC dipole magnets

    NARCIS (Netherlands)

    Roovers, A.J.M.; van Pelt, A.J.; van de Klundert, L.J.M.

    1990-01-01

    In this paper loss measurements on a prototype NbTi cable for the Large Hadron Collider dipole magnets are presented. The cable is meant to be used for the outer layer of the magnets. It is a trapezium-shaped (key-stoned) Rutherford cable. The experimental results were obtained in a Twente test

  6. Highly alloyed Ni-W substrates for low AC loss applications

    Science.gov (United States)

    Gaitzsch, Uwe; Hänisch, Jens; Hühne, Ruben; Rodig, Christian; Freudenberger, Jens; Holzapfel, Bernhard; Schultz, Ludwig

    2013-08-01

    Cube texture formation has been studied in Ni-W alloys with a W content of 9 at.% and above. These alloys show a low magnetization at 77 K and below, and are therefore excellent candidates for use as substrates of coated conductors in AC applications. The application of a modified deformation and annealing sequence leads to a highly textured surface of Ni9W and Ni9.5W tapes with cube texture fractions above 96%. YBCO (YBa2Cu3O7-δ) layers obtained on these substrates using a standard buffer architecture showed a critical current density exceeding 1.5 MA cm-2 at 77 K, similar to those for films on commercial Ni5W tapes. In contrast, only a weak cube texture was achieved in Ni10W tapes. The rolling texture of this alloy showed a significantly increased Goss component, which could not be reduced by applying intermediate annealing treatments. The influence of this texture on the cube texture formation will be discussed in detail.

  7. Influence of pinning parameters on the ac loss in high-T{sub c} Superconductors; Koon chodendotai no koryu sonshitsu ni okeru pinningu parameta no eikyo

    Energy Technology Data Exchange (ETDEWEB)

    Ohashi, K.; Fujiyoshi, K. [Kumamoto Univ., Kumamoto (Japan); Yamafuji, K. [Ariake National College Tech., Fukuoka (Japan); Kisu, T. [Kyushu Univ., Fukuoka (Japan). Dept. of Systems Engineering

    2000-05-29

    It is indispensable to estimate the ac loss, when exchanges and utilizes the high temperature superconductor. For the reason, analysis of the field distribution in the superconductor is necessary. In Bean Model used in the alloyed superconductor, in case of the high temperature superconductor, it cannot accurately evaluate the distribution, since it complicatedly changes. In this paper, the computer analyzed field distribution of high temperature superconductor as the pinning parameter changes using the nonlinear current-voltage characteristics model in which high temperature superconductor is peculiar numerically, and ac loss was evaluated. In addition, it carried out the theoretical evaluation of the ac loss using the model in which Bean model was made to consider the frequency dependence. (NEDO)

  8. An improved FEM model for computing transport AC loss in coils made of RABiTS YBCO coated conductors for electric machines

    Science.gov (United States)

    Ainslie, Mark D.; Rodriguez-Zermeno, Victor M.; Hong, Zhiyong; Yuan, Weijia; Flack, Timothy J.; Coombs, Timothy A.

    2011-04-01

    AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.

  9. Influence of longitudinal magnetic field on AC loss in twisted multifilamentary HTS tapes; Tsuisuto pucchi to bozai teikouritsu wo kaeta tashin tepu senzai no koryu sonshitsu suchi kaiseki

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, N. [Yokohama National Univ., Yokohama (Japan). Fuculty of Engineering; Banno, N. [National Research Inst. for Metals, Tokyo (Japan)

    1999-11-10

    The wire rod must transport AC under alternating current magnetic field, when high temperature superconductivity multicore tape wire rod is used for electric power equipment driven at 50/60Hz alternating current frequency. Generally twist and high resistivity of the base metal are made effective in order to reduce the loss under alternating current transverse field. In this study, the relationship between loss and twist pitch, base metal resistivity of wire rod, which transported AC under alternating current magnetic field, was quantitatively examined by numerical analysis by finite element method. (NEDO)

  10. Ac loss in Ag/Bi-2223 tape cooled by GM cryocooler; Dendo reikyaku Ag/Bi-2223 tepu no koryu sonshitsu tokusei

    Energy Technology Data Exchange (ETDEWEB)

    Wakasugi, K.; Murakami, T.; Natsume, K.; Naito, F.; Murase, S.; Shimamoto, S. [Tohoku Univ., Miyagi (Japan). Graduate School of Engineering

    1999-11-10

    It expects the application to electric power field the superconductivity is shown at the liquid nitrogen temperature the Bi system high temperature oxidation thing superconductor. Though it has made the research on the ac loss of the Bi system high temperature oxidation thing superconductor, it is at commercial frequency and liquid nitrogen temperature in the many. In this experiment, ac loss at wide 7K-77K temperatures and various 0.1Hz-500Hz frequencies was measured using conduction cooling GM refrigerating machine. (NEDO)

  11. A.C. loss of the high-Tc superconducting cable conductor; Koon chodendo keburu dotai no koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Kume, A.; Futaki, N.; Ono, K.; Sadakata, N.; Saito, T. [Fujikura Ltd., Tokyo (Japan); Hasegawa, T. [Showa Electric Wire and Cable Co., Ltd., Kanagawa (Japan); Nagaya, S. [Chubu Electric Power Co., Ltd., Aichi (Japan)

    1999-06-07

    High-temperature superconducting cable used in the liquid nitrogen circulation cooling was expected in the electric power field, because of an attempt to compact the cable size and possibly reduce the power transmission loss. In the multilayer spiral conductor laminated by which Bi-2223 phase silver sheath tape were spirally wound and insulated between layers, the drift problem that current distribution concentrated in the outer layer occurred, because the inductance of the internal layer was higher than that of the outer layer in the alternating current. In this study, for a purpose of attempting the drift countermeasure and reduction of AC loss, the transposition yarn twist segment was composed of Bi-2223 phase silver sheath tape, the transposition yarn twist conductor was manufactured with the structure of the transposition yarn twist segment spirally wound on a frame, and the alternating current characteristics were investigated. As the result, the phase shift of transferring current could be hardly observed on the silver sheath wire in the segment. (NEDO)

  12. A.c. losses of a 10 kA NbTi cable-in-conduit superconductor for SMES applications

    Science.gov (United States)

    Kwasnitza, K.; Sultan, A.; Al-Wakeel, S.

    In this paper we present a.c. loss investigations performed on a 10 kA prototype cable-in-conduit superconductor with a NbTi basis. The twisted and braided conductor was under development for a superconducting 180 MJ energy storage model coil with Bmax = 5.4 T at Imax = 10 kA. Special aspects of our measurements are the coupling loss dependence on the Cr coating and on the plastic deformation of the basic multifilament wires in the cable. Further, we separately determined the individual contributions from the different conductor components to the coupling losses. Also, the influence of the void fraction in the conductor on the coupling losses was investigated. In addition, d.c. transverse resistance measurements were performed on the cable. The measured hysteresis and coupling losses are small for such a large current conductor and were sufficiently low for our purposes. Further a.c. loss reduction could be achieved by a proper choice of the basic multifilament wire in the cable. Our a.c. loss results should also be useful for other pulsed magnetic field applications of this conductor type.

  13. AC hysteresis losses near the glass-liquid transition temperature in high-T{sub c} cuprate superconductors. Handy expression for AC hysteresis loss; Sankabutsu koon chodendotai no jisoku gurasu - ekitai ten'i ondo fukin ni okeru koryu rireki sonshitsu. Koryu rireki sonshitsu ni taisuru kanbenna rironshiki

    Energy Technology Data Exchange (ETDEWEB)

    Fujiyoshi, T.; Ohashi, K.; Hiramatsu, A. [Kumamoto Univ., Kumamoto (Japan); Yamafuji, K.; Nakamura, S. [Ariake National College of Tech., Fukuoka (Japan); Kisu, T. [Kyushu Univ., Fukuoka (Japan). Graduate School of Information Science and Electrical Engineering

    2000-05-25

    The AC loss in high-T{sub c} superconductors near the glass-liquid transition temperature, T{sub g}, is studied numerically and theoretically. It is shown that the AC loss in a slab sample under a DC bias magnetic field depends noticeably on the angular frequency, {omega}, and hence, cannot be described by the usual critical state model using critical current density, J{sub c}, defined with the aid of the electric field criterion. However, the AC loss including the flux flow loss is shown to be describable quantitatively by present handy theoretical expression, which has the same form as the well-known expression based on Bean's critical state model except that J{sub c} is replaced by the effective critical current density, J{sub ce}({omega}). (author)

  14. Loss Prediction and Thermal Analysis of Surface-Mounted Brushless AC PM Machines for Electric Vehicle Application Considering Driving Duty Cycle

    Directory of Open Access Journals (Sweden)

    Tianxun Chen

    2016-01-01

    Full Text Available This paper presents a computationally efficient loss prediction procedure and thermal analysis of surface-mounted brushless AC permanent magnet (PM machine considering the UDDS driving duty cycle by using a lumped parameters’ thermal model. The accurate prediction of loss and its variation with load are essential for thermal analysis. Employing finite element analysis (FEA to determine loss at every load point would be computationally intensive. Here, the finite element analysis and/or experiment based computationally efficient winding copper and iron loss and permanent magnet (PM power loss models are employed to calculate the electromagnetic loss at every operation point, respectively. Then, the lumped parameter thermal method is used to analyse the thermal behaviour of the driving PM machine. Experiments have been carried out to measure the temperature distribution in a motor prototype. The calculation and experiment results are compared and discussed.

  15. Measurement of AC losses in superconducting wires under external transverse magnetic field; Chodendo senzai no gaibu yoko jikai ka ni okeru koryu sonshitsu sokutei

    Energy Technology Data Exchange (ETDEWEB)

    Kakiuchi, T.; Arakawa, K.; Kawabata, S.; Sumiyoshi, F. [Kagoshima Univ., Kagoshima (Japan)

    2000-05-29

    The quantitative evaluation of ac loss characteristics of the superconducting wire material is very important, when little-loss design of the superconducting wire rod and application to the superconductive equipment are considered. Though in the case of this loss measurement in the pick-up coil method, the solenoidal coil state does the winding of the material wire rod, the loss characteristic measured by the interaction between winding changes, when coil shape such as roll pitch and number of layers of the sample coil change. Then, the purpose of this study is to clarify the effect of the shape of the sample coil to the loss characteristic in loss measurement under the outside transverse field by the pick-up coil method. (NEDO)

  16. AC losses in parallel conductors (6) -dependence of the distance between strands; Chodendo heiretsudotai ni okeru koryu sonshitsu (6). Sosenkan kyori no eikyo.

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, H.; Kajikawa, K.; Iwakuma, M.; Funaki, K. [kyushu Univ., Fukuoka (Japan)

    2000-05-29

    Since dislocation parallel conductor was considered best as a composing method for large current capacity oxide superconductor, its electromagnetic phenomena were examined, and magnetic field amplitude dependency, frequency dependency deviation dependency of dislocation position have been already clarified on additional AC losses with deviation of dislocation position. In this study, The effect of the change of distance between elementary wires of 2-wire parallel conductor on magnetic flux density distribution was examined from practical and theoretical sides. The investigation results on magnetic density distribution produced by shield current showed that, though magnetic flux density was constant inside parallel conductor if distance between centers of elementary wires was small, it became small in the center if distance was increased. In future, this distance dependency is planned to be quantitatively verified by measuring combination constants and additional AC losses of parallel conductor. (NEDO)

  17. A round robin test for pre-standardization of a saddle-shaped pickup coil method to measure AC losses in Bi-2223 Ag-sheathed tapes

    Energy Technology Data Exchange (ETDEWEB)

    Funaki, K. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan)], E-mail: funaki@sc.kyushu-u.ac.jp; Iwakuma, M.; Sueyoshi, T. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan); Fujikami, J.; Ayai, N.; Ishida, T. [Sumitomo Electric Industries Ltd., 1-1-3, Shimaya, Konohana-ku, Osaka 554-0024 (Japan); Tanaka, Y. [International Superconductivity Technology Center, 5-34-3 Shinbashi, Minato-ku, Tokyo 105-0004 (Japan); Osamura, K. [Research Institute for Applied Sciences, 49 Tanaka Ohicho, Sakyo-ku, Kyoto 606-8202 (Japan)

    2008-09-15

    We performed a round robin test to measure AC losses in Bi-2223 Ag-sheathed tapes with saddle-shaped pickup coils in an alternating perpendicular magnetic field at liquid nitrogen temperature. Two laboratories participated in the round robin test with each system of the pickup coil and the measurement circuit. Short specimens of a Bi-2223 tape and a copper magnet to generate the alternating magnetic field were used for common conditions in the test. The saddle-shaped pickup coils were made under recommended conditions for the structure and the sizes that give a calibration coefficient around unity. The signals of the magnetic moment from the pickup coils were calibrated by using a standard hairpin copper tape. AC losses of the common specimen of the Bi-2223 tape were measured in the round robin test in the ranges of frequency up to 60 Hz and the amplitude up to 0.2 T of perpendicular magnetic field. While we had only two participants in the test, we obtained the following results in a pre-standardization process of the AC loss measurement with the saddle-shaped pickup coil (i) it was suggested from the calibration procedure using hairpin copper tape that the deviations from numerical simulation for an ideal pickup coil and a sufficiently long specimen is within 3% on an average, (ii) the values of COV for the AC losses measured at 1 Hz and 10 Hz are less than about 3% in the range of the field amplitude between 0.02 T and 0.2 T.

  18. Flux density distribution and the ac loss near the glass-liquid transition temperature in high-Tc superconductors; Koon chodendo no jisoku gurasu-ekitai sen'i ondo kinbo ni okeru naibu jisoku bunpu to koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Ohashi, K.; Fujiyoshi, T. [Kumamoto Univ., Kumamoto (Japan); Kisu, T. [Kyushu Univ., Fukuoka (Japan); Yamafuji, K.

    1999-11-10

    It is possible that the high temperature superconductor keeps the superconductivity at boiling point of cheap liquid nitrogen, and the electric power application is expected. Then, the ac loss in the alternating current utilization becomes a problem. For the reason, analysis of the field distribution in the superconductor is necessary. Using the nonlinear E-J characteristics model in which high temperature superconductor was peculiar, the computer analyzed the field distribution of high temperature superconductor numerically, and the ac loss was evaluated. In addition, the theoretical evaluation of the ac loss was carried out using the model in which Bean model was made to consider the frequency dependence. (NEDO)

  19. AC losses of high temperature superconducting wires in combined condition of transverse magnetic field and transport current; Ojikai{center_dot}denryu no doji soinji ni okeru koon chodendo senzai no koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Kajikawa, K.; Takenaka, A.; Kawasaki, K.; Iwakuma, M.; Funaki, K. [Kyushu Univ., Fukuoka (Japan)

    2000-05-29

    We propose the summary measuring method as a method for conveniently evaluating ac loss under various electromagnetic environment of superconducting wire rod high precise. It has evaluated the ac loss as simultaneously; it has applied current and magnetic field until now to Bi-2223 silver sheath wire rod using this technique experimentally. And, got measurement result agreed with the numerical calculation result well, and it was able to verify the usefulness of this technique. However, the condition of the simultaneous sweep examined until now is only the case in which current and magnetic field are in-phases, and it is necessary to examine whether it is also estimable on the ac loss in both in case of phase difference by summary measuring method. This time, the ac loss as simultaneously, it applied precedence, current with phase difference in oxide superconducting wire rod and magnetic field to the experimental examination was estimated by numerical calculation. (NEDO)

  20. Development of a 1000 kVA oxide superconducting transformer cooled by liquid nitrogen. 4. Ac loss properties.; Ekitai chisso reikyaku 1000 kVA sankabutsu chodendo hen'atsuki no kaihatsu 4. Koryu sonshitsu tokusei

    Energy Technology Data Exchange (ETDEWEB)

    Iwakuma, M.; Fukuda, Y.; Matsumura, K. [Kyushu Univ., Fukuoka (JP)] [and others

    2000-05-29

    In this study group, it developed the liquid nitrogen cooling 22kV/6.9kV-1000kVA single phase superconducting transformer using the Bi2223 superconducting wire rod with the aim of the superconduction of the transformer for urban area underground substation this time. In this paper, ac loss characteristics of the superconductive winding are reported. In developed superconductive winding, the ac loss occupies over half of all thermal load, and it becomes important characteristics, which decide necessary cooling unit capacity and equipment efficiency. In this study, it put principal objective for the establishment of ac loss evaluation technique in the design and ac loss measuring technique of actual equipment. (NEDO)

  1. Reduction of AC transport losses in Ag-sheathed Bi2223 multifilamentary tapes by resistive barrier; Koteiko baria donyu ni yoru gin shisu Bi2223 tashin tepu senzai no koryu tsuden sonshitsu no teigenka

    Energy Technology Data Exchange (ETDEWEB)

    Inada, R.; Uno, T.; Takatori, Y.; Ota, A.; Zhang, P. [Toyohashi Univ. of Technology, Aichi (Japan); Fujimoto, H. [Railway technical Research Institute, Tokyo (Japan); Zhou, L.

    2000-05-29

    Wire by Ag-sheathed Bi2223 multifilamentary tapes where barrier layer was introduced in parallel with tape plane, was fabricated and the property of AC transport losses was evaluated. It was measured using frequency from 50 Hz to 500 Hz. As barrier material, Bi-2201 and AgCu alloy were used. As the result, AC loss of tape wire decreased by 60-70% using Bi-2201 barrier. (NEDO)

  2. AC stabilities in superconducting magnetic shielding body with shorted low AC loss Nb{sub 3}Sn coil; Nb{sub 3}Sn kansen jiki shaheitai no koryu anteisei

    Energy Technology Data Exchange (ETDEWEB)

    Aizawa, N.; Nii, A.; Ito, Y.; Onishi, T. [Hokkaido Univ., Hokkaido (Japan); Shibuya, M. [Engineering Research Association for Superconductive Genertion Equipment and Materials, Osaka (Japan)

    1999-06-07

    In this study, the superconducting magnetic shielding body conductively cooled by the small refrigerating machine at the intermediate temperature (10K-14K) was examined with the aim of a magnetic shielding type superconducting current limiter as closed as maintenance-free. Nb{sub 3}Sn coil closed the two ends was an object as a magnetic shielding body. In case of such a cooling system, the research of the stability was indispensable because of possible normal conduction transition in addition of disturbance into tapes. Then, the method to use the thyristor bypass circuit was examined in order to establish the stabilization method. As for the simulation, the normal conduction transition of the low AC loss Nb{sub 3}Sn coil which AC transferred in the constant-voltage power source, and the recovery characteristics of superconductivity were analyzed in the liquid helium. As a result of evaluating the stability in the constant-voltage power source, it was shown that the current attenuated by the resistance, and the exothermic reaction was controlled even if the disturbance happened and quenched. From these results, it was clarified that the stabilization method to establish the thyristor bypass circuit was effective for improvement on the stability of the superconductor. (NEDO)

  3. Practice of AC loss measurement in high Tc superconductor; Koon chodendo senzai no koryu sonshitsu sokutei jisshu

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, N.; Tsukamoto, O.; Ciszek, M. [Yokohama National Univ., Yokohama (Japan). Faculty of Engineering

    1999-06-07

    The cooperative research promotion center in the Yokohama National University was set up for a purpose to promote the co-operative research with civilian agencies, conduct and the co-operate technical education to engineers from civilian agencies and take the technical discussion and supply the academic information with civilian agencies. As one part of this work, the engineer training called as the high technology training was conducted. In this paper, the seminar on the alternate current loss measurement conducted in November 1998 was reported. This training was a 'high' technology training for an objective of engineers, 8 participants included engineers and graduate students in a major of superconductivity from makers, civilian institutes and universities as the superconducting specialists attended this lecture. In this training, lectures on the loss generating mechanism and the loss measurement principle and its practical use, manufacture of the measuring samples, measurement (the energization loss and magnetization loss), the report of measured results and examination and comments were carried out in order. In the manufacture of samples, participants carried out all soldering and pick-up coil rolls by handling sample tapes and sample holder parts. (NEDO)

  4. Measurement and Numerical Evaluation of AC-Losses in a ReBCO Roebel Cable at 4.5 K

    CERN Document Server

    van Nugteren, J.; Gao, P.; Bottura, L,; Dhallé, M.; Goldacker, W.; Kario, A.; ten Kate, H.; Kirby, G.; Krooshoop, E.; de Rijk, G.; Rossi, L.; Senatore, C.; Wessel, S.; Yagotintsev, K.; Yang, Y.

    2016-01-01

    EUCARD2 aims to research ReBCO superconducting magnets for future accelerator applications. The properties of ReBCO conductors are very different from low temperature superconductors. To investigate dynamic field quality, stability and normal zone propagation an electrical network model for coated conductor cables was developed. To validate the model two identical samples were prepared at CERN after which measurements were taken at the University of Twente and Southampton University. The model predicts that for Roebel cable, in a changing magnetic field applied in the perpendicular direction, the hysteresis loss is much larger than the coupling loss. In the case of a changing magnetic field applied parallel to the cable coupling loss is dominant. In the first case the experiment is in good agreement with the model. In the second case the data can only be compared qualitatively because the calibration for the inductive measurement is not available.

  5. AC loss properties of Bi-2212 rutherford-type cables; Bi-2212 razafuodo gata asshuku seikei dotai no koryu sonshitsu tokusei

    Energy Technology Data Exchange (ETDEWEB)

    Fukuda, Y.; Matsumura, K.; Kajikawa, K.; Iwakuma, M.; Funaki, K. [Kyushu Univ., Fukuoka (Japan); Hasegawa, T. [Showa Electric Wire and Cable Co., Ltd., Kanagawa (Japan); Kasahara, H.; Akita, S. [Central Research Inst. of Electric Power Industry, Tokyo (Japan)

    2000-05-29

    With the aim of the application to SMES, it advances the development of the large-capacity oxide superconducting wire rod. A current capacity per 1 is small for present oxide superconducting wire rod. And, it needs the development of method of improving of mechanical strength of wire rod in the large magnet like SMES, because it receives the mighty electromagnetic force. It produced Rutherford type conductor, which made the Ni unit alloy to be the reinforcement using Bi-2212 cross section wire rod as a trial for solving these problems experimentally. In this study, it measured ac loss on produced conductor and the wire, which constitutes this, and it evaluated the electromagnetic property. (NEDO)

  6. Current distribution and ac loss of the coaxial and multilayer superconductive cable with magnetic shielding (3); Jiki shirudo wo yusuru taso dojikugata chodendo keburu no denryu bunpu to koryu sonshitsu (3)

    Energy Technology Data Exchange (ETDEWEB)

    Fukui, S.; Hirasawa, T.; Sato, K.; Yamaguchi, M.; Sato, T.; Tsukamoto, O.

    1999-11-10

    On current distribution and ac loss of multilayer and spiral high temperature superconductivity cable with the magnetic shielding conductor, we constructed the theoretical model. We showed the examination case on the relation between conductor structure and current distribution and ac loss using it. Then, we quantitatively obtained the twist pitch of the conductor, which could equalize current distribution from the numerical analysis. In this paper, we obtained the value of a twist pitch from this model and general electrical circuit modeling, and we examined those differences. In addition, we also examined the effect for the equalizing condition of cable outer diameter and number of layers. (NEDO)

  7. Jc and a.c. losses of Bi2223 Multifilamentary tapes with SVO barriers; Fuiramento kan ni SVO baria wo motsu Bi2223 tashin tepu no Jc to koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Inaba, T.; Maeda, H.; Sato, M. [Kitama Institute of Technology, Hokkaido (Japan); Zhang, P. [Toyohashi Univ. of Technology, Aichi (Japan); Chen, W. [Tohoku Univ., Miyagi (Japan). Institute for Materials Research

    2000-05-29

    For application of Bi-2223 wire, decrease of AC losses is important. For this, Bi-2223 multifilamentary tape where Sr{sub 6}V{sub 2}O{sub 1}1(SVO) powders arranged between filaments of high temperature superconductor was fabricated and the AC loss was evaluated. Slurry of blended SVO with polymer was produced. Wire where inside surface and outside surface of pipe was coated with this showed high Jc. But wire where both side of Ag pipe was coated with this showed low Jc. This is caused by disconnection of wires. (NEDO)

  8. Small current transformer for transport AC loss measurement using oxide superconductor; Sankabutsu chodendotai ni yoru koryu tsuden sokuteiyo kogata denryu toransu

    Energy Technology Data Exchange (ETDEWEB)

    Otabe, S.; Morizane, Y.; Matsushita, T. [Kyushu Univ., Fukuoka (Japan)

    1999-06-07

    The transformer, which used the Bi-2223 silver sheath polycore tape for the purpose of last time and simple current source for alternating current loss measurement of the oxide superconductivity body, was produced experimentally. As the result, it was confirmed that to run AC of 841A peak value of the double of critical current in the liquid nitrogen almost was possible. And, the loss measurement was carried out in the Y-123 bulk material actually, and it was shown that the result equal to the value estimated from the result of the magnetic hysteretic measured in SQUID was obtained. However, it is not possible to make the more and more small transformer flexural strain characteristics, because the result of beforehand heat-treating the Bi-2223 tape material was used. And, there was some a problem that coupling constant it is structural lowered and that the efficiency is bad. Then, the smaller transformer is reported, because the tape material was prepared by the Wind and React method in order to manufacture the transformer that in this study, it is smaller, and that it is efficient, and because it was produced experimentally. (NEDO)

  9. CMP-Neu5Ac Hydroxylase Null Mice as a Model for Studying Metabolic Disorders Caused by the Evolutionary Loss of Neu5Gc in Humans.

    Science.gov (United States)

    Kwon, Deug-Nam; Choi, Yun-Jung; Cho, Ssang-Goo; Park, Chankyu; Seo, Han Geuk; Song, Hyuk; Kim, Jin-Hoi

    2015-01-01

    The purpose of this study was to identify the modification/turnover of gene products that are altered in humans due to evolutionary loss of Neu5Gc. CMP-Neu5Ac hydroxylase- (Cmah-) deficient mice show the infiltration of Kupffer cells within liver sinusoids, whereas body and liver weight develop normally. Pathway analysis by use of Illumina MouseRef-8 v2 Expression BeadChip provided evidence that a number of biological pathways, including the glycolysis, gluconeogenesis, TCA cycle, and pentose phosphate pathways, as well as glycogen metabolism-related gene expression, were significantly upregulated in Cmah-null mice. The intracellular glucose supply in Cmah-null mice resulted in mitochondrial dysfunction, oxidative stress, and the advanced glycation end products accumulation that could further induce oxidative stress. Finally, low sirtuin-1 and sirtuin-3 gene expressions due to higher NADH/NAD in Cmah-null mice decreased Foxo-1 and MnSOD gene expression, suggesting that oxidative stress may result in mitochondrial dysfunction in Cmah-null mouse. The present study suggests that mice with CMAH deficiency can be taken as an important model for studying metabolic disorders in humans.

  10. Development of a 10 m long 1 kA 66/77 kV YBCO HTS cable with low AC loss and a joint with low electrical resistance

    Energy Technology Data Exchange (ETDEWEB)

    Yagi, Masashi; Mukoyama, Shinichi [Energy Transmission Research Department Ecology and Energy Laboratory, Furukawa Electric Corporated, Ltd, 6 Yawata-Kaigandori, Ichihara, Chiba 290-8555 (Japan); Amemiya, Naoyuki [Department of Electrical Engineering, Graduate School of Engineering, Kyoto University, Kyoto-Daigaku-Katsura, Nishikyo, Kyoto 615-8510 (Japan); Kashima, Naoji; Nagaya, Shigeo [Chubu Electric Power Company, Incorporated, 20-1, Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan); Shiohara, Yuh [Superconductivity Research Laboratory, 1-10-13, Shinonome, Koto-ku, Tokyo 135-0062 (Japan)], E-mail: m-yagi@ch.furukawa.co.jp

    2009-08-15

    We have developed high-T{sub c} superconducting (HTS) cables using YBCO tapes. A 10 mm-wide YBCO tape was divided into five strips using a YAG laser to reduce AC loss. A 0.3 m conductor and a 1 m conductor were fabricated achieving AC losses at 1 kA{sub rms} and 50 Hz of 0.054 W m{sup -1} and of 0.048 W m{sup -1}, respectively. Based on the successful AC loss reduction in the 0.3 and 1 m conductors, we fabricated a 10 m HTS cable with a three-layer HTS conductor, electrical insulation, and a one-layer HTS shield. The AC loss in this 10 m HTS conductor was 0.090 W m{sup -1} at 1 kA{sub rms} and 50 Hz. An HTS cable joint was designed and fabricated that included a three-layer HTS conductor and a one-layer HTS shield. Joint resistance of 5.2 n{omega} for the HTS conductor and that of 10 n{omega} for the HTS shield were achieved. The HTS cable joint was compact and had sufficient withstand voltage properties for 66/77 kV. In addition, we also confirmed the efficiency of joint construction. Moreover, a 20 m long HTS cable was successfully constructed and tested in January 2008. This HTS cable consisted of two 10 m HTS cables and the HTS cable joint. One 10 m HTS cable using HoBCO was made by Sumitomo, and the HTS cable joint and the other 10 m cable using IBAD YBCO were made by Furukawa and Chubu. The electrical resistance of the HTS cable joint was less than 10 n{omega}, and the 20 m HTS cable including the joint withstood an over-current of 31.5 kA{sub rms} whose duration was 2 s.

  11. Peri-operative risk factors associated with early tissue expander (TE) loss following immediate breast reconstruction (IBR): a review of 9305 patients from the 2005-2010 ACS-NSQIP datasets.

    Science.gov (United States)

    Fischer, John P; Nelson, Jonas A; Serletti, Joseph M; Wu, Liza C

    2013-11-01

    Early loss of an implant is a serious complication following breast reconstruction. We assess perioperative risk factors associated with tissue expander (TE) loss following immediate breast reconstruction (IBR) using the ACS-NSQIP datasets. We reviewed the 2005-2010 ACS-NSQIP databases identifying encounters for CPT codes for IBR using TE (19357). Patients were identified as experiencing a "loss of graft/prosthetic" based on a defined dataset variable. Patients who experienced a TE loss were compared to those who did not with respect to peri-operative characteristics. 9305 patients were identified who were on average 51.0 ± 10.5 years. Average length of stay was 1.7 ± 1.7 days. Patients experiencing early TE loss tended to have higher BMI (P TE loss also more frequently had longer operative times (P = 0.0002), total length of stay (P = 0.004), superficial surgical site infections (P = 0.004), and deep surgical infections (P 55 years) (OR = 2.0, P = 0.004), obesity (BMI ≥ 30 kg/m(2)) (OR = 1.7, P = 0.03), active smoking (OR = 4.0, P 1 SD above average) (OR = 2.2, P = 0.002), superficial wound infection (OR = 4.0, P = 0.002), and deep wound infection (OR = 9.1, P TE loss. Early TE loss is a complex multifactorial process likely related to identifiable preoperative, modifiable risk factors and postoperative complications. This analysis highlights previous work demonstrating of the added risk of age, obesity, and active smoking. Copyright © 2013 British Association of Plastic, Reconstructive and Aesthetic Surgeons. Published by Elsevier Ltd. All rights reserved.

  12. AC transport losses of simple cable conductors composed of Ag-sheathed Bi2223 high-T{sub c} superconducting tapes; Gin shisu Bi kei 2223 so koon chodendo tepu senzai wo mochiita kan'i shugo dotai no koryu tsuden sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Inada, R.; Kaneko, T.; Ota, A. [Toyohashi Univ. of Tech., Aichi (Japan); Fukunaga, T. [Gifu National College of Tech., Gifu (Japan)

    2000-05-25

    The AC transport loss properties under self-fields at 77 K have been investigated for simple cable conductors composed of 4 or 8 pieces of Ag-sheathed Bi2223 multifilamentary tape with different filament arrangements. The AC transport losses per cycle are nearly independent of frequency from 30 to 200 Hz for each conductor, indicating that the main contribution to losses comes from the hysteresis loss in the superconductor regardless of filament arrangements in the tape strand and the arrangement of tape strands in the conductors. The loss values of conductors strongly depend on the filament arrangements in the tape strands. The conductors composed of tape strands with sectioned filament arrangements have lower losses than those without sectioned filament arrangements, because the field-free core (FFC) in the former is sectioned into some parts in the filament group. The AC transport losses of cable conductors are also influenced by the number of tape strands. The loss values are decreased by increasing the number of tape strands, which is explained by calculated results for density distributions of AC transport losses per cycle in a tape strand. These results show that improvement in the filament arrangements in tape strands and the arrangement of tape strands in conductors are quite important to suppress the losses generated in cable conductors under AC current transmission. (author)

  13. Dielectric constant, loss factor and ac conductivity of Ni{sup 2+}-doped K{sub 2}ZnCl{sub 4} crystals in the ferroelectric-commensurate, incommensurate and normal phases

    Energy Technology Data Exchange (ETDEWEB)

    Gaffar, M.A. [Physics Department, School of Science and Engineering, American University in Cairo, Cairo 11511 (Egypt); Abousehly, A.M.; Mostafa, M.M. [Physics Department, Faculty of Science, Al-Azhar University, 71524 Assiut (Egypt); Abu El-Fadl, A. [Physics Department, Faculty of Science, Assiut University, 71516 Assiut (Egypt)

    2006-11-15

    The dielectric constant ({epsilon}), dielectric loss (tan{delta}) and ac conductivity ({sigma}{sub ac}) of virgin and thermally cycled undoped and Ni{sup 2+}-doped K{sub 2}ZnCl{sub 4}(KZC) crystals in the ferroelectric-commensurate (FC), incommensurate (IC) and normal phases (N) have been studied. Anomalous behaviour at the two-phase transition points was observed while measuring {epsilon} along the polar a-axis for the undoped sample. With increasing Ni {sup 2+}concentration a systematic shift of the phase transition temperature towards lower values and a continuous inhibition of the peak height were detected. {epsilon} changed linearly with lnf up to f=10{sup 5} Hz. tan {delta} along the a-axis declared the phase transitions by peak changes. After Ni {sup 2+}-doping this behaviour was preserved at the FC-IC phase transition point while the IC-N phase transition was manifested by a change in the slope of the straight line representing the tan {delta}-T dependence. The ac conductivity changed lineally with frequency according to a relation of the form {sigma}{sub ac}={sigma}{sub o} f{sup {beta}} where 0>{beta}>1.9{sigma}{sub ac} increased monotonically with increasing temperature and doping concentration in the low-temperature phases tending to merge in one straight-line with high activation energy that might be due to superionic dc conduction in the high temperature N-phase. Doping with Ni{sup 2+} pinned stripples, decreased the soliton-soliton interaction, weakened discommensuration effects, shortened the IC-phase and strongly affected the 'chaotic' behaviour at the T{sub C-IC}. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  14. Large A.C. machines theory and investigation methods of currents and losses in stator and rotor meshes including operation with nonlinear loads

    CERN Document Server

    Boguslawsky, Iliya; Hayakawa, Masashi

    2017-01-01

    In this monograph the authors solve the modern scientific problems connected with A.C. motors and generators, based first on the detailed consideration of their physical phenomena. The authors describe the theory and investigative methods they developed and applied in practice, which are considered to be of essential interest for specialists in the field of the electrical engineering industry in European countries, the USA, Argentina, and Brazil, as well as in such countries as India, China, and Iran. This book will be of interest to engineers specialized in the field of the manufacture, operation, and repair of A.C. machines (motors and generators) as well as electric drives; to professors, lecturers, and post-graduate students of technical universities, who are specializing in the field of electric machine engineering and electric drives; and to students who are engaged in the field of high current techniques, electric drives, and electric machine engineering.

  15. AC losses in superconducting parallel conductors (5). Dependence of the magnetization on the distance between the strands; Chodendo heiretsu dotai ni okeru koryu sonshitsu (5). Sosen kan kyori to jika

    Energy Technology Data Exchange (ETDEWEB)

    Nagasawa, M.; Tanaka, H.; Iwakuma, M.; Hunaki, K. [Kyushu University, Fukuoka (Japan)

    1999-11-10

    The transposition parallel conductor examines idea it is be and the electromagnetic property on us in order to attempt large current capacitating of the superconductive polycore line with the rectangular cross section. In the case of the transposition in the optimum position, when this deviated, though the shielding current is not induced between wires, the shielding current is induced, and the additive ac loss is generated. The quantitative evaluation of the magnetization by the shielding current is indispensable to this quantitative evaluation. The two parallel conductors were examined on the relation between magnetization and distance between wires by the shielding current from both sides of experiment and theory. (NEDO)

  16. AC Losses in Bi2Sr2Ca2Cu3O10+x Tapes and a 3.15-m-Long Single-Phase Cable

    DEFF Research Database (Denmark)

    Juul, Jeppe; Mølgaard, Ebsen T.; Jensen, Jens

    2011-01-01

    The alternating-current losses in superconducting multifilament BiSCCO-2223 tapes and a 3.15-m single-phase test cable were measured at 77 K using an electrical transport method. The cable had an inner diameter of 42 mm; it was composed of a single layer of 31 multifilament tapes and had a critical...... current of Ic = 4.1 kA. The measured losses of the tapes were found to be in good agreement with the Norris ellipse (NE) model. The losses of the cable were, for high currents, found to be bounded by the monoblock and independent NE models....

  17. AC transport losses for Ag-sheathed Bi2223 superconductor tapes; Gin shisu Bi2223 chodendo tepu senzai no koryu tsuden sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Kaneko, T.; Inada, R.; Ota, A. [Toyahashi Univ. of Tech., Aichi (Japan); Fukunaga, T. [Gifu National College of Tech., Gifu (Japan)

    1999-11-10

    The cable becomes cluster conductor, which consists of the multiple wire rods, when high temperature superconductivity wire rod is applied to the power cable. It is considered that this time, current distribution and self magnetic field in the wire rod inside also complicatedly change on the behavior of the alternating current loss, since it complicatedly changes by cross-sectional shape and combination configuration of the wire rod. In this study, the alternating current loss in compounding silver sheath Bi2223 superconductivity tape wire rod was measured, and the behavior was evaluated using numerical calculation. (NEDO)

  18. AC Losses in Bi2Sr2Ca2Cu3O10+x Tapes and a 3.15-m-Long Single-Phase Cable

    DEFF Research Database (Denmark)

    Juul, Jeppe Søgaard; Mølgaard, Esben Tore; Jensen, Jens

    2011-01-01

    The alternating-current losses in superconducting multifilament BiSCCO-2223 tapes and a 3.15-m single-phase test cable were measured at 77 K using an electrical transport method. The cable had an inner diameter of 42 mm; it was composed of a single layer of 31 multifilament tapes and had a critic...

  19. Studies of superspin glass state and AC-losses in La{sub 0.7}Sr{sub 0.3}MnO{sub 3} nanoparticles obtained by high-energy ball-milling

    Energy Technology Data Exchange (ETDEWEB)

    Phong, P.T., E-mail: ptphong.nh@khanhhoa.edu.vn [Department of Advanced Materials Chemistry, Dongguk University-Gyeongju, 707 Suckjang-dong, Gyeongbuk, Gyeongju-Si 780-714 (Korea, Republic of); Nha Trang Pedagogic College, 1 Nguyen Chanh Street, Khanh Hoa Province, Nha Trang City (Viet Nam); Manh, D.H. [Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay District, Ha Noi City (Viet Nam); Nguyen, L.H. [Nha Trang Pedagogic College, 1 Nguyen Chanh Street, Khanh Hoa Province, Nha Trang City (Viet Nam); Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay District, Ha Noi City (Viet Nam); Tung, D.K. [Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay District, Ha Noi City (Viet Nam); Phuc, N.X., E-mail: phucnx1949@gmail.com [Nha Trang Pedagogic College, 1 Nguyen Chanh Street, Khanh Hoa Province, Nha Trang City (Viet Nam); Lee, I.-J., E-mail: lij@dongguk.ac.kr [Department of Advanced Materials Chemistry, Dongguk University-Gyeongju, 707 Suckjang-dong, Gyeongbuk, Gyeongju-Si 780-714 (Korea, Republic of)

    2014-11-15

    Single-phase perovskite compound La{sub 0.7}Sr{sub 0.3}MnO{sub 3} was synthesized by a high-energy ball milling method. Nanoparticle nature of this manganite with the average particle diameter of 11 nm was revealed from structure and morphology characterizations. The results of ac magnetic susceptibility measurements show that the system can be described as an ensemble of interacting magnetic nanoparticles, which indicates that the dipole–dipole interactions are strong enough to create superspin glass state in the sample. Furthermore, the specific loss power which is exhausted on the irradiation of an ensemble of particles with a magnetic field has been calculated and measured experimentally. - Highlights: • LSMO nanopowder was prepared by the high-energy ball-milling method. • The superspin glass state of LSMO nanopowder was studied. • The SLP has been calculated and measured experimentally.

  20. Anomalies of AC susceptibility losses in the doped [Bi(Pb)]{sub 2}Sr{sub 2}Ca{sub 2}Cu{sub 3}O{sub x} superconductor

    Energy Technology Data Exchange (ETDEWEB)

    Mihalache, V [National Institute for Materials Physics, Bucharest-Magurele, PO Box MG-7, R-76900 (Romania); Aldica, G [National Institute for Materials Physics, Bucharest-Magurele, PO Box MG-7, R-76900 (Romania); Badica, P [National Institute for Materials Physics, Bucharest-Magurele, PO Box MG-7, R-76900 (Romania); Crisan, A [National Institute for Materials Physics, Bucharest-Magurele, PO Box MG-7, R-76900 (Romania)

    2004-04-01

    AC susceptibility measurements have been performed on Bi{sub 1.7}Pb{sub 0.4}Sr{sub 1.5}Ca{sub 2.5}Cu{sub 3.6}O{sub x} (Bi-2223) samples doped with different Li-based compounds and prepared by the solid-state method. As-prepared samples and/or samples annealed in oxygen or argon, ground or unground, have been investigated in detail in order to understand the occurrence, nature and evolution of the anomalous peaks observed in {chi}''(T) curves versus the measuring parameters; we have detected up to four peaks instead of the usual two peaks observed in the non-doped samples. It was found that intrinsic physical-chemical properties, such as the melting temperature of the doping compound, are no less important for the final properties of the superconductor than their insertion properties into the crystal lattice of Bi-2223. Doping compounds with melting temperatures below or close to the phase formation temperature of the Bi-2223 phase can act as flux, changing the growth conditions. Intensification of some processes against others (e.g. decomposition-recovery of the Bi-2223 phase, solubilization-precipitation of the secondary phases, changes in the properties of the liquid phase, etc) can lead to the formation of the Bi-2223 phase with different properties than for the non-doped superconductor. Generally, when using flux-type doping compounds, anomalous AC losses peaks are detected and the intra-granular critical current density is enhanced.

  1. Dismiss, upset and breach - just don’t suspend : the\\ud false dawn of damages for future losses. A case\\ud note on Edwards v Chesterfield Royal Hospital NHS\\ud Foundation Trust [2011] UKSC 58, [2012] 2 AC 22

    OpenAIRE

    Marson, James

    2013-01-01

    On 14 December 2011 the Supreme Court handed down its judgment regarding the extent to which damages awards in instances of dismissal can take into account future losses, see Edwards v Chesterfield Royal Hospital NHS Foundation Trust [2011] UKSC 58, [2012] 2 AC 22. The Court of Appeal ([2010] EWCA Civ 571) had held there was no principle of law why damages could not include future losses where an employer had breached the contract by not following contractual disciplinary and dismissal proce...

  2. California Condors AC2 and AC3

    African Journals Online (AJOL)

    AC8 4 Female of the Agua Blanca. Pair, taken into captivity on 6 June. 1986, released at Hopper Ranch on. 28 March 2000, shot by pig hunter on. Tejon Ranch in February 2003. SB#. 12. 4. AC9 - First chick ever seen hatched by the newly formed Condor Research. Center in 1980, captured for captive breeding on 19 April ...

  3. Low frequency ac conduction and dielectric relaxation in poly (N ...

    Indian Academy of Sciences (India)

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

  4. AC loss measurement of transposed / twister Ag-sheathed Bi round wires; Fuiramentosoku ni yori{center_dot}ten'i wo hodokoshita bisumasu kei marugata gin shisu chodendo senzai no koryu sonshitsu sokutei

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, N.; Torii, M. [Yokohama National Univ., Kanagawa (Japan). Faculty of Engineering; Sasaoka, T. [Hitachi Cable, Ltd., Tokyo (Japan)

    2000-05-29

    In superconductive wire of bismuth system, tape wire is main usage, but in the case of conductor for large current, round wire with assembles of twisted wire is advantageous. Transport loss and magnetization loss of pure Ag-sheathed Bi-2212 superconductive round wire was measured. This structure is one where three first filaments with fan type consisting of 54 filaments were bundled with second twisted structure. Transport loss of filament bundle was near Norris theoretical value regardless of transposition. It was confirmed from magnetization loss that loss by transverse field decreased by breaking of association of filaments and filament bundles. (NEDO)

  5. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  6. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  7. Exothermic reaction in zeolite hemostatic dressings: QuikClot ACS and ACS+.

    Science.gov (United States)

    Arnaud, Françoise; Tomori, Toshiki; Carr, Walter; McKeague, Anne; Teranishi, Kohsuke; Prusaczyk, Keith; McCarron, Richard

    2008-10-01

    Zeolites have hemostatic properties used to stop bleeding in severe hemorrhage. Manufactured QuikClot is an approved zeolite-based hemostatic agent for battlefield use. The exothermic reaction associated with QuikClot as loose granules or as granules packaged in a mesh bag has potential burn effects; this led to the development of a formulation of "cooler" non-exothermic QuikClot. The goal of this study was to compare the elevation of temperature of these formulations upon contact with blood. Following full transection of the femoral vasculature, anesthetized Yorkshire pigs (n = 15) (28.8 +/- 1.5 kg) were hemorrhaged for 2 min and treated with 100 g of bagged QuikClot (Advanced Clotting Sponge (ACS) (n = 4)) or a modified non-exothermic formulation (ACS+ (n = 11)). Vital signs and temperature at the dressing/tissue interface were continuously recorded for 3 h. Additional procedures were used to examine effects of different ratios of blood to zeolite on temperature elevation. Total post-treatment blood loss was comparable for ACS+_E and ACS_E groups (overall average: 18.6 +/- 10.5% EBV). Temperature recorded at the dressing/tissue interface was significantly lower with ACS+ vs. ACS (40.3 +/- 1.8 vs. 61.4 +/- 10.7 degrees C, respectively, p < 0.01) and was 3.2 +/- 2.6 degrees C higher than rectal temperature (38.0 +/- 0.7 degrees C, p < 0.01). Survival at endpoint (7/11 vs. 4/4) and average survival time (134 +/- 64 vs. 180 min) were greater for both ACS+ and ACS in comparison to Standard Dressing. The wound temperature with ACS was reduced with greater blood to product ratios and this pattern was paralleled with in vitro measurements. The lower heat release with ACS+ compared to ACS was confirmed in an animal model and ACS+ had similar efficacy in arresting bleeding when compared to Standard Dressing.

  8. AC/RF Superconductivity

    CERN Document Server

    Ciovati, G.

    2014-07-17

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  9. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  10. Design of high Tc superconducting transformer for rolling stick (2). Study for AC loss.; Tetsudo sharyo yo koon chodendo hen'atsuki no gainen sekkei (2). Koryu sonshitsu no kento.

    Energy Technology Data Exchange (ETDEWEB)

    Hata, H.; Kamijo, H.; Fujimoto, H. [Railway Technical Research Inst., Tokyo (Japan); Matsumura, K.; Iwakuma, M.; Funaki, K. [Kyushu Univ., Kyushu (Japan)

    2000-05-29

    There is a superconductive advantage for high current density energization, which originates for this with the low loss-ness. It can expect the drastic lightening by that is to say, it reduces the magnetic loading design basic parameter 1 turn voltages, and increasing the electric loading, when the superconductive technology was applied to the transformer. This time, the quantitative examination is reported, because we did it on the assumption of the adoption of present oxide superconducting wire rod in the superconduction of the transformer for the rolling stock. (NEDO)

  11. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  12. Parallel ac-ac converters using master-slave control

    Science.gov (United States)

    Taufik

    The objective of this study is to develop a parallel ac-ac converter that can be implemented as a means of connecting ac generators in parallel. The most important goal of the parallel converter in this study is to obtain equal current sharing performance among the paralleled generators such that an economically optimal solution for production cost of electricity can be accomplished. At the same time, voltage regulation and stability of the parallel system upon changes of different sizes and load types are to be maintained. Use of the available parallel converter method and voltage inversion technique leads to the formulation of a new solution technique for parallel operation of ac generators. The proposed parallel ac-ac converter involves Sinusoidal Pulse Width Modulation inverter combined with a control scheme called the Stationary Master-Slave control that uses voltage feedback loop and designates one generator unit as the master. The study involves numerous computer simulations to verify the feasibility of the parallel ac-ac converters. In doing so, as many as five models are considered including Current Control Current Source model, PI model, PI-PWM model, PI-PWM model with MOSFETs, and PI-PWM model with real MOSFET model. The results of the simulations show that the parallel ac-ac converter not only successfully provides the current sharing property among the paralleled units but also maintains system stability during changes in load demand. Further research work is suggested to address extensions to parallel ac-dc and dc-ac systems, hardware setup of at least two turbogenerators to test and verify the proposed approach, dynamic analysis to ensure system stability, and implementations of other types of Master-Slave control schemes to improve redundancy.

  13. Single-Phase Direct Boost AC-AC Converter

    Directory of Open Access Journals (Sweden)

    URSARU, O.

    2017-11-01

    Full Text Available This paper introduces and studies a boost AC-AC converter circuit that can be used to supply power to the 220V receivers in the 110V grids or to increase and adjust voltage at the end of long lines. High frequency AC-AC converters have better specifications than alternative voltage phase control drives with thyristors or TRIACs. When frequency exceeds 20kHz, noise is eliminated, filters are smaller and efficiency is higher. The current waveform is much better, the output voltage can be higher than the input voltage and voltage control is more accurate.

  14. AC Electrokinetics: Applications for Nanotechnology

    OpenAIRE

    Hughes, MP

    2000-01-01

    The phenomena of dielectrophoresis and electrorotation, collectively referred to as AC electrokinetics, have been used for many years to study, manipulate and separate particles on the nanotechnology, that is the precise manipulation of particles on the nanometre scale. In this paper we present the principles of AC electrokinetics for particle manipulation, review the current state of AC Electrokinetic techniques for the manipulation of particles on the nanometre scale, and consid...

  15. Loss comparison of different nine-switch and twelve-switch energy conversion systems

    DEFF Research Database (Denmark)

    Bahman, Amir Sajjad; Loh, Poh Chiang; Qin, Zian

    2014-01-01

    with an answer only available after performing a thorough analysis. For that, it is the intention now to compare the nine-switch and twelve-switch converters when they are used in ac-ac, ac-dc, dc-ac or dc-dc energy conversion systems. Their losses will be compared to identify when the nine-switch converter...

  16. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  17. Electricity-AC versus DC

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Electricity - AC versus DC. D P Sen Gupta. General Article Volume 2 Issue 10 October 1997 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/10/0046-0053. Author Affiliations.

  18. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  19. A dual-stage pwm dc to ac inverter with reduced harmonic distorsion ...

    African Journals Online (AJOL)

    In conventional pulse width modulated full bridge dc to ac inverters, all power devices are switched at high frequency and are consequently subject to significant power losses. This paper presents a modified dc to ac inverter topology where the high frequency switching is performed by a single device in a pre-converter ...

  20. Low frequency ac conduction and dielectric relaxation in poly(N ...

    Indian Academy of Sciences (India)

    Unknown

    Abstract. The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investi- gated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc ...

  1. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  2. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  3. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

    2009-01-01

    of semiconductor commutations, and hence, no increase in switching losses. The proposed converter therefore offers a low-cost alternative to applications that need to ride through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype......This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

  4. AC susceptibility as a characterization tool for coated conductor tapes

    Science.gov (United States)

    Gömöry, F.; Vojenčiak, M.; Solovyov, M.; Frolek, L.; Šouc, J.; Seiler, E.; Bauer, M.; Falter, M.

    2017-11-01

    The measurement and analysis of magnetic AC susceptibility is a useful tool in the study of superconductor (SC) materials. Exposure of a sample to a magnetic field changing in time generates loops of electrical currents that are detectable in a contactless way with the help of a suitable pick-up system. In this paper the applicability of this technique in the characterization and quality control of coated conductor (CC) tapes is evaluated. First we recollect the essential results of the analytical theory derived for thin SC strips and their extrapolation to strips with finite thickness. From the analytical expressions one can see how the properties of CC tape that are important for application in electric power devices, namely its critical current and AC loss, can be deduced from AC susceptibility data in straightforward way. The main focus of our study is to investigate the influence that various cases of non-uniformities in SC layer exhibit on the magnetic properties examined in an AC regime. Numerical computations were used to explore the consequences of lateral variation in the critical current density. Predictions derived for some model cases were compared with experimental findings. A dedicated experiment was also carried out to demonstrate that a transverse scratch that would be detrimental for DC transport could sneak unobserved through the AC magnetic experiment on a long sample. Our study shows that the analysis of both parts of the complex magnetic susceptibility in place of a mere AC loss determination in a common AC magnetization experiment is worth the additional effort.

  5. Control Aspects for Energy-Efficient and Sensorless AC Motor Drives

    OpenAIRE

    Qu, Zengcai

    2015-01-01

    This research proposes control methods for improving the energy efficiency and stability of sensorless AC motor drives. The study focuses on induction motors (IMs) and synchronous reluctance motors (SyRMs). Loss-minimizing methods are developed for both IM and SyRM drives. The loss-minimizing control applies dynamic space-vector motor models which take into account hysteresis losses and eddy-current losses as well as the magnetic saturation. The minimum points of the loss function are numeric...

  6. An H2A Histone Isotype, H2ac, Associates with Telomere and Maintains Telomere Integrity.

    Directory of Open Access Journals (Sweden)

    Chia-Hsin Su

    Full Text Available Telomeres are capped at the ends of eukaryotic chromosomes and are composed of TTAGGG repeats bound to the shelterin complex. Here we report that a replication-dependent histone H2A isotype, H2ac, was associated with telomeres in human cells and co-immunoprecipitates with telomere repeat factor 2 (TRF2 and protection of telomeres protein 1 (POT1, whereas other histone H2A isotypes and mutations of H2ac did not bind to telomeres or these two proteins. The amino terminal basic domain of TRF2 was necessary for the association with H2ac and for the recruitment of H2ac to telomeres. Depletion of H2ac led to loss of telomeric repeat sequences, the appearance of dysfunctional telomeres, and chromosomal instability, including chromosomal breaks and anaphase bridges, as well as accumulation of telomere-associated DNA damage factors in H2ac depleted cells. Additionally, knockdown of H2ac elicits an ATM-dependent DNA damage response at telomeres and depletion of XPF protects telomeres against H2ac-deficiency-induced G-strand overhangs loss and DNA damage response, and prevents chromosomal instability. These findings suggest that the H2A isotype, H2ac, plays an essential role in maintaining telomere functional integrity.

  7. Hearing loss

    Science.gov (United States)

    Decreased hearing; Deafness; Loss of hearing; Conductive hearing loss; Sensorineural hearing loss; Presbycusis ... Symptoms of hearing loss may include: Certain sounds seeming too loud Difficulty following conversations when two or more people are talking ...

  8. AC Cable: Yokohama Project

    Science.gov (United States)

    Masuda, Takato

    High Temperature Superconducting (HTS) cables can transmit large amounts of electricity in a compact size with minimal losses. Therefore, they are expected to save the construction cost of underground lines in urban areas and decrease transmission losses. Several HTS cables have recently been demonstrated in networks around the world, and full-scale commercialization is expected in the near future. In Japan, the development of compact HTS cables suitable for urban deployment has been underway since the early 1990s. In 2007, a national project was started to verify their operational performance and long-term reliability in the grid. An HTS cable 240 m long was installed at the Asahi substation of the Tokyo Electric Power Company (TEPCO) in Yokohama; then a joint, terminations and cooling system was constructed in 2011. After successful performance tests, the cable was connected to the grid for the first time in Japan, and started to deliver electricity to 70,000 households in October 2012. This trouble-free in-grid service continued for over a year. We can conclude that the HTS cable system performs well and has the stability required for long-term in-grid operations.

  9. Converting DC trains to AC operation using converters; Umstellung von DC-Bahnen auf AC-Betrieb mit Umrichtern

    Energy Technology Data Exchange (ETDEWEB)

    Schuette, Thorsten [Atkins Sverige AB, Vaesteraas (Sweden); Behmann, Uwe

    2012-01-15

    Nowadays, powerful DC trains run in interconnected overhead line contact systems. Converting them to AC operation in the conventional way, i.e. using phase-changing substations or even transformers, means new disadvantages to both the trains and the 3AC operators. Among these disad-vantages are power peaks that occur when catching up on speed losses after idling runs in phase separation sections. Static converters now again permit an interconnection of the line systems which allows a conversion to be re-assessed. (orig.)

  10. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  11. VVCF AC-AC Converters Using Single Bridge Circuit

    Science.gov (United States)

    Neba, Yasuhiko; Matsumoto, Hirokazu; Itoh, Ryozo; Ishizaka, Kouichi

    Single-phase and three-phase voltage source converters with variable voltage and constant frequency ac-ac conversion are presented. These converters are a single bridge circuit of two legs for single-phase conversion and of three legs for three-phase, respectively. Both the power source and the load are connected to bridge legs. The normal PWM methods with the sinusoidal modulating and the triangular carrier waves are used for the converters. The experimental results confirm that the PWM converters can generate the sinusoidal input/output currents.

  12. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  13. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  14. AcEST: BP920378 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Actin OS=Histriculus cavicola PE=3 SV=2 55 1e-07 sp|P26182|ACT_ACHBI Actin OS=Ac...V=1 55 1e-07 sp|P17128|ACT_KLULA Actin OS=Kluyveromyces lactis GN=ACT PE=3 SV=2 55 1e-07 sp|O00937|ACT_HISCA

  15. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  16. AcEST: BP921278 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ac... 30 2.9 sp|Q01042|IE68_SHV21 Immediate-early protein OS=Saimiriine herpe... 30 2.9 sp|Q8CFW7|C2D2A_MOUS...PSPAPSLEES---HRPGSQTSSHPSSSVSSSPSQMDHHSE 418 >sp|Q01042|IE68_SHV21 Immediate-earl

  17. STIMULATION OF RENIN SECRETION BY CATECHOLAMINES IS DEPENDENT ON ADENYLYL CYCLASES AC5 AND AC6

    Science.gov (United States)

    Aldehni, Fadi; Tang, Tong; Madsen, Kirsten; Plattner, Michael; Schreiber, Andrea; Friis, Ulla G.; Hammond, H. Kirk; Han, Pyung Lim; Schweda, Frank

    2011-01-01

    The sympathetic nervous system stimulates renin release from juxtaglomerular cells via the ß-adrenoreceptor - cAMP pathway. Recent in vitro studies have suggested that the calcium-inhibited adenylyl cyclases AC5 and AC6 possess key roles in the control of renin exocytosis. In order to investigate the relative contribution of AC5 and AC6 to the regulation of renin release in vivo we performed experiments using AC5 and AC6 knockout mice. Male AC5−/− mice exhibited normal plasma renin concentrations (PRC), renal renin synthesis (mRNA and renin content), urinary volume and systolic blood pressure. In male AC6−/− mice, PRC (AC6−/−: 732 ± 119, AC6 +/+: 436 ± 78 ng angI/h*ml, p renin synthesis were stimulated associated with an increased excretion of dilute urine (1.55-fold, p renin release from isolated perfused kidneys were attenuated to a higher extent in AC6−/− (−51 to −98% vs. AC6+/+) than in AC5−/− (−31 to 46% vs. AC5+/+). In conclusion, both AC5 and AC6 are involved in the stimulation of renin secretion in vivo, and AC6 is the dominant isoforms in this process. PMID:21282557

  18. AcEST: DK955839 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Heat shock protein 70 OS=Cucumis sativus ... 320 3e-86 tr|Q8GSN4|Q8GSN4_CUCMA Non-cell-autonomous... MVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMR 174 >tr|Q8GSN3|Q8GSN3_CUCMA Non-cell-autonomous heat sho...3|Q8GSN3_CUCMA Non-cell-autonomous heat shock cognate pr... 324 3e-87 tr|Q67BD0|Q67BD0_TOBAC Heat shock prot...iva subs... 324 2e-87 tr|B8AC06|B8AC06_ORYSI Putative uncharacterized protein OS=Oryza... 324 2e-87 tr|Q8GSN

  19. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    The proposed DPFM can be used for AC low voltage (LV) autonomous microgrid systems with added advantages of remedying the dependency on voltage level and R/X ratio in the formulation itself. DPFM is applied on a 10 bus, low voltage, microgrid system giving a better voltage profile.. Keywords: Microgrid (MG) ...

  20. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  1. Tomato ACS4 is necessary for timely start of and progression through the climacteric phase of fruit ripening

    Directory of Open Access Journals (Sweden)

    Suzanne eHoogstrate

    2014-09-01

    Full Text Available Climacteric fruit ripening, as it occurs in many fruit crops, depends on a rapid, autocatalytic increase in ethylene production. This agriculturally important process has been studied extensively, with tomato simultaneously acting both as a model species and target crop for modification. In tomato, the ethylene biosynthetic genes ACC SYNTHASE2 (ACS2 and ACS4 are highly expressed during fruit ripening, with a combined loss of both ACS2 and ACS4 activity preventing generation of the ethylene burst necessary for fruit ripening. However, the individual roles and importance of ACS2 and ACS4 have not been determined. In this study, we examined specifically the role of ACS4 by comparing the phenotype of an acs4 mutant firstly with that of the wild-type, and secondly with two novel ripening-inhibitor (rin mutants. Ethylene production during ripening was significantly reduced in both acs4-1, and rin lines, with rin genotypes showing the weaker ethylene burst. Also i the time between anthesis and the start of fruit ripening and ii the time required to progress through ripening were significantly longer in acs4-1 than in the wild type, but shorter than in the strongest rin mutant. The delay in ripening was reflected in the lower expression of ripening-related transcripts during the mature green and light red ripening stages. Furthermore, expression of ACS2 and ACS4 was strongly dependent on a functional RIN gene, while ACS2 expression was largely independent of ACS4. Altogether, we show that ACS4 is necessary for normal progression of tomato fruit ripening and that mutation of this gene may provide a useful means for altering ripening traits.

  2. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  3. Memory loss

    Science.gov (United States)

    ... amnesia (sudden, temporary loss of memory) of unclear cause Transient ischemic attack (TIA) or stroke Hydrocephalus (fluid collection in the brain) Sometimes, memory loss occurs with mental health problems, such as: After a major, traumatic or stressful ...

  4. Hair Loss

    Science.gov (United States)

    ... overall hair thinning and not bald patches. Full-body hair loss. Some conditions and medical treatments, such as ... in the loss of hair all over your body. The hair usually grows back. Patches of scaling that spread ...

  5. Development of an AC Module System: Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Suparna Kadam; Miles Russell

    2012-06-15

    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  6. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  7. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  8. Experiencing Loss

    DEFF Research Database (Denmark)

    Kristiansen, Maria; Younis, Tarek; Hassani, Amani

    2015-01-01

    , who narrates her experience of losing herhusband to lung cancer. By drawing on a religious framework, Aisha creates meaning fromher loss, which enables her to incorporate this loss into her life history and sustain agency.Her narrative invites wider audiences to witness her tale of overcoming loss...

  9. AcEST: DK949342 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 31 ACYNCGESGHLARDCPSE 84 AC+NCGESGH A DCP++ Sbjct: 741 A...270 Score = 37.0 bits (84), Expect = 0.030 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame...= 36.6 bits (83), Expect = 0.040 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 34 CYNC... (79), Expect = 0.12 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 34 CYNCGESGHLARDCPS...6 (62%), Positives = 15/16 (93%) Frame = +1 Query: 34 CYNCGESGHLARDCPS 81 CY CG++GH++RDCP+ Sbjct: 170 CYKCGD

  10. Estimation of Transformer Parameters and Loss Analysis for High Voltage Capacitor Charging Application

    DEFF Research Database (Denmark)

    Thummala, Prasanth; Schneider, Henrik; Ouyang, Ziwei

    2013-01-01

    In a bi-directional DC-DC converter for capacitive charging application, the losses associated with the transformer makes it a critical component. In order to calculate the transformer losses, its parameters such as AC resistance, leakage inductance and self capacitance of the high voltage (HV......) winding has to be estimated accurately. This paper analyzes the following losses of bi-directional flyback converter namely switching loss, conduction loss, gate drive loss, transformer core loss, and snubber loss, etc. Iterative analysis of transformer parameters viz., AC resistance, leakage inductance...

  11. AcEST: BP919060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |VW5B1_MOUSE von Willebrand factor A domain-containing ... 43 0.001 sp|Q75WE7|LHR2A_RAT Loss of heterozygosi...0.030 sp|Q99KC8|LHR2A_MOUSE Loss of heterozygosity 11 chromosomal regi... 37 0.05...1 sp|P19823|ITIH2_HUMAN Inter-alpha-trypsin inhibitor heavy chain ... 32 0.084 sp|O00534|LHR2A_HUMAN Loss of...KEAMLVALKSLMPACFFNII 392 >sp|Q75WE7|LHR2A_RAT Loss of heterozygosity 11 chromosomal region 2 gene A protein ...MI 497 +SL FN+I Sbjct: 389 KSLMPACLFNII 400 >sp|Q99KC8|LHR2A_MOUSE Loss of heterozygosity 11 chromosomal reg

  12. AcEST: BP920277 [AcEST

    Lifescience Database Archive (English)

    Full Text Available p_hit_id A8E5U3 Definition sp|A8E5U3|L12R1_XENTR Loss of heterozygosity 12 chromosomal region 1 protein homo...core E Sequences producing significant alignments: (bits) Value sp|A8E5U3|L12R1_XENTR Loss of heterozygosity... 12 chromosomal regi... 35 0.25 sp|Q5PPY2|L12R1_XENLA Loss of heterozygosity 12 chromosomal regi... 35 0.25 ...n scabrous OS=Drosophila melanogaster ... 30 8.1 >sp|A8E5U3|L12R1_XENTR Loss of h...ct: 96 YQEHLHQCAEAVSFDQNALVKRIKEMDSSVD-GLYSLMQERQKRFAKYAEQIQK 148 >sp|Q5PPY2|L12R1_XENLA Loss of heterozygos

  13. AcEST: BP921262 [AcEST

    Lifescience Database Archive (English)

    Full Text Available (bits) Value sp|Q09130|IF2G_SCHPO Eukaryotic translation initiation factor 2 ... 32 1.7 sp|O00534|LHR2A_HUMAN Loss... of heterozygosity 11 chromosomal regi... 31 2.9 sp|Q75WE7|LHR2A_RAT Loss of heterozygosity 11 chromo...somal region... 30 5.0 sp|Q99KC8|LHR2A_MOUSE Loss of heterozygosity 11 chromosoma...ISGVHTVRFKNELERNITIKLGYANAKIYKCSNEECP----RPGC 83 Query: 348 TRMY 359 R Y Sbjct: 84 YRSY 87 >sp|O00534|LHR2A_HUMAN Loss... SGGT FI + R+Q + + L + +DV Sbjct: 418 SFGIGEGTSTSLIKGIARASGGTSEFITGKDRMQSKALRTLKRSLQPVVEDV 469 >sp|Q75WE7|LHR2A_RAT Loss

  14. AcEST: DK955175 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sult : Swiss-Prot sp_hit_id O00534 Definition sp|O00534|LHR2A_HUMAN Loss of heterozygosity 11 chromosomal re...............done Score E Sequences producing significant alignments: (bits) Value sp|O00534|LHR2A_HUMAN Loss... of heterozygosity 11 chromosomal regi... 39 0.017 sp|Q75WE7|LHR2A_RAT Loss of heterozygosity 11 chromosomal... region... 36 0.083 sp|Q99KC8|LHR2A_MOUSE Loss of heterozygosity 11 chromosomal r...3orf62 OS=Homo sa... 30 7.8 >sp|O00534|LHR2A_HUMAN Loss of heterozygosity 11 chromosomal region 2 gene A pro

  15. AC electrothermal technique in microchannels

    Science.gov (United States)

    Salari, Alinaghi; Navi, Maryam; Dalton, Colin

    2017-02-01

    Electrokinetic techniques have a wide range of applications in droplet, particle, and fluid manipulation systems. In general, they can be categorized into different subgroups including electroosmosis, electrothermal, electrophoresis, dielectrophoresis, etc. The AC electrothermal (ACET) technique has been shown to be very effective in applications which involve high conductivity fluids, such as blood, which are typically used in biomedical applications. In the past few years, the ACET effect has received considerable attention. Unlike AC electroosmosis (ACEO), the ACET effect shows plateaus in force in a wide frequency range. In other words, with electrothermal force, velocity is more steady and predictable at different frequencies, compared to ACEO and dielectrophoresis (DEP). Although electrothermal microflows form as a result of Joule heating in the fluid, due to high conduction of heat to the ambience, the temperature rise in the fluid is not so high as to threaten the nature of the biofluids. The average temperature rise resulting from the ACET effect is below 5 °K. In order to generate high strength AC electric fields, microfabricated electrode arrays are commonly used in microchannels. For pumping applications, it is essential to create asymmetry in the electric field, typically by having asymmetrical electrode pairs. There is no defined border between many electrokinetic techniques, and as such the point where electrothermal processes interferes with other electrokinetic techniques is not clear in the literature. In addition, there have been comprehensive reviews on micropumps, electrokinetics, and their subcategories, but the literature lacks a detailed up-to-date review on electrothermal microdevices. In this paper, a brief review is made specifically on electric fields in ACET devices, in order to provide an insight for the reader about the importance of this aspect of ACET devices and the improvements made to date.

  16. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.

    2017-07-21

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.

  17. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  18. imulation Results of Single Stage AC- AC Converter for Induction Heating

    OpenAIRE

    S. ARUMUGAM; S.Rama Reddy

    2010-01-01

    This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBT...

  19. Influence of SDBD plasma aerodynamic actuation on flow control by AC power supply and AC-DC power supply

    Science.gov (United States)

    Hu, Xu; Gao, Chao; Hao, Jiangnan

    2018-01-01

    In this paper, the excitation effect of single dielectric barrier discharge plasma actuator (SDBD) is compared by using AC power supply and AC-DC power supply. AC-DC power supply is based on the AC power supply, just adding DC component. The flow measurement is carried out by PIV technique. Results show that the excitation effect of AC power supply and AC-DC power supply increases by the increase of voltage, the range of speed field excited by AC power is greater than that of AC-DC power supply. For x direction maximum speed, excited by AC power supply is close to AC-DC, and for y direction maximum speed, AC power supply is greater than AC-DC power supply. So the excitation effect of AC power supply is better than that of AC-DC power supply for SDBD.

  20. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  1. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  2. Hair Loss

    Science.gov (United States)

    ... to treat acne, bipolar disorder, and ADHD. Diet pills that contain amphetamines also can cause hair loss. Alopecia areata (pronounced: al-uh-PEE-shuh air-ee-AH-tuh) . This skin disease causes hair ...

  3. High Frequency AC Inductor Analysis and Design for Dual Active Bridge (DAB) Converters

    DEFF Research Database (Denmark)

    Zhang, Zhe; Andersen, Michael A. E.

    2016-01-01

    The dual active bridge (DAB) converter is an isolated bidirectional dc-dc topology which is the most critical part for the power conversion systems such as solid-state transformers (SST). This paper focuses on analysis and design of high frequency ac inductors which are the power interfacing...... the core loss and the winding loss are almost equal is selected as the optimal one. The experimental results are presented to verify the validity of the analysis and design....

  4. AC-DC integrated load flow calculation for variable speed offshore wind farms

    DEFF Research Database (Denmark)

    Zhao, Menghua; Chen, Zhe; Blaabjerg, Frede

    2005-01-01

    This paper proposes a sequential AC-DC integrated load flow algorithm for variable speed offshore wind farms. In this algorithm, the variable frequency and the control strategy of variable speed wind turbine systems are considered. In addition, the losses of wind turbine systems and the losses...... of converters are also integrated into the load flow algorithm. As a general algorithm, it can be applied to different types of wind farm configurations, and the load flow is related to the wind speed....

  5. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  6. Exenatide: AC 2993, AC002993, AC2993A, exendin 4, LY2148568.

    Science.gov (United States)

    2004-01-01

    Exenatide [AC002993, AC2993A, AC 2993, LY2148568, exendin 4], a glucagon-like peptide-1 (GLP-1) agonist, is a synthetic exendin 4 compound under development with Amylin Pharmaceuticals for the treatment of type 2 diabetes. Both exendin 4 and its analogue, exendin 3, are 39-amino acid peptides isolated from Heloderma horridum lizard venom that have different amino acids at positions 2 and 3, respectively. Exendins are able to stimulate insulin secretion in response to rising blood glucose levels, and modulate gastric emptying to slow the entry of ingested sugars into the bloodstream. Amylin Pharmaceuticals acquired exclusive patent rights for the two exendin compounds (exendin 3 and exendin 4) from the originator, Dr John Eng (Bronx, NY, US). On 20 September 2002, Amylin and Eli Lilly signed a collaborative agreement for the development and commercialisation of exenatide for type 2 diabetes. Under the terms of the agreement, Eli Lilly has paid Amylin a licensing fee of 80 million US dollars and bought Amylin's stock worth 30 million US dollars at 18.69 US dollars a share. After the initial payment, Eli Lilly will pay Amylin up to 85 US dollars million upon reaching certain milestones and also make an additional payment of up to 130 million US dollars upon global commercialisation of exenatide. Both companies will share the US development and commercialisation costs, while Eli Lilly will pick up up to 80% of development costs and all commercialisation costs outside the US. Amylin and Eli Lilly will equally share profit from sales in the US, while Eli Lilly will get 80% of the profit outside the US and Amylin will get the rest. This agreement has also enabled Amylin to train its sales force to co-promote Lilly's human growth hormone Humatrope. Alkermes will receive research and development funding and milestone payments, and also a combination of royalty payments and manufacturing fees based on product sales. Alkermes undertakes the responsibility for the development

  7. AC Electrokinetic Phenomena Generated by Microelectrode Structures

    Science.gov (United States)

    Hart, Robert; Oh, Jonghyun; Capurro, Jorge; Noh, Hongseok (Moses)

    2008-01-01

    The field of AC electrokinetics is rapidly growing due to its ability to perform dynamic fluid and particle manipulation on the micro- and nano-scale, which is essential for Lab-on-a-Chip applications. AC electrokinetic phenomena use electric fields to generate forces that act on fluids or suspended particles (including those made of dielectric or biological material) and cause them to move in astonishing ways1, 2. Within a single channel, AC electrokinetics can accomplish many essential on-chip operations such as active micro-mixing, particle separation, particle positioning and micro-pattering. A single device may accomplish several of those operations by simply adjusting operating parameters such as frequency or amplitude of the applied voltage. Suitable electric fields can be readily created by micro-electrodes integrated into microchannels. It is clear from the tremendous growth in this field that AC electrokinetics will likely have a profound effect on healthcare diagnostics3-5, environmental monitoring6 and homeland security7. In general, there are three AC Electrokinetic phenomena (AC electroosmosis, dielectrophoresis and AC electrothermal effect) each with unique dependencies on the operating parameters. A change in these operating parameters can cause one phenomena to become dominant over another, thus changing the particle or fluid behavior. It is difficult to predict the behavior of particles and fluids due to the complicated physics that underlie AC electrokinetics. It is the goal of this publication to explain the physics and elucidate particle and fluid behavior. Our analysis also covers how to fabricate the electrode structures that generate them, and how to interpret a wide number of experimental observations using several popular device designs. This video article will help scientists and engineers understand these phenomena and may encourage them to start using AC Electrokinetics in their research. PMID:19066515

  8. Hair Loss

    Science.gov (United States)

    ... hair if you have certain diseases, such as thyroid problems, diabetes, or lupus. If you take certain medicines or have chemotherapy for cancer, you may also lose your hair. Other causes are stress, a low protein diet, a family history, or poor nutrition. Treatment for hair loss depends ...

  9. Hearing Loss

    Science.gov (United States)

    ... birth defects and other medical conditions run in families, and how they can affect your health and your baby's health. There are ... Too Soon Global Map Premature birth report card Careers Archives ... Family health & safety Complications & Loss Pregnancy complications Preterm labor & ...

  10. Alternating current losses of a 10 metre long low loss superconducting cable conductor determined from phase sensitive measurements

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten

    1999-01-01

    The ac loss of a superconducting cable conductor carrying an ac current is small. Therefore the ratio between the inductive (out-of-phase) and the resistive (in-phase) voltages over the conductor is correspondingly high. In vectorial representations this results in phase angles between the current......-in amplifiers can be exploited. In this paper we present the results from ac-loss measurements on a low loss 10 metre long high temperature superconducting cable conductor using such a correction scheme. Measurements were carried out with and without a compensation circuit that could reduce-the inductive...... voltage. The 1 mu V cm(-1) critical current of the conductor was 3240 A at 77 K. At an rms current of 2 kA (50 Hz) the ac loss was derived to be 0.6 +/- 0.15 W m(-1). This is, to the best of our knowledge, the lowest value of ac loss of a high temperature superconducting cable conductor reported so far...

  11. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  12. AC-DC Power Processor, Type I.

    Science.gov (United States)

    1979-11-01

    output vol taqv S ice the out put rectifiers drop is a 1 arqe percentaote of the output voltate value. F i ure 24 Ows5 the out put impedance of the AC-I)C...65- TABLE XII- AC-DC POWER PROCESSOR TEMPERATURE PROFILE AT 83"F AMBIENT (COMPONENT AND UNIT TEMPERATURES AT END OF 72 HOUR TESI ) T.C. NO. LOCATION

  13. AC susceptibility in NbTi multifilamentary wires; NbTi gokusai tashinsen no koryu taijiritsu

    Energy Technology Data Exchange (ETDEWEB)

    Maeda, R.; Muranaka, T.; Akune, T.; Sakamoto, N. [Kyushu Sangyo Univ., Fukuoka (Japan). Dept. of Electrical Engineering

    1999-06-07

    In the superfine polycore line, the matrix shows the weakness superconductivity by affection broth of the electron pair from the NbTi filament. The filament of the polycore line is made to combine by this, and we cause magnetization and ac losses, increase in magnetic flux creep, etc.. It is possible to obtain superconductive critical current density J{sub cp} of the matrix by the proximity effect from twist pitch l{sub p} dependence of magnetization M. Here, the relation with the peak in the imaginary part of ac magnetic susceptibility is reported on evaluation and result of examining. (NEDO)

  14. Microtubule alignment and manipulation using AC electrokinetics.

    Science.gov (United States)

    Uppalapati, Maruti; Huang, Ying-Ming; Jackson, Thomas N; Hancock, William O

    2008-09-01

    The kinesin-microtubule system plays an important role in intracellular transport and is a model system for integrating biomotor-driven transport into microengineered devices. AC electrokinetics provides a novel tool for manipulating and organizing microtubules in solution, enabling new experimental geometries for investigating and controlling the interactions of microtubules and microtubule motors in vitro. By fabricating microelectrodes on glass substrates and generating AC electric fields across solutions of microtubules in low-ionic-strength buffers, bundles of microtubules are collected and aligned and the electrical properties of microtubules in solution are measured. The AC electric fields result in electro-osmotic flow, electrothermal flow, and dielectrophoresis of microtubules, which can be controlled by varying the solution conductivity, AC frequency, and electrode geometry. By mapping the solution conductivity and AC frequency over which positive dielectrophoresis occurs, the apparent conductivity of taxol-stabilized bovine-brain microtubules in PIPES buffer is measured to be 250 mS m(-1). By maximizing dielectrophoretic forces and minimizing electro-osmotic and electrothermal flow, microtubules are assembled into opposed asters. These experiments demonstrate that AC electrokinetics provides a powerful new tool for kinesin-driven transport applications and for investigating the role of microtubule motors in development and maintenance of the mitotic spindle.

  15. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  16. Loss Networks

    OpenAIRE

    Kelly, F. P.

    1991-01-01

    This paper describes work on the stochastic modelling of loss networks. Such systems have long been of interest to telephone engineers and are becoming increasingly important as models of computer and information systems. Throughout the century problems from this field have provided an impetus to the development of probability theory, pure and applied. This paper provides an introduction to the area and a review of recent work.

  17. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  18. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing wireless...

  19. Frequency Dependent Losses in Transmission Cable Conductors

    DEFF Research Database (Denmark)

    Olsen, Rasmus Schmidt; Holbøll, Joachim; Guðmundsdóttir, Unnur Stella

    2011-01-01

    and economical gain, such severe network changes necessitate correct estimation and optimisation of load conditions in the cable grid. Both IEC and IEEE have published standards for rating transmission cables' current carrying capacity. These standards are based on assumptions of a number of parameters......, such as thermal conditions in and around the cable, as well as the heat generated in conductors, screens, armours etc., taking into account proximity and skin effects. The work performed and presented in this paper is concerned with an improved determination of the losses generated in the conductor, by means...... of better calculation of the AC resistance of transmission cable conductors, in particular regarding higher frequencies. In this way, also losses under harmonics can be covered. Furthermore, the model is suitable for modelling of transient attenuation in high voltage cables. The AC resistance is calculated...

  20. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift

  1. Dielectric and AC Conductivity Studies in PPy-Ag Nanocomposites

    Directory of Open Access Journals (Sweden)

    K. Praveenkumar

    2015-01-01

    Full Text Available Polypyrrole and silver nanoparticles have been synthesized at 277 K by chemical route. Nanoparticles of polypyrrole-silver (PPy-Ag composites were prepared by mixing polypyrrole and silver nanoparticles in different weight percentages. Dielectric properties as a function of temperature in the range from 300 K to 550 K and frequency in the range from 50 Hz to 1 MHz have been measured. Dielectric constant decreased with increase in frequency and temperature. Dielectric loss decreased with increase in frequency and increased with increase in temperature. Using dielectric data AC conductivity has been determined. Conductivity was found to be in the order of 10−3 (Ω−1 m−1 and it increased with increase in temperature. Temperature variation of conductivity data has been analyzed in the light of Mott’s polaron hopping model. Activation energy for conduction has been determined. Activation energy was determined to be in the order of meV and it has increased with increase in frequency and Ag nanoparticles content. This is the first time that PPy-Ag nanocomposites have been investigated for dielectric properties and AC conductivity and data analyzed thoroughly.

  2. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  3. ACS Data Handbook v.6.0

    Science.gov (United States)

    Gonzaga, S.; et al.

    2011-03-01

    ACS was designed to provide a deep, wide-field survey capability from the visible to near-IR using the Wide Field Camera (WFC), high resolution imaging from the near-UV to near-IR with the now-defunct High Resolution Camera (HRC), and solar-blind far-UV imaging using the Solar Blind Camera (SBC). The discovery efficiency of ACS's Wide Field Channel (i.e., the product of WFC's field of view and throughput) is 10 times greater than that of WFPC2. The failure of ACS's CCD electronics in January 2007 brought a temporary halt to CCD imaging until Servicing Mission 4 in May 2009, when WFC functionality was restored. Unfortunately, the high-resolution optical imaging capability of HRC was not recovered.

  4. Interior point algorithm-based power flow optimisation of a combined AC and DC multi-terminal grid

    Directory of Open Access Journals (Sweden)

    Farhan Beg

    2015-01-01

    Full Text Available The high cost of power electronic equipment, lower reliability and poor power handling capacity of the semiconductor devices had stalled the deployment of systems based on DC (multi-terminal direct current system (MTDC networks. The introduction of voltage source converters (VSCs for transmission has renewed the interest in the development of large interconnected grids based on both alternate current (AC and DC transmission networks. Such a grid platform also realises the added advantage of integrating the renewable energy sources into the grid. Thus a grid based on DC MTDC network is a possible solution to improve energy security and check the increasing supply demand gap. An optimal power solution for combined AC and DC grids obtained by the solution of the interior point algorithm is proposed in this study. Multi-terminal HVDC grids lie at the heart of various suggested transmission capacity increases. A significant difference is observed when MTDC grids are solved for power flows in place of conventional AC grids. This study deals with the power flow problem of a combined MTDC and an AC grid. The AC side is modelled with the full power flow equations and the VSCs are modelled using a connecting line, two generators and an AC node. The VSC and the DC losses are also considered. The optimisation focuses on several different goals. Three different scenarios are presented in an arbitrary grid network with ten AC nodes and five converter stations.

  5. TRF2 and lamin A/C interact to facilitate the functional organization of chromosome ends.

    Science.gov (United States)

    Wood, Ashley M; Rendtlew Danielsen, Jannie M; Lucas, Catherine A; Rice, Ellen L; Scalzo, David; Shimi, Takeshi; Goldman, Robert D; Smith, Erica D; Le Beau, Michelle M; Kosak, Steven T

    2014-11-17

    Telomeres protect the ends of linear genomes, and the gradual loss of telomeres is associated with cellular ageing. Telomere protection involves the insertion of the 3' overhang facilitated by telomere repeat-binding factor 2 (TRF2) into telomeric DNA, forming t-loops. We present evidence suggesting that t-loops can also form at interstitial telomeric sequences in a TRF2-dependent manner, forming an interstitial t-loop (ITL). We demonstrate that TRF2 association with interstitial telomeric sequences is stabilized by co-localization with A-type lamins (lamin A/C). We also find that lamin A/C interacts with TRF2 and that reduction in levels of lamin A/C or mutations in LMNA that cause an autosomal dominant premature ageing disorder--Hutchinson Gilford Progeria Syndrome (HGPS)-lead to reduced ITL formation and telomere loss. We propose that cellular and organismal ageing are intertwined through the effects of the interaction between TRF2 and lamin A/C on chromosome structure.

  6. Weight-loss medicines

    Science.gov (United States)

    Prescription weight loss drugs; Diabetes - weight loss drugs; Obesity - weight loss drugs; Overweight - weight loss drugs ... are not approved by the FDA to treat weight-loss. So you should not take them if you do not have diabetes.

  7. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...

  8. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  9. Multi-phase AC/AC step-down converter for distribution systems

    Science.gov (United States)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  10. Meso Mechanical Analysis of AC Mixture Response

    NARCIS (Netherlands)

    Woldekidan, M.F.; Huurman, M.; Vaccari, E.; Poot, M.

    2012-01-01

    Ongoing research into performance modeling of Asphalt Concrete (AC) mixtures using meso mechanics approaches is being undertaken at Delft University of Technology (TUD). The approach has already been successfully employed for evaluating the long term performance of porous asphalt concrete. The work

  11. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele...

  12. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    deficiency, but to boorishness or ill-will. While grammatical error may reveal a speaker to be a less than proficient language- http://spilplus.journals.ac.za/ .... problems of meanlng, language use and the various linguistic aspects of interaction... contrastive analysis without a pragmalinguistic dimension is inadequate.".

  13. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  14. Meso Mechanical Analysis of AC Mixture Response

    NARCIS (Netherlands)

    Woldekidan, M.F.; Huurman, M.; Vaccari, E.; Poot, M.

    Ongoing research into performance modeling of Asphalt Concrete (AC) mixtures using meso mechanics approaches is being undertaken at Delft University of Technology (TUD). The approach has already been successfully employed for evaluating the long term performance of porous asphalt concrete. The work

  15. Total synthesis of chaetoquadrins A-C.

    Science.gov (United States)

    Kim, U Bin; Furkert, Daniel P; Brimble, Margaret A

    2013-02-01

    The first total synthesis of the monoamine oxidase inhibitors chaetoquadrins A-C has been accomplished. Key steps in the synthesis include an aromatic Claisen rearrangement, asymmetric boron aldol reaction and acid-mediated spiroketalization. Comparison of spectral data for the synthetic spiroketals confirmed the proposed structure for these natural products.

  16. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  17. Organic magnetoresistance under resonant ac drive

    Science.gov (United States)

    Roundy, R. C.; Raikh, M. E.

    2013-09-01

    Motivated by a recent experiment, we develop a theory of organic magnetoresistance (OMAR) in the presence of a resonant ac drive. To this end, we perform a thorough analysis of the dynamics of ac-driven electron-hole polaron pair in magnetic field, which is a sum of external and random hyperfine fields. Resonant ac drive affects the OMAR by modifying the singlet content of the eigenmodes. This, in turn, leads to the change of recombination rate, and ultimately, to the change of the spin-blocking that controls the current. Our analysis demonstrates that, upon increasing the drive amplitude, the blocking eigenmodes of the triplet type acquire a singlet admixture and become unblocking. Most surprisingly, the opposite process goes in parallel: new blocking modes emerge from nonblocking precursors as the drive increases. These emergent blocking modes are similar to subradiant modes in the Dicke effect. A nontrivial evolution of eigenmodes translates into a nontrivial behavior of OMAR with the amplitude of the ac drive: it is initially linear, then passes through a maximum, drops, and finally saturates.

  18. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  19. Three-Phase AC Optimal Power Flow Based Distribution Locational Marginal Price: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Rui; Zhang, Yingchen

    2017-05-17

    Designing market mechanisms for electricity distribution systems has been a hot topic due to the increased presence of smart loads and distributed energy resources (DERs) in distribution systems. The distribution locational marginal pricing (DLMP) methodology is one of the real-time pricing methods to enable such market mechanisms and provide economic incentives to active market participants. Determining the DLMP is challenging due to high power losses, the voltage volatility, and the phase imbalance in distribution systems. Existing DC Optimal Power Flow (OPF) approaches are unable to model power losses and the reactive power, while single-phase AC OPF methods cannot capture the phase imbalance. To address these challenges, in this paper, a three-phase AC OPF based approach is developed to define and calculate DLMP accurately. The DLMP is modeled as the marginal cost to serve an incremental unit of demand at a specific phase at a certain bus, and is calculated using the Lagrange multipliers in the three-phase AC OPF formulation. Extensive case studies have been conducted to understand the impact of system losses and the phase imbalance on DLMPs as well as the potential benefits of flexible resources.

  20. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  1. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    OpenAIRE

    S. Arumugam S. Ramareddy M. Sridhar

    2011-01-01

    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  2. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  3. Analysis of X-ray structure, dielectric properties and AC conductivity of (4E-2-amino-3-cyanobenzo[b]oxocin-6-one

    Directory of Open Access Journals (Sweden)

    Ali H.A.M.

    2016-06-01

    Full Text Available The crystal structure of (4E-2-amino-3-cyanobenzo[b]oxocin-6-one, denoted as 4(E-ACBO, was analyzed using X-ray diffraction technique. The dielectric and AC electrical conductivity measurements of the bulk 4(E-ACBO in the form of pellet were studied in the range of frequency 42 Hz to 5 MHz and the temperature range of 303 K to 373 K. The temperature and frequency dependence of dielectric constant (∊1, dielectric loss (∊2 and AC electrical conductivity (σAC were investigated. The relaxation time (τ for electrons to hop over a barrier of height WH was calculated at different temperatures. The AC activation energy was determined from the temperature dependence of σAC at different frequencies.

  4. UARS PEM Level 2 VMAG AC V001

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  5. Optimizing efficiency on conventional transformer based low power AC/DC standby power supplies

    DEFF Research Database (Denmark)

    Nielsen, Nils

    2004-01-01

    on two common power supply topologies designed for this power level. The two described topologies uses either a series (or linear) or a buck regulation approach. Common to the test power supplies is they either are using a standard cheap off-the-shelf transformer, or one, which are loss optimized by very......This article describes the research results for simple and cheap methods to reduce the idle- and load-losses in very low power conventional transformer based power supplies intended for standby usage. In this case "very low power" means 50 Hz/230 V-AC to 5 V-DC@1 W. The efficiency is measured...

  6. AC Electrokinetics of Physiological Fluids for Biomedical Applications

    OpenAIRE

    Lu, Yi; Liu,Tingting; Lamanda, Ariana C.; Sin, Mandy L. Y.; Gau, Vincent; Liao, Joseph C.; Wong, Pak Kin

    2014-01-01

    AC electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration and separation, makes it possible to develop integrated systems for clinical diagnostics in non-traditional healthcare settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics based dia...

  7. Hearing Loss in Children

    Science.gov (United States)

    ... Hearing Loss Homepage Facts Noise-Induced Hearing Loss Genetics of Hearing Loss Screening & Diagnosis Types of Hearing Loss About Sound Treatment & Intervention Services Learning Language Bacterial Meningitis Studies Data & Statistics EHDI Annual Data 2015 ...

  8. Genetics of Hearing Loss

    Science.gov (United States)

    ... Hearing Loss Homepage Facts Noise-Induced Hearing Loss Genetics of Hearing Loss Screening & Diagnosis Types of Hearing Loss About Sound Treatment & Intervention Services Learning Language Bacterial Meningitis Studies Data & Statistics EHDI Annual Data 2015 ...

  9. Managing Hearing Loss

    Science.gov (United States)

    ... page please turn JavaScript on. Feature: Hearing Loss Managing Hearing Loss Past Issues / Spring 2015 Table of ... not a cure. Read More "Hearing Loss" Articles Managing Hearing Loss / Symptoms, Devices, Prevention & Research / Screening Newborns / ...

  10. Bone Loss in IBD

    Science.gov (United States)

    ... Home > Resources > Bone Loss in IBD Go Back Bone Loss in IBD Email Print + Share As many as ... halt bone loss are so important. CAUSES OF BONE LOSS IN IBD Experts point to several suspected causes ...

  11. A simple technique for a.c. conductivity measurements

    Indian Academy of Sciences (India)

    Unknown

    A.c. conductivity; complex impedance spectroscopy; bulk resistance; grain boundaries. 1. Introduction. A.c. conductivity is one of the studies done on solids in order to characterize the bulk resistance of the crystalline sample. Measurement of a.c. .... If Zs is purely resistive, there will be change in the amplitude. But if Zs is ...

  12. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  13. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

  14. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area. (b...

  15. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  16. Evaluation of ac conductivity of rubber ferrite composites from ...

    Indian Academy of Sciences (India)

    They were then incorporated into a butyl rubber matrix according to a specific recipe. The a.c. electrical conductivity (a.c.) calculations were carried out by using the data available from dielectric measurements and by employing a simple relationship. The a.c. conductivity values were found to be of the order of 10–3 S/m.

  17. Evaluation of 225Ac decay data.

    Science.gov (United States)

    Xiaolong, Huang; Baosong, Wang

    2007-06-01

    Evaluation of the complete decay scheme and data for (225)Ac including new measurements are presented in this report; literature data available up to March 2006 are included. The half-life is determined to be 10.0+/-0.1 days. All known measured gamma-ray relative intensities have been examined; the gamma-ray emission probability of the reference gamma-ray line of 150.04 keV is recommended to be 0.693+/-0.012%. The calculated internal conversion coefficients and their uncertainties have been used to obtain the complete decay intensity balance. The other decay characteristics are calculated using the ENSDF analysis program. Finally, the new decay scheme for (225)Ac is presented.

  18. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  19. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  20. Updated MDRIZTAB Parameters for ACS/WFC

    Science.gov (United States)

    Hoffman, S. L.; Avila, R. J.

    2017-03-01

    The Mikulski Archive for Space Telescopes (MAST) pipeline performs geometric distortion corrections, associated image combinations, and cosmic ray rejections with AstroDrizzle. The MDRIZTAB reference table contains a list of relevant parameters that controls this program. This document details our photometric analysis of Advanced Camera for Surveys Wide Field Channel (ACS/WFC) data processed by AstroDrizzle. Based on this analysis, we update the MDRIZTAB table to improve the quality of the drizzled products delivered by MAST.

  1. ACS6, a Hydrogen sulfide-donating derivative of sildenafil, inhibits homocysteine-induced apoptosis by preservation of mitochondrial function

    Directory of Open Access Journals (Sweden)

    Tang Xiao-Qing

    2011-08-01

    Full Text Available Abstract Background The hydrogen sulfide-releasing sildenafil, ACS6, has been demonstrated to inhibit superoxide formation through donating hydrogen sulfide (H2S. We have found that H2S antagonizes homocysteine-induced oxidative stress and neurotoxicity. The aim of the present study is to explore the protection of ACS6 against homocysteine-triggered cytotoxicity and apoptosis and the molecular mechanisms underlying in PC12 cells. Methods Cell viability was determined by Cell Counting Kit-8 assay. Cell apoptosis was observed using the chromatin dye Hoechst 33258 and analyzed by Flow Cytometry after propidium iodide staining. Mitochondrial membrane potential was monitored using the fluorescent dye Rh123. Intracellular reactive oxygen species were determined by oxidative conversion of cell permeable 2',7'-dichlorfluorescein-diacetate to fluorescent 2',7'-dichlorfluorescein. The expression of cleaved caspase-3 and bcl-2 and the accumulation of cytosolic cytochrome c were analyzed by Western blot. Results We show that ACS6 protects PC12 cells against cytotoxicity and apoptosis induced by homocysteine and blocks homocysteine-triggered cytochrome c release and caspase-3 activation. ACS6 treatment results in not only prevention of homocysteine-caused mitochondrial membrane potential (Δψ loss and reactive oxygen species (ROS overproduction but also reversal of Bcl-2 down-expression. Conclusions These results indicate that ACS6 protects PC12 cells against homocysteine-induced cytotoxicity and apoptosis by preservation of mitochondrial function though inhibiting both loss of Δψ and accumulation of ROS as well as modulating the expression of Bcl-2. Our study provides evidence both for a neuroprotective effect of ACS6 and for further evaluation of ACS6 as novel neuroprotectants for Alzheimer's disease associated with homocysteine.

  2. Direct amplitude detuning measurement with ac dipole

    Science.gov (United States)

    White, S.; Maclean, E.; Tomás, R.

    2013-07-01

    In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning). The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  3. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  4. Ac conductivity and dielectric properties of bulk tin phthalocyanine dichloride (SnPcCl{sub 2})

    Energy Technology Data Exchange (ETDEWEB)

    El-Nahass, M.M.; Farid, A.M.; Abd El-Rahman, K.F. [Department of Physics, Faculty of Education, Ain Shams University, Roxy, 11757 Cairo (Egypt); Ali, H.A.M. [Department of Physics, Faculty of Education, Ain Shams University, Roxy, 11757 Cairo (Egypt)], E-mail: hend2061@yahoo.com

    2008-07-01

    The ac conductivity, {sigma}{sub ac}({omega}), has been measured for bulk tin phthalocyanine dichloride (SnPcCl{sub 2}) in the form of compressed pellet with evaporated ohmic Au electrodes in a temperature range 303-403 K. Ac conductivity, {sigma}{sub ac}({omega}), is found to vary as {omega}{sup s} in the frequency range 42 Hz-5x10{sup 6} Hz. At low range of frequency, s<1 and it decreases with the increase in temperature indicating a dominant hopping process. At high range of frequency, s is found to be equal to {approx}1.09 and is temperature independent. The dielectric constant, {epsilon}{sub 1}, and dialectic loss, {epsilon}{sub 2}, have been determined for bulk SnPcCl{sub 2}. Both {epsilon}{sub 1} and {epsilon}{sub 2} decrease with the increase in frequency and increase with the increase in temperature. The Cole-Cole types have been used to determine some parameters such as; the macroscopic relaxation time ({tau}{sub o}), the molecular relaxation time ({tau}), the activation energy for relaxation (E{sub o}) and the distribution parameter ({alpha}). The temperature dependence of {tau} is expressed by a thermally activated process with the activation energy of 0.299 eV.

  5. A wide-frequency range AC magnetometer to measure the specific absorption rate in nanoparticles for magnetic hyperthermia

    Energy Technology Data Exchange (ETDEWEB)

    Garaio, E., E-mail: eneko.garayo@ehu.es [Elektrizitatea eta Elektronika Saila, UPV/EHU, P.K. 644, Bilbao (Spain); Collantes, J.M. [Elektrizitatea eta Elektronika Saila, UPV/EHU, P.K. 644, Bilbao (Spain); Garcia, J.A. [Fisika Aplikatua II Saila, UPV/EHU, P.K. 644, Bilbao (Spain); Plazaola, F. [Elektrizitatea eta Elektronika Saila, UPV/EHU, P.K. 644, Bilbao (Spain); Mornet, S. [Institut de Chimie de la Matière Condensée de Bordeaux, UPR 9048 CNRS / Université de Bordeaux, Bordeaux (France); Couillaud, F. [Résonance Magnétique des Systèmes Biologiques, UMR 5536 CNRS / Université de Bordeaux, Bordeaux (France); Sandre, O., E-mail: olivier.sandre@enscbp.fr [Laboratoire de Chimie des Polymères Organiques, UMR 5629 CNRS / Université de Bordeaux, Bordeaux (France)

    2014-11-15

    Measurement of specific absorption rate (SAR) of magnetic nanoparticles is crucial to assert their potential for magnetic hyperthermia. To perform this task, calorimetric methods are widely used. However, those methods are not very accurate and are difficult to standardize. In this paper, we present AC magnetometry results performed with a lab-made magnetometer that is able to obtain dynamic hysteresis-loops in the AC magnetic field frequency range from 50 kHz to 1 MHz and intensities up to 24 kA m{sup −1}. In this work, SAR values of maghemite nanoparticles dispersed in water are measured by AC magnetometry. The so-obtained values are compared with the SAR measured by calorimetric methods. Both measurements, by calorimetry and magnetometry, are in good agreement. Therefore, the presented AC magnetometer is a suitable way to obtain SAR values of magnetic nanoparticles. - Highlights: • We propose AC magnetometry as a method to measure the specific absorption rate (SAR) of magnetic nanoparticles suitable for magnetic hyperthermia therapy. • We have built a lab-made AC magnetometer, which is able to measure magnetic dynamic hysteresis-loops of nanoparticle dispersions. • The device works with AC magnetic field intensities up to 24 kA m{sup −1} in a frequency range from 75 kHz to 1 MHz. • The SAR values of maghemite nanoparticles around 12 nm in magnetic diameter dispersed in water are measured by the lab-made magnetometer and different calorimetric methods. • Although all methods are in good agreement, several factors (probe location, thermal inertia, losses, etc.) make calorimetric method less accurate than AC magnetometry.

  6. Topologically protected ac transport in zigzag silicene nanosystem

    Science.gov (United States)

    Ye, En-Jia; Sun, Yun-Lei; Yang, Guo-Feng; Chen, Guo-Qing

    2017-04-01

    The linear ac transport properties are investigated theoretically in zigzag silicene nanoribbon and nanojunction systems. Based on the tight-binding approach and ac response theory, we compute the dc conductance and ac emittance. The topologically protected edge states and eliminated ac emittance are presented around the Dirac point. Emittances as functions of the strength of spin-orbital interaction (SOI) and geometric size of the silicene systems are studied. The results show that the eliminated ac response behavior is induced by the strong SOI and is topologically protected against the size variation.

  7. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented. © 2014 Society for Laboratory Automation and Screening.

  8. Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

    Directory of Open Access Journals (Sweden)

    Amir V. Tavakoli

    2017-09-01

    Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

  9. Effect of nanosilica on optical, electric modulus and AC conductivity of polyvinyl alcohol/polyaniline films

    Science.gov (United States)

    El-Sayed, Somyia; Abel-Baset, Tarob; Elfadl, Azza Abou; Hassen, Arafa

    2015-05-01

    Nanosilica (NS) was synthesized by a sol-gel method and mixed with 0.98 polyvinyl alcohol (PVA)/0.02 polyaniline (PANI) in different amounts to produce nanocomposite films. High-resolution transmission electron microscopy (HR-TEM) revealed the average particle size of the NS to be ca. 15 nm. Scanning electron microscopy (SEM) showed that the NS was well-dispersed on the surface of the PVA/PNAI films. The Fourier transform infrared (FTIR) spectra of the samples showed a significant change in the intensity of the characteristic peak of the functional groups in the composite films with the amount of NS added. The absorbance and refractive index (n) of the composites were studied in the UV-vis range, and the optical energy band gap, Eg, and different optical parameters were calculated. The dielectric loss modulus, M″ and ac conductivity, σac, of the samples were studied within 300-425 K and 0.1 kHz-5 MHz, respectively. Two relaxation peaks were observed in the frequency dependence of the dielectric loss modulus, M″. The behavior of σac(f) for the composite films indicated that the conduction mechanism was correlated barrier hopping (CBH). The results of this work are discussed and compared with those of previous studies of similar composites.

  10. Alternating magnetic field losses in ATLAS type aluminium stabilized NbTi superconductors

    CERN Document Server

    Boxman, E W; ten Kate, H H J

    2002-01-01

    During ramping up- and down of the current in large-scale magnets the ramp losses are an important factor affecting the thermal and electro-magnetic stability of the system. The calculation of the losses is not straightforward due to the large dimensions of the conductor (~600 mm/sup 2/) implying that diffusion effects have to be taken into account. The AC-losses of the Al stabilized NbTi cable conductors used in the ATLAS magnet system were measured in 0.5 m long samples, using an inductive method with pick-up coils as well as the calorimetric method. External varying magnetic fields up to 2 tesla amplitude were applied parallel and perpendicular to the conductor wide surface. The results are compared to theory. It is found that hysteresis loss, eddy current loss in the Aluminum cladding and cable-to-cladding coupling loss contribute most to the AC loss. (5 refs).

  11. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    OpenAIRE

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  12. Comportamento Acústico de Fachadas: Isolamento Acústico versus Permeabilidade ao Ar

    OpenAIRE

    Ferreira, Diogo Miguel do Rosário

    2016-01-01

    Nos dias de hoje, o conforto acústico dos edifícios revela-se como um factor muito importante no contexto da comodidade global dos seus habitantes. Para tanto, contribui de forma relevante o isolamento sonoro que as fachadas dos edifícios possam assegurar. Sendo as fachadas constituídas por uma parte opaca e uma outra translúcida, é esta última a que mais condiciona o isolamento acústico que o elemento fachada proporciona, o qual é influenciado tanto pela janela propriamente dita, como pelas ...

  13. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  14. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  15. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  16. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer

    Directory of Open Access Journals (Sweden)

    Phuc Thinh Doan

    2013-06-01

    Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43

  17. What's Hearing Loss?

    Science.gov (United States)

    ... Weight for Me? Your Teeth Heart Murmurs What's Hearing Loss? KidsHealth > For Kids > What's Hearing Loss? Print ... problem can also develop later in life. How Hearing Works To understand how and why hearing loss ...

  18. Genes and Hearing Loss

    Science.gov (United States)

    ... Find an ENT Doctor Near You Genes and Hearing Loss Genes and Hearing Loss Patient Health Information News media interested in ... One of the most common birth defects is hearing loss or deafness (congenital), which can affect as ...

  19. Pregnancy Loss and Miscarriage

    Science.gov (United States)

    ... Information Find a Study Resources and Publications Pregnancy Loss: Condition Information Skip sharing on social media links Share this: Page Content What is pregnancy loss/miscarriage? A miscarriage, also called pregnancy loss or ...

  20. Menopause and Bone Loss

    Science.gov (United States)

    ... up bone loss. After menopause your ovaries stop producing the hormone estrogen, which helps to keep your ... you minimize and treat bone loss? Diet and lifestyle can help prevent and treat bone loss. Successful ...

  1. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  2. single-phase dc phase dc-ac boost converter ac boost converter

    African Journals Online (AJOL)

    User

    This paper describes a new power conversion circuit dc-dc boost converter. It boost converter. It boost converter. It comprises an H comprises an H. Change of load .... A full-wave rectified signal is used to produce an AC reference voltage v* o. The outer voltage loop generates the reference current command i* f. A common.

  3. Economic Loan Loss Provision and Expected Loss

    Directory of Open Access Journals (Sweden)

    Stefan Hlawatsch

    2010-10-01

    Full Text Available The intention of a loan loss provision is the anticipation of the loan's expected losses by adjusting the book value of the loan. Furthermore, this loan loss provision has to be compared to the expected loss according to Basel II and, in the case of a difference, liable equity has to be adjusted. This however assumes that the loan loss provision and the expected loss are based on a similar economic rationale, which is only valid conditionally in current loan loss provisioning methods according to IFRS. Therefore, differences between loan loss provisions and expected losses should only result from different approaches regarding the parameter estimation within each model and not due to different assumptions regarding the outcome of the model. The provisioning and accounting model developed in this paper overcomes the before-mentioned shortcomings and is consistent with an economic rationale of expected losses. Additionally, this model is based on a close-to-market valuation of the loan that is in favor of the basic idea of IFRS. Suggestions for changes in current accounting and capital requirement rules are provided.

  4. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  5. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  6. Non-vanishing ponderomotive AC electrophoretic effect for particle trapping

    Energy Technology Data Exchange (ETDEWEB)

    Guan, Weihau [Yale University; Park, Jae Hyun nmn [ORNL; Krstic, Predrag S [ORNL; Reed, Mark A [Yale University

    2011-01-01

    We present here a study on overlooked aspects of alternating current (AC) electrokinetics AC electrophoretic (ACEP) phenomena. The dynamics of a particle with both polarizability and net charges in a non-uniform AC electric trapping field is investigated. It is found that either electrophoretic (EP) or dielectrophoretic (DEP) effects can dominate the trapping dynamics, depending on experimental conditions. A dimensionless parameter gamma is developed to predict the relative strength of EP and DEP effects in a quadrupole AC field. An ACEP trap is feasible for charged particles in salt-free or low salt concentration solutions. In contrast to DEP traps, an ACEP trap favors the downscaling of the particle size.

  7. Dynamics of supercooled liquid and plastic crystalline ethanol: Dielectric relaxation and AC nanocalorimetry distinguish structural α- and Debye relaxation processes.

    Science.gov (United States)

    Chua, Y Z; Young-Gonzales, A R; Richert, R; Ediger, M D; Schick, C

    2017-07-07

    Physical vapor deposition has been used to prepare glasses of ethanol. Upon heating, the glasses transformed into the supercooled liquid phase and then crystallized into the plastic crystal phase. The dynamic glass transition of the supercooled liquid is successfully measured by AC nanocalorimetry, and preliminary results for the plastic crystal are obtained. The frequency dependences of these dynamic glass transitions observed by AC nanocalorimetry are in disagreement with conclusions from previously published dielectric spectra of ethanol. Existing dielectric loss spectra have been carefully re-evaluated considering a Debye peak, which is a typical feature in the dielectric loss spectra of monohydroxy alcohols. The re-evaluated dielectric fits reveal a prominent dielectric Debye peak, a smaller and asymmetrically broadened peak, which is identified as the signature of the structural α-relaxation and a Johari-Goldstein secondary relaxation process. This new assignment of the dielectric processes is supported by the observation that the AC nanocalorimetry dynamic glass transition temperature, Tα, coincides with the dielectric structural α-relaxation process rather than the Debye process. The combined results from dielectric spectroscopy and AC nanocalorimetry on the plastic crystal of ethanol suggest the occurrence of a Debye process also in the plastic crystal phase.

  8. Low AC Loss in a 3 kA HTS Cable of the Dutch Project

    NARCIS (Netherlands)

    Chevtchenko, O.; Zuijderduin, R.; Smit, J.; Willen, D.; Lentge, H.; Thidemann, C.; Traeholt, C.; Melnik, I.; Geschiere, A.

    2012-01-01

    are: a cable has to fit in an annulus of 160 mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in the cable, potentially affecting public acceptance of the project. A way out would be to substantially reduce

  9. Magnetic and mechanical AC loss of the ITER CSI model coil conductor under transverse cyclic loading

    NARCIS (Netherlands)

    Nijhuis, Arend; Noordman, Niels H.W.; ten Kate, Herman H.J.; Mitchell, Neil; Bruzzone, Pierluigi

    1998-01-01

    The magnetic field in a coil results in a transverse force on the strands pushing the cable towards one side of the jacket. A special cryogenic press has been built to study in a unique way the mechanical and electrical properties of full-size ITER Cable-in-Conduit (CIC) samples under a transverse,

  10. Flex concept for US-A BWR extended loss of AC power events

    Energy Technology Data Exchange (ETDEWEB)

    Powers, J. [Toshiba America Nuclear Energy, Charlotte, North Carolina (United States); Aoyagi, Y.; Kataoka, K. [Toshiba Corporation, Kawasaki, Kanagawa (Japan); Thomas, S.; Mookhoek, B., E-mail: jim.powers@toshiba.com [Nuclear Innovation North America, Lake Jackson, Texas (United States)

    2015-09-15

    The US-Advanced Boiling Water Reactor (US-A BWR), certified by the US NRC, is a third generation, evolutionary boiling water reactor design which is the reference for the South Texas Project Units 3 and 4 (Stp 3 and 4) Combined License Application (Cola) and incorporates numerous design and technology enhancements for improved safety performance. Nuclear Innovation North America (NINA) is the License Applicant for this new build project, and Toshiba is the selected primary technology contractor. The Stp 3 and 4 project has finished the US NRC technical review of the Cola, and the final safety evaluation report (FSER) is scheduled to be issued by the US NRC in 2015. Following the accident at the Fukushima Dai-ichi plant, the US-A BWR was reviewed for Beyond Design Basis Event (BDBE) safety using industry and regulatory guidance for US NRC Order EA-12-049 Order Modifying Licenses with Regard to Requirements for Mitigation of Beyond Design Basis External Events (BDBEE). By virtue of the design approach, the US-A BWR is capable of providing an indefinite coping period for a station blackout. The use of installed systems with extended coping times is a significant advantage of the US-A BWR compared to most of the plants currently operating in the U.S. In addition, the Stp 3 and 4 design incorporates enhancements consistent with the current US industry Diverse and Flexible Coping Strategies (Flex) initiative. The final technical topic requiring review by the US NRC Advisory Committee on Reactor Safeguards was the Flex Integrated Plan submitted by NINA, and this review was successfully completed. This paper summarizes the progress of the US-A BWR in licensing the Flex Integrated Plan for the project, and describes the technology and features of the US-A BWR design that contribute to safety post-Fukushima. It also provides an informational comparison of the design capabilities of the US-A BWR for extreme external events, and relates these capabilities to re-assessments performed for the Laguna Verde site following the Fukushima event. (Author)

  11. Loss of ACS7 confers abiotic stress tolerance by modulating ABA sensitivity and accumulation in Arabidopsis

    National Research Council Canada - National Science Library

    Hui Dong; Zhiqin Zhen; Jinying Peng; Li Chang; Qingqiu Gong; Ning Ning Wang

    2011-01-01

    The phytohormones ethylene and abscisic acid (ABA) play essential roles in the abiotic stress adaptation of plants, with both cross-talk of ethylene signalling and ABA biosynthesis and signalling reported...

  12. Hair loss in women.

    Science.gov (United States)

    Harfmann, Katya L; Bechtel, Mark A

    2015-03-01

    Hair loss is a common cause of morbidity for many women. As a key member of the woman's health care team, the obstetrician/gynecologist may be the first person to evaluate the complaint of hair loss. Common types of nonscarring hair loss, including female pattern hair loss and telogen effluvium, may be diagnosed and managed by the obstetrician/gynecologist. A systematic approach to diagnosis and management of these common forms of hair loss is presented.

  13. Hearing loss in pregnancy

    OpenAIRE

    Ashok Murthy, V.; Krishna, Kirtan

    2011-01-01

    To study hearing loss in healthy pregnant women. Tertiary care hospital. Prospective study. We screened fifty healthy, non-complicated pregnant women (study group) in the third trimester for hearing loss who had no previous history for the same. Fifty healthy, non-pregnant women (control group) were also screened for hearing loss with a normal pure tone audiogram (PTA) for evidence of hearing loss. Thirteen women in the study group had evidence of hearing loss, in the form of absence of disto...

  14. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  15. Sub-Kelvin ac magnetic susceptometry.

    Science.gov (United States)

    Schmidt, M A; Silevitch, D M; Woo, N; Rosenbaum, T F

    2013-01-01

    Designing an apparatus for experiments that operate deep into the milliKelvin regime requires a careful selection of materials and construction techniques, and often entails balancing mutually contradictory requirements. In the case of magnetic susceptibility measurements, this involves choosing materials that realize both high thermal conductivity for good heat sinking and low electrical conductivity for minimal eddy-current heating. A coil mounting system with a completely nonmetallic construction, achieved through the use of a sapphire skeleton and a machined carbon-fiber body, resolves this dilemma. This system permits the use of large ac magnetic field amplitudes at kHz frequencies and above, opening the door to studies of the nonlinear dynamics of a wide variety of magnetic systems that were previously inaccessible.

  16. Compensation methods applied in current control schemes for large AC drive systems

    DEFF Research Database (Denmark)

    Rus, D. C.; Preda, N. S.; Teodorescu, Remus

    2012-01-01

    The paper deals with modified PI current control structures for large AC drive systems which use surface mounted permanent magnet synchronous machines or squirrel-cage induction motors supplied with voltage source inverters. In order to reduce the power losses caused by high frequency switching...... of the semiconductor devices, various compensation methods are used and a modified structure for a PI current controller is proposed, to reduce the switching frequency of the inverter for the same operating frequency of the drive. Simulation, experimental development and test results are presented in order...... to demonstrate the capabilities of the control procedure....

  17. Hysteresis Current Control Based Shunt Active Power Filter for Six Pulse Ac/Dc Converter

    OpenAIRE

    Rakesh Kumar Pandey; Vaibhav Purwar; Nikhlesh Sharma

    2017-01-01

    In this paper the simulation of Shunt Active power Filter using P-Q theory and PI controller has been presented. This SAPF compensates the harmonic currents drawn by three phase six pulse AC/DC converter. The process of compensation is done by calculating the instantaneous reactive power losses using p-q theory and the PI controller to reduce the ripple voltage of the dc capacitor of the PWM-VSI. This approach is different from conventional approach and provides very effective sol...

  18. Development of 500-kV AC cable employing laminar insulation of other than conventional cellulosic paper

    Science.gov (United States)

    Bahder, G.; Eager, G. S., Jr.; Walker, J. J.; Dima, A. F.

    1980-09-01

    The results of an investigation to develop a 500 kV ac laminar dielectric power cable and joint having insulation with lower losses than conventional cellulosic paper insulation are presented. Background information is presented on proposed low loss synthetic and composite synthetic/cellulosic paper insulations. From these studies, fibrous polypropylene paper tape and cellulosic paper-polypropylene film-cellulosic paper composite paper (PPP) were chosen. Extensive testing of handwrapped cable models fabricated with each type of tape served to eliminate the fibrous polypropylene paper tape from further consideration. Cable model tests indicate that the PPP tape is satisfactory for insulation in 500 kV ac cable, and that oil impregnants now used in conventional cellulosic paper insulated cables are unsuitable, but that silicone oil with an additive is satisfactory for PPP tapes.

  19. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Loh, Poh Chiang; Gao, Feng

    2007-01-01

    a low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper.......This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can accurately produce...

  20. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  1. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  2. Realization of a Photovoltaic Fed Sparse Alternating Current (AC-Link Inverter

    Directory of Open Access Journals (Sweden)

    R. Ramaprabha

    2016-12-01

    Full Text Available In this paper, a soft-switched alternating current (AC-link buck-boost inverter with a reduced number of switches, referred to as a sparse AC-link buck-boost inverter, was designed and implemented for a photovoltaic (PV interface. Important features of the sparse configuration included a lower number of switches, lower failure rates, compactness, and cost-effectiveness. The link was composed of a low reactive rating series inductor/capacitor pair. Significant merits of the AC-link buck-boost inverter are a zero voltage turn on and a soft turn off of the switches, resulting in minimum voltage stress on the switches and negligible switching losses. In this paper, 10 switches were used instead of 20 switches as are used in existing buck-boost inverter topology. The reduction in the number of switches did not change the principle of operation of the sparse configuration; hence, it remains the same as that of the original configuration. The pulse width modulation (PWM technique was used for gating the switches. The inverter operation was validated and implemented for PV interface using a microcontroller.

  3. High Temperature Microwave Dielectric Properties of JSC-1AC Lunar Simulant

    Science.gov (United States)

    Allan, Shawn M.; Merritt, Brandon J.; Griffin, Brittany F.; Hintze, Paul E.; Shulman, Holly S.

    2011-01-01

    Microwave heating has many potential lunar applications including sintering regolith for lunar surface stabilization and heating regolith for various oxygen production reactors. The microwave properties of lunar simulants must be understood so this technology can be applied to lunar operations. Dielectric properties at microwave frequencies for a common lunar simulant, JSC-1AC, were measured up to 1100 C, which is approximately the melting point. The experimentally determined dielectric properties included real and imaginary permittivity (epsilon', epsilon"), loss tangent (tan delta), and half-power depth, the di stance at which a material absorbs 50% of incident microwave energy. Measurements at 2.45 GHz revealed tan delta of JSC-1A increases from 0.02 at 25 C to 0.31 at 110 C. The corresponding half-power depth decreases from a peak of 286 mm at 110 C, to 13 mm at 1100 C. These data indicate that JSC-1AC becomes more absorbing, and thus a better microwave heater as temperature increases. A half-power depth maximum at 100-200 C presents a barrier to direct microwave heating at low temperatures. Microwave heating experiments confirm the sluggish heating effect of weak absorption below 200 C, and increasingly strong absorption above 200 C, leading to rapid heating and melting of JSC-1AC.

  4. An Integrated Multifunctional Bidirectional AC/DC and DC/DC Converter for Electric Vehicles Applications

    Directory of Open Access Journals (Sweden)

    Liwen Pan

    2016-06-01

    Full Text Available This paper presents an on-board vehicular battery charger that integrates bidirectional AC/DC converter and DC/DC converter to achieve high power density for application in electric vehicles (EVs. The integrated charger is able to transfer electrical energy between the battery pack and the electric traction system and to function as an AC/DC battery charger. The integrated charger topology is presented and the design of passive components is discussed. The control schemes are developed for motor drive system and battery-charging system with a power pulsation reduction circuit. Simulation results in MATLAB/Simulink and experiments on a 30-kW motor drive and 3.3-kW AC/DC charging prototype validate the performance of the proposed technology. In addition, power losses, efficiency comparison and thermal stress for the integrated charger are illustrated. The results of the analyses show the validity of the advanced integrated charger for electric vehicles.

  5. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...

  6. Trajectory Control of Self-Propelled Micromotors Using AC Electrokinetics.

    Science.gov (United States)

    Yoshizumi, Yoshitaka; Honegger, Thibault; Berton, Kevin; Suzuki, Hiroaki; Peyrade, David

    2015-11-11

    3D control of the motion of self-powered micromotors is demonstrated using AC electrokinetics by applying an AC electric field on indium tin oxide transparent electrodes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  8. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  9. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    . This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  10. Similar genetic basis of resistance to Bt toxin Cry1Ac in Boll-selected and diet-selected strains of pink bollworm.

    Directory of Open Access Journals (Sweden)

    Jeffrey A Fabrick

    Full Text Available Genetically engineered cotton and corn plants producing insecticidal Bacillus thuringiensis (Bt toxins kill some key insect pests. Yet, evolution of resistance by pests threatens long-term insect control by these transgenic Bt crops. We compared the genetic basis of resistance to Bt toxin Cry1Ac in two independently derived, laboratory-selected strains of a major cotton pest, the pink bollworm (Pectinophora gossypiella [Saunders]. The Arizona pooled resistant strain (AZP-R was started with pink bollworm from 10 field populations and selected with Cry1Ac in diet. The Bt4R resistant strain was started with a long-term susceptible laboratory strain and selected first with Bt cotton bolls and later with Cry1Ac in diet. Previous work showed that AZP-R had three recessive mutations (r1, r2, and r3 in the pink bollworm cadherin gene (PgCad1 linked with resistance to Cry1Ac and Bt cotton producing Cry1Ac. Here we report that inheritance of resistance to a diagnostic concentration of Cry1Ac was recessive in Bt4R. In interstrain complementation tests for allelism, F(1 progeny from crosses between AZP-R and Bt4R were resistant to Cry1Ac, indicating a shared resistance locus in the two strains. Molecular analysis of the Bt4R cadherin gene identified a novel 15-bp deletion (r4 predicted to cause the loss of five amino acids upstream of the Cry1Ac-binding region of the cadherin protein. Four recessive mutations in PgCad1 are now implicated in resistance in five different strains, showing that mutations in cadherin are the primary mechanism of resistance to Cry1Ac in laboratory-selected strains of pink bollworm from Arizona.

  11. Corona helps curb losses

    Energy Technology Data Exchange (ETDEWEB)

    Laasonen, M.; Lahtinen, M.; Lustre, L.

    1996-11-01

    The greatest power losses in electricity transmission arise through a phenomenon called load losses. Corona losses caused by the surface discharge of electricity also constitute a considerable cost item. IVS, the nationwide network company, is investigating corona- induced losses, and has also commissioned similar research from IVO International, the Technical Research Centre of Finland (VTT) and from Tampere University of Technology. The research work strives to gain more in-depth knowledge on the phenomenon of frosting and its impact on corona losses. The correct prediction of frost helps reduce corona losses, while also cutting costs considerably. (orig.)

  12. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  13. The use of low frequency AC for offshore wind power

    Energy Technology Data Exchange (ETDEWEB)

    Schuette, T.; Stroem, M.; Gustavsson, Bo [Balfour Beatty Rail AB, Vaesteraas (Sweden)

    2001-07-01

    Low frequency AC, that means AC with a frequency well below the usual frequencies 50 or 60 Hz, has today its main use in single phase AC electrified railways in a number of European countries (16 2/3 Hz), USA (25 Hz) and Costa Rica (20 Hz). Offshore wind power is well suited to 'join the club' as low frequency AC has a number of advantages for that use: Low frequency AC better fits the low revolution frequency of wind power rotors. This can either be used for reduction of pole number for direct generation machines or for a reduction of the gear ratio for conventional machines, resulting in simpler, lighter and more reliable gearboxes. Low frequency AC gives rise to lower charging current/reactive power production, which restricts the maximum cable length for 50 - 60 Hz heavily due to the high specific capacitance of power cables. For low frequency AC, cables longer than 100 km are possible, which is necessary for many future offshore wind power sites. Low frequency AC enables for the use of (air insulated) transmission lines at loads well above their characteristic power, often up to their thermal maximum load. This means that weak 50 or 60 Hz lines between the shore and consumers or stronger parts of a national grid can transfer more power when operated with low frequency AC. On all aspects of low frequency AC, profound knowledge has been accumulated the last century in the railway sector and can be made available for wind power.

  14. Adapting AC Lines to DC Grids for Large-Scale Renewable Power Transmission

    Directory of Open Access Journals (Sweden)

    D. Marene Larruskain

    2014-10-01

    Full Text Available All over the world, governments of different countries are nowadays promoting the use of clean energies in order to achieve sustainable energy systems. In this scenario, since the installed capacity is continuously increasing, renewable sources can play an important role. Notwithstanding that, some important problems may appear when connecting these sources to the grid, being the overload of distribution lines one of the most relevant. In fact, renewable generation is usually connected to the nearest AC grid, although this HV system may not have been designed considering distributed generation. In the particular case of large wind farms, the electrical grid has to transmit all the power generated by wind energy and, as a consequence, the AC system may get overloaded. It is therefore necessary to determine the impact of wind power transmission so that appropriate measures can be taken. Not only are these measures influenced by the amount of power transmitted, but also by the quality of the transmitted power, due to the output voltage fluctuation caused by the highly variable nature of wind. When designing a power grid, although AC systems are usually the most economical solution because of its highly proven technology, HVDC may arise in some cases (e.g. offshore wind farms as an interesting alternative, offering some added values such as lower losses and better controllability. This way, HVDC technology can solve most of the aforementioned problems and has a good potential for future use. Additionally, the fast development of power electronics based on new and powerful semiconductor devices allow the spread of innovative technologies, such as VSC-HVDC, which can be applied to create DC grids. This paper focuses on the main aspects involved in adapting the existing overhead AC lines to DC grids, with the objective of improving the transmission of distributed renewable energy to the centers of consumption.

  15. Transgenic pigeonpea events expressing Cry1Ac and Cry2Aa exhibit resistance to Helicoverpa armigera.

    Science.gov (United States)

    Ghosh, Gourab; Ganguly, Shreeparna; Purohit, Arnab; Chaudhuri, Rituparna Kundu; Das, Sampa; Chakraborti, Dipankar

    2017-07-01

    Independent transgenic pigeonpea events were developed using two cry genes. Transgenic Cry2Aa-pigeonpea was established for the first time. Selected transgenic events demonstrated 100% mortality of Helicoverpa armigera in successive generations. Lepidopteran insect Helicoverpa armigera is the major yield constraint of food legume pigeonpea. The present study was aimed to develop H. armigera-resistant transgenic pigeonpea, selected on the basis of transgene expression and phenotyping. Agrobacterium tumefaciens-mediated transformation of embryonic axis explants of pigeonpea cv UPAS 120 was performed using two separate binary vectors carrying synthetic Bacillus thuringiensis insecticidal crystal protein genes, cry1Ac and cry2Aa. T0 transformants were selected on the basis of PCR and protein expression profile. T1 events were exclusively selected on the basis of expression and monogenic character for cry, validated through Western and Southern blot analyses, respectively. Independently transformed 12 Cry1Ac and 11 Cry2Aa single-copy events were developed. The level of Cry-protein expression in T1 transgenic events was 0.140-0.175% of total soluble protein. Expressed Cry1Ac and Cry2Aa proteins in transgenic pigeonpea exhibited significant weight loss of second-fourth instar larvae of H. armigera and ultimately 80-100% mortality in detached leaf bioassay. Selected Cry-transgenic pigeonpea events, established at T2 generation, inherited insect-resistant phenotype. Immunohistofluorescence localization in T3 plants demonstrated constitutive accumulation of Cry1Ac and Cry2Aa in leaf tissues of respective transgenic events. This study is the first report of transgenic pigeonpea development, where stable integration, effective expression and biological activity of two Cry proteins were demonstrated in subsequent three generations (T0, T1, and T2). These studies will contribute to biotechnological breeding programmes of pigeonpea for its genetic improvement.

  16. Refined localization of the Escherichia coli F4ab/F4ac receptor locus on pig chromosome 13

    DEFF Research Database (Denmark)

    Joller, D.; Jørgensen, Claus Bøttcher; Bertschinger, H.U.

    2009-01-01

    Diarrhoea in newborn and weaned pigs caused by enterotoxigenic Escherichia coli (ETEC) expressing F4 fimbriae leads to considerable losses in pig production. In this study, we refined the mapping of the receptor locus for ETEC F4ab/F4ac adhesion (F4bcR) by joint analysis of Nordic and Swiss data....

  17. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    Science.gov (United States)

    2010-07-01

    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning tests...

  18. PD-Detection vs. Loss Measurements at High Voltages with variable frequencies

    DEFF Research Database (Denmark)

    Holbøll, Joachim T.; Edin, Hans

    1999-01-01

    Partial discharge-activity (PD) in internal voids in epoxy plastic was measured at AC voltages from below inception to 3 times inception with variable frequencies in the range 0.1 to 100Hz.The results from phase/height analyses were compared to dielec-tric loss measurements and related to the app......Partial discharge-activity (PD) in internal voids in epoxy plastic was measured at AC voltages from below inception to 3 times inception with variable frequencies in the range 0.1 to 100Hz.The results from phase/height analyses were compared to dielec-tric loss measurements and related...

  19. Telogen Effluvium Hair Loss

    Science.gov (United States)

    ... Category: Share: Yes No, Keep Private Telogen Effluvium Hair Loss Share | It is normal to lose up to ... months after the "shock". This sudden increase in hair loss, usually described as the hair coming out in ...

  20. What causes bone loss?

    Science.gov (United States)

    ... of bone loss. For men, a drop in testosterone as they age can cause bone loss. Your ... Wisse, MD, Associate Professor of Medicine, Division of Metabolism, Endocrinology & Nutrition, University of Washington School of Medicine, ...

  1. Injection losses and protection

    CERN Document Server

    Bartmann, W; Baudrenghien, P; Bracco, C; Dehning, B; Di Mauro, A; Drosdal, L; Emery, J; Goddard, B; Holzer, E B; Höfle, W; Kain, V; Meddahi, M; Radaelli, S; Shaposhnilova, E; Uythoven, J; Valuch, D; Wenninger, J; Zamantzas, C; Gianfelice-Wendt, E

    2012-01-01

    Injection losses are compared for 2010 and 2011 operation. Mitigation techniques which were put in place in 2010 to reduce losses at injection are described. Issues in 2011 operation, their potential improvements and the performance reach for 2012 are shown.

  2. OI Issues: Hearing Loss

    Science.gov (United States)

    Hearing Loss and Osteogenesis Imperfecta Introduction Significant hearing loss has been reported in approximately 50% of people with osteogenesis imperfecta (OI) beginning any time from childhood into middle age. While not ...

  3. Hearing loss and music

    Science.gov (United States)

    ... and how often you are exposed to loud music Headphone use Family history of hearing loss Jobs or activities that increase your chance of hearing loss from music are: Being a musician, sound crew member, or ...

  4. Recurrent pregnancy loss

    DEFF Research Database (Denmark)

    Egerup, Pia; Kolte, A M; Larsen, E C

    2016-01-01

    STUDY QUESTION: Is there a different prognostic impact for consecutive and non-consecutive early pregnancy losses in women with secondary recurrent pregnancy loss (RPL)? SUMMARY ANSWER: Only consecutive early pregnancy losses after the last birth have a statistically significant negative prognostic...... impact in women with secondary RPL. WHAT IS KNOWN ALREADY: The risk of a new pregnancy loss increases with the number of previous pregnancy losses in patients with RPL. Second trimester losses seem to exhibit a stronger negative impact than early losses. It is unknown whether the sequence of pregnancy...... losses plays a role for the prognosis in patients with a prior birth. STUDY DESIGN, SIZE, DURATION: This retrospective cohort study of pregnancy outcome in patients with unexplained secondary RPL included in three previously published, Danish double-blinded placebo-controlled trials of intravenous...

  5. Canine hearing loss management.

    Science.gov (United States)

    Scheifele, Lesa; Clark, John Greer; Scheifele, Peter M

    2012-11-01

    Dog owners and handlers are naturally concerned when suspicion of hearing loss arises for their dogs. Questions frequently asked of the veterinarian center on warning signs of canine hearing loss and what can be done for the dog if hearing loss is confirmed. This article addresses warning signs of canine hearing loss, communication training and safety awareness issues, and the feasibility of hearing aid amplification for dogs. Copyright © 2012 Elsevier Inc. All rights reserved.

  6. ACLY and ACC1 Regulate Hypoxia-Induced Apoptosis by Modulating ETV4 via α-ketoglutarate.

    Directory of Open Access Journals (Sweden)

    Melissa M Keenan

    2015-10-01

    Full Text Available In order to propagate a solid tumor, cancer cells must adapt to and survive under various tumor microenvironment (TME stresses, such as hypoxia or lactic acidosis. To systematically identify genes that modulate cancer cell survival under stresses, we performed genome-wide shRNA screens under hypoxia or lactic acidosis. We discovered that genetic depletion of acetyl-CoA carboxylase (ACACA or ACC1 or ATP citrate lyase (ACLY protected cancer cells from hypoxia-induced apoptosis. Additionally, the loss of ACLY or ACC1 reduced levels and activities of the oncogenic transcription factor ETV4. Silencing ETV4 also protected cells from hypoxia-induced apoptosis and led to remarkably similar transcriptional responses as with silenced ACLY or ACC1, including an anti-apoptotic program. Metabolomic analysis found that while α-ketoglutarate levels decrease under hypoxia in control cells, α-ketoglutarate is paradoxically increased under hypoxia when ACC1 or ACLY are depleted. Supplementation with α-ketoglutarate rescued the hypoxia-induced apoptosis and recapitulated the decreased expression and activity of ETV4, likely via an epigenetic mechanism. Therefore, ACC1 and ACLY regulate the levels of ETV4 under hypoxia via increased α-ketoglutarate. These results reveal that the ACC1/ACLY-α-ketoglutarate-ETV4 axis is a novel means by which metabolic states regulate transcriptional output for life vs. death decisions under hypoxia. Since many lipogenic inhibitors are under investigation as cancer therapeutics, our findings suggest that the use of these inhibitors will need to be carefully considered with respect to oncogenic drivers, tumor hypoxia, progression and dormancy. More broadly, our screen provides a framework for studying additional tumor cell stress-adaption mechanisms in the future.

  7. Transition after Traumatic Loss

    Science.gov (United States)

    Kuban, Caelan

    2011-01-01

    Children experience grief when they suffer the loss of a close relationship. When that loss also traumatizes children, they experience additional emotional reactions. It is important that adults educate themselves and others who deal with children about typical, healthy grief reactions. Following a non-violent loss, the initial reactions of…

  8. Medicines and Bone Loss

    Science.gov (United States)

    Fact Sheet Medici a ne n s d Bone Loss Some types of medicines can cause bone loss, making your bones weak, if used for a long time. Use over a short time ... old bone and replaces it with new bone. Bone loss occurs when old bone breaks down faster than ...

  9. The ACS Nearby Galaxy Survey Treasury: Overview

    Science.gov (United States)

    Dalcanton, Julianne

    2006-12-01

    The ACS Nearby Galaxy Survey Treasury program (ANGST) consists of a carefully crafted imaging survey of a volume-limited sample of galaxies in the Local Universe outside the Local Group. The resulting images will allow unprecedented measurements of: (1) the SFH of a >100 Mpc3 volume of the Universe with a time resolution of Delta[log(t)]=0.25; (2) correlations between spatially resolved SFHs and environment; (3) the structure and properties of thick disks and stellar halos; and (4) the color distributions, sizes, and specific frequencies of globular and disk clusters as a function of galaxy mass and environment. To reach these goals, we are using a combination of wide-field tiling, pointed deep imaging, and archival data to carry out a uniform analysis of the ancient and recent star formation histories of 70 galaxies within a volume-limited sample extending to 3.5 Mpc, with an extension to the M81 group. For all galaxies, a radial strip of imaging will cover out to beyond the optical radius and will reach photometric depths of at least 2 magnitudes below the tip of the red giant branch throughout the limits of the survey volume. Additional deep pointings will reach SNR 10 for red clump stars, sufficient to recover the ancient star formation history (SFH) from the color-magnitude diagram for the galaxies that provide more than 99% of the star formation in the local volume. The resulting analysis will produce photometric information for several million stars.

  10. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  11. Electron transport through ac driven graphene p-n junctions

    Science.gov (United States)

    Zhang, Zhi-Qiang; Kang, Yan-Zhuo; Ding, Kai-He

    2018-02-01

    We study the electronic transport through ac driven graphene p-n junctions under a perpendicular magnetic field. It is found that subject to the transversely or longitudinally polarized ac field, in the p-n region, the conductance versus the on-site energy of the right electrode exhibits a characteristic structure with a zero value plateau and the followed oscillation peaks, whose widths are greatly suppressed by the ac field. In the n-n region, the conductance plateaus at G = (n + 1 / 2) (4e2 / h) (n is an integer) shrink for the transversely polarized ac field, whereas accompanied with the addition of the new quantized plateaus at G = n (4e2 / h) for the longitudinally polarized ac field. The combined influence of the ac field with the disorder can trigger a change in the mixing of the hole and electron states at the p-n interface, which leads to a destruction of the plateaus structure in the conductance versus the disorder strength with the emergence of new ones. The influence of the elliptically and circularly polarized ac field on the conductance is also shown.

  12. Beam Loss in Linacs

    CERN Document Server

    Plum, M.A.

    2016-01-01

    Beam loss is a critical issue in high-intensity accelerators, and much effort is expended during both the design and operation phases to minimize the loss and to keep it to manageable levels. As new accelerators become ever more powerful, beam loss becomes even more critical. Linacs for H- ion beams, such as the one at the Oak Ridge Spallation Neutron Source, have many more loss mechanisms compared to H+ (proton) linacs, such as the one being designed for the European Spallation Neutron Source. Interesting H- beam loss mechanisms include residual gas stripping, H+ capture and acceleration, field stripping, black-body radiation and the recently discovered intra-beam stripping mechanism. Beam halo formation, and ion source or RF turn on/off transients, are examples of beam loss mechanisms that are common for both H+ and H- accelerators. Machine protection systems play an important role in limiting the beam loss.

  13. An adenylyl cyclase like-9 gene (NlAC9) influences growth and fecundity in the brown planthopper, Nilaparvata lugens (Stål) (Hemiptera: Delphacidae).

    Science.gov (United States)

    Ge, LinQuan; Gu, HaoTian; Huang, Bo; Song, Qisheng; Stanley, David; Liu, Fang; Yang, Guo-Qing; Wu, Jin-Cai

    2017-01-01

    The cAMP/PKA intracellular signaling pathway is launched by adenylyl cyclase (AC) conversion of adenosine triphosphate (ATP) to 3', 5'-cyclic AMP (cAMP) and cAMP-dependent activation of PKA. Although this pathway is very well known in insect physiology, there is little to no information on it in some very small pest insects, such as the brown planthopper (BPH), Nilaparvata lugens Stål. BPH is a destructive pest responsible for tremendous crop losses in rice cropping systems. We are investigating the potentials of novel pest management technologies from RNA interference perspective. Based on analysis of transcriptomic data, the BPH AC like-9 gene (NlAC9) was up-regulated in post-mating females, which led us to pose the hypothesis that NlAC9 is a target gene that would lead to reduced BPH fitness and populations. Targeting NlAC9 led to substantially decreased soluble ovarian protein content, yeast-like symbiont abundance, and vitellogenin gene expression, accompanied with stunted ovarian development and body size. Eggs laid were decreased and oviposition period shortened. Taken together, our findings indicated that NlAC9 exerted pronounced effects on female fecundity, growth and longevity, which strongly supports our hypothesis.

  14. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  15. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the grids......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...

  16. Risk of Fetal Loss Associated With Invasive Testing Following Combined First-Trimester Screening for Down Syndrome

    DEFF Research Database (Denmark)

    Wulff, C. B.; Gerds, T. A.; Rode, L.

    2016-01-01

    The risk of miscarriage after chorionic villus sampling (CVS) and amniocentesis (AC) was investigated in randomized clinical trials in the 1980s and 1990s. Studies have compared CVS with AC and found comparable risk of miscarriage after the 2 procedures. Since then, prenatal screening has changed...... from being based on maternal age to combined first-trimester screening (cFTS) for trisomy 21. The aim of the study was to assess prospectively the risk of fetal loss associated with CVS and AC after cFTS for Down syndrome. A nationwide population-based study (Danish Fetal Medicine Database, 2008......FTS for AC. Results of the study indicated that the risks of miscarriage and stillbirth were not higher in women exposed to CVS or AC compared with unexposed women, independent of the analysis time point. Average effect of CVS on risk of miscarriage was -0.08% (95% confidence interval [CI], -0.64 to 0...

  17. ALTERNATING CURRENT LOSSES IN AG-SHEATHED BSCCO (2212 AND 2223) TAPES AND WIRES AND YBCO (123) COATED CONDUCTORS

    Energy Technology Data Exchange (ETDEWEB)

    Dr. John S. Hurley

    2000-01-01

    In this study, we focus on the examination of ac losses in conductors utilizing Bi{sub 2}Sr{sub 2}Ca{sub 2}Cu{sub 3}O [BSCCO (2223)] high TC superconductors (HTS). In addition, we seek to assist other facilities such as the University of Wisconsin-Madison Applied Superconductivity Center (UW-ASC), Brookhaven National Laboratory, and other DoE facilities investigating the use of HTS in electric power applications (e.g., generators, motors, and transformers). To accomplish this we will develop an ac losses capability at Clark Atlanta University to complement the established ac losses efforts at Brookhaven National Laboratory (BSCCO) on BSCCO/Ag and various material characterization efforts taking place at the UW-ASC. Our goal is through this effort to gain a greater understanding of the effects on ac losses due to parameters such as ac/dc current, J{sub c}, tape geometry, voltage tap placement, field orientation, material anisotropy, surface irregularities, percolations and filament coupling effects. As a result, we expect to better understand how to minimize ac losses in applications requiring real or practical conductors. HTS conductors based on BSCCO-2223 are now being routinely produced in industrial lengths of high quality. Vendors such as Southwire and ASC are producing multi-filamentary tapes in lengths of 6 km or more carrying critical current densities of up to 3 kA/cm**2 at 77 K. While this is approaching the level of performance where some large-scale applications are considered to be economically viable, a number of problems remain to be solved. The remaining issues include: rapid reduction in JC in magnetic fields; and power dissipation due to varying magnetic fields or currents (ac losses).

  18. ISTTOK upgrade towards AC and remote operation

    Science.gov (United States)

    Fernandes, H.; Silva, C.; Carvalho, B.; Sousa, J.; Valcárcel, D.; Neto, A.; Fortunato, J.; Carvalho, I.; Varandas, C. A. F.

    2006-12-01

    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed. In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented. The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat.

  19. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  20. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto

    2014-01-01

    Analytical methods of cable performance in EHV AC electrical power are discussed in this comprehensive reference. Descriptions of energization, power quality, cable safety constraints and more, guide readers in cable planning and power network operations.

  1. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  2. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  3. Non-vanishing ponderomotive AC electrophoretic effect for particle trapping

    Energy Technology Data Exchange (ETDEWEB)

    Guan Weihua; Reed, Mark A [Department of Electrical Engineering, Yale University, New Haven, CT 06520 (United States); Park, Jae Hyun; Krstic, Predrag S, E-mail: mark.reed@yale.edu [Physics Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States)

    2011-06-17

    We present here a study on overlooked aspects of alternating current (AC) electrokinetics-AC electrophoretic (ACEP) phenomena. The dynamics of a particle with both polarizability and net charges in a non-uniform AC electric trapping field is investigated. It is found that either electrophoretic (EP) or dielectrophoretic (DEP) effects can dominate the trapping dynamics, depending on experimental conditions. A dimensionless parameter {gamma} is developed to predict the relative strength of EP and DEP effects in a quadrupole AC field. An ACEP trap is feasible for charged particles in 'salt-free' or low salt concentration solutions. In contrast to DEP traps, an ACEP trap favors the downscaling of the particle size.

  4. National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit

    Science.gov (United States)

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...

  5. Detection of Genetic Modification 'ac2' in Potato Foodstuffs

    Directory of Open Access Journals (Sweden)

    Petr Kralik

    2009-01-01

    Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

  6. Initial tests of an AC dipole for the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; /Texas U.; Jansson, A.; /Fermilab; Kopp, S.; /Texas U.; Syphers, M.; /Fermilab

    2006-06-01

    The AC dipole is a device to diagnose transverse motions of a beam. It can achieve large-amplitude oscillations without two inevitable problems of conventional kicker/pinger magnets: decoherence and emittance growth. While not the first synchrotron to operate with an AC dipole, the Tevatron can now make use of its recently upgraded BPM system, providing unprecedented resolution for use with an AC dipole, to measure both linear and nonlinear properties of the accelerator. Plans are to provide AC dipole systems for both transverse degrees of freedom. Preliminary tests have been done using an audio power amplifier with an existing vertical pinger magnet, producing oscillation amplitudes up to 2{sigma} at 150 GeV. In this paper, we will present the configuration of this system. We also show the analysis of a first few data sets, including the direct measurement of beta functions at BPM locations.

  7. Drugs and hair loss.

    Science.gov (United States)

    Patel, Mansi; Harrison, Shannon; Sinclair, Rodney

    2013-01-01

    Hair loss is a common complaint, both in men and women, and use of prescription medications is widespread. When there is a temporal association between the onset of hair loss and commencement of a medication, the medication is commonly thought to have caused the hair loss. However, hair loss and in particular telogen effluvium may occur in response to a number of triggers including fever, hemorrhage, severe illness, stress, and childbirth, and a thorough exclusion of these potential confounders is necessary before the hair loss can be blamed on the medication. Certain medications are known to cause hair loss by a variety of mechanisms including anagen arrest, telogen effluvium, or accentuation of androgenetic alopecia by androgens. Crown Copyright © 2013. Published by Elsevier Inc. All rights reserved.

  8. Handbook on loss reserving

    CERN Document Server

    Schmidt, Klaus; Schnaus, Anja

    2016-01-01

    This handbook presents the basic aspects of actuarial loss reserving. Besides the traditional methods, it also includes a description of more recent ones and a discussion of certain problems occurring in actuarial practice, like inflation, scarce data, large claims, slow loss development, the use of market statistics, the need for simulation techniques and the task of calculating best estimates and ranges of future losses. In property and casualty insurance the provisions for payment obligations from losses that have occurred but have not yet been settled usually constitute the largest item on the liabilities side of an insurer's balance sheet. For this reason, the determination and evaluation of these loss reserves is of considerable economic importance for every property and casualty insurer. Actuarial students, academics as well as practicing actuaries will benefit from this overview of the most important actuarial methods of loss reserving by developing an understanding of the underlying stochastic models...

  9. Loss of vision.

    Science.gov (United States)

    Lueck, Christian J

    2010-12-01

    Visual loss is not uncommon and many patients end up seeing neurologists because of it. There is a long list of possible causes but in most patients visual loss is associated with visual field loss. This means that for practical purposes the differential diagnosis can usually be narrowed down to a manageable shortlist by consideration of where in the visual pathway the lesion is likely to be, along with the time course of the visual loss. This article provides a practical approach to the diagnosis and appropriate investigation of such patients, dividing them into four groups: those in whom vision is lost transiently, acutely, subacutely (i.e., days to weeks) and over a longer time frame (months to years). In addition, there is a discussion of those patients in whom visual loss is not obviously accompanied by any visual field loss.

  10. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    For a sufficiently strong ac field the dc conductance fluctuations are much stronger for the periodic pumping than in the case of the noise ac field of the same intensity. The reduction factor in a static magnetic field takes the universal value of 2 only for the white-noise pumping. In general may deviate from 2 thus ...

  11. AC magnetic dipole localization by a magnetoelectric sensor

    Science.gov (United States)

    Shen, Y.; McLaughlin, K. L.; Gao, J.; Gray, D.; Shen, L.; Wang, Y.; Li, M.; Berry, D.; Li, J.; Viehland, D.

    2012-06-01

    We report progress towards achievement of a triple-axis magnetoelectric (ME) sensor technology that is capable of localizing an AC magnetic dipole at quasi-static frequencies. Estimation of the location of the AC dipole was realized with the help of a grid search (GS) algorithm. The results show good convergence and accuracy of object location along three orthogonal directions. Through simulation analysis, the major localization errors were found to arise from sensor calibration.

  12. Mixed mobile ion effect on ac conductivity of boroarsenate glasses

    Indian Academy of Sciences (India)

    In this article we report the study of mixed mobile ion effect (MMIE) in boroarsenate glasses. DSC and a.c. electrical conductivity studies have been carried out for MgO–(25−)Li2O–50B2O3–25As2O3 glasses. It is observed that strength of MMIE in a.c. conductivity is less pronounced with increase in temperature and ...

  13. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  14. Optimal football strategies: AC Milan versus FC Barcelona

    OpenAIRE

    Papahristodoulou, Christos

    2012-01-01

    In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

  15. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc....... Mathematically, our study refers to the expanding area of fractional calculus and we propose a systematic derivation of the fractional relaxation and fractional diffusion equations from the property of ac universality....

  16. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  17. Experimental verification of Faradaic charging in ac electrokinetics.

    Science.gov (United States)

    Ng, Wee Yang; Lam, Yee Cheong; Rodríguez, Isabel

    2009-04-23

    This paper investigates the phenomenon of Faradaic charging in ac electrokinetics. Faradaic reactions were suggested as a key effect responsible for the reversal of pumping direction in ac micropumps. However, this hypothesis has yet to be proven convincingly and directly. Here we present an ion detection strategy to determine the production of ions through Faradaic hydrolytic reactions originating from direct application of voltage to electrolytic solutions during ac electrokinetics. Experiments were performed with symmetrical planar electrodes aligned along a microfluidic channel. Fluorescein, a pH-dependent dye, was employed as the pH indicator for the detection of ion production. Images were captured for analysis at various voltage levels. From analyzing the fluorescence intensity and its distribution, it can be concluded that the production of ions from hydrolytic reactions takes place and increases with the ac voltage. The coefficient of deviation indicates a significant enhancement at ac voltage above 11 V(pp). Lastly, we demonstrate a strategy using dc-biased ac electrokinetics to achieve controllability in direction and magnitude of the net fluid flow in pumping application.

  18. Role of the AcsF protein in Chloroflexus aurantiacus.

    Science.gov (United States)

    Tang, Kuo-Hsiang; Wen, Jianzhong; Li, Xianglu; Blankenship, Robert E

    2009-06-01

    The green phototrophic bacteria contain a unique complement of chlorophyll pigments, which self-assemble efficiently into antenna structures known as chlorosomes with little involvement of protein. The few proteins found in chlorosomes have previously been thought to have a primarily structural function. The biosynthetic pathway of the chlorosome pigments, bacteriochlorophylls c, d, and e, is not well understood. In this report, we used spectroscopic, proteomic, and gene expression approaches to investigate the chlorosome proteins of the green filamentous anoxygenic phototrophic bacterium Chloroflexus aurantiacus. Surprisingly, Mg-protoporphyrin IX monomethyl ester (oxidative) cyclase, AcsF, was identified under anaerobic growth conditions. The AcsF protein was found in the isolated chlorosome fractions, and the proteomics analysis suggested that significant portions of the AcsF proteins are not accessible to protease digestion. Additionally, quantitative real-time PCR studies showed that the transcript level of the acsF gene is not lower in anaerobic growth than in semiaerobic growth. Since the proposed enzymatic activity of AcsF requires molecular oxygen, our studies suggest that the roles of AcsF in C. aurantiacus need to be investigated further.

  19. AC electrophoretic deposition of organic-inorganic composite coatings.

    Science.gov (United States)

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R

    2013-02-15

    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials. Copyright © 2012 Elsevier Inc. All rights reserved.

  20. [Genetic hearing loss].

    Science.gov (United States)

    Tanaka-Ouyang, Lei; Marlin, Sandrine; Nevoux, Jérôme

    2017-11-01

    Deafness is the most common sensory disability in developed countries affecting more than 2 births in 1000. Eighty percent of congenital deafness is genetic. Universal newborn hearing screening has been in place since 2012 in France. All genetic hearing losses are not congenital and all congenital hearing losses are not genetic. Genetic hearing loss may be syndromic (associated with other symptoms) (10 %) or non-syndromic (isolated) (90 %). Hearing loss may initially be the only symptom of syndromic deafness. A genetic origin can be diagnosed and must therefore be evoked systematically even in the adult. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  1. Self-field loss in Ag / Bi-2223 tape in various temperatures and frequencies; Ag / Bi-2223 tepu no ondo {center_dot} syuhasu wo kaeta koryu sonshitsu tokusei

    Energy Technology Data Exchange (ETDEWEB)

    Wakasugi, K.; Natsume, K.; Naito, S.; Murase, S.; Shimamoto, S. [Tohoku Univ., Miyagi (Japan). Graduate School of Engineering

    2000-05-29

    AC losses of high temperature superconductor of oxides in bismuth series at commercial frequency and liquid nitrogen temperature have been reported till now. An AC loss was examined this time over wide temperature range (9 K - 77 K) and various frequencies region (3 Hz - 1500 Hz). Fifty-five Ag-sheathed multifilamentary tape wires were examined. Cooling by heat conduction using GM refrigerator was employed. AC loss was calculated from electric voltage induced inside the sample. As the result, deviation from Norris theory was found at frequency region below about 10 Hz and over 500 Hz. In particular, this trend appeared remarkably at low current and low temperature. (NEDO)

  2. Modulation schemes with enhanced switch thermal distribution for single-phase AC-DC-AC reduced-switch converters

    DEFF Research Database (Denmark)

    Qin, Zian; Loh, Poh Chiang; Blaabjerg, Frede

    2015-01-01

    though various topologies have been proposed. The motivation of this paper is to study two promising single-phase ac-dc-ac converters using reduced number of switches, and subsequently proposes new modulation schemes for them. The proposed schemes help the converters to achieve a better thermal spread...... among their switches, while keeping their dc-link voltages low. Single points of failure are thus minimized, allowing the converters to have longer lifetimes. Simulation and experimental results have demonstrated the intended performances and hence verifying the idea.......ulation schemes can significantly change the performance of a power converter in steady state, and they have been extensively studied, but mostly directed to three-phase topologies, where triplen offsets are added. Single-phase systems, including ac-dc-ac systems, are less widely pursued, even...

  3. Hearing Loss in Children: Types of Hearing Loss

    Science.gov (United States)

    ... Hearing Loss Homepage Facts Noise-Induced Hearing Loss Genetics of Hearing Loss Screening & Diagnosis Types of Hearing Loss About Sound Treatment & Intervention Services Learning Language Bacterial Meningitis Studies Data & Statistics EHDI Annual Data 2015 ...

  4. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  5. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...... it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach....

  6. Loss of 115 kV Power

    Energy Technology Data Exchange (ETDEWEB)

    Smith, J.A.

    2001-08-22

    This report discusses the postulated loss of 115 kV power. Continuous electrical power to Savannah River Plant reactors is necessary to maintain water flow for heat removal and essential monitoring and control. Should power supplied to the plant 115 kV system from offsite be lost, on-site generation is sufficient to maintain all reactors in a safe shutdown mode for an indefinite period. Should on-site generators for the 115 kV grid also be lost, diesel-electric generators within each reactor building are also sufficient to maintain safe shutdown for a finite period. In all cases DC power for necessary monitoring and control would be available from battery systems with AC converter backup.

  7. Overexpression of PP2A-C5 that encodes the catalytic subunit 5 of protein phosphatase 2A in Arabidopsis confers better root and shoot development under salt conditions.

    Science.gov (United States)

    Hu, Rongbin; Zhu, Yinfeng; Wei, Jia; Chen, Jian; Shi, Huazhong; Shen, Guoxin; Zhang, Hong

    2017-01-01

    Protein phosphatase 2A (PP2A) is an enzyme consisting of three subunits: a scaffolding A subunit, a regulatory B subunit and a catalytic C subunit. PP2As were shown to play diverse roles in eukaryotes. In this study, the function of the Arabidopsis PP2A-C5 gene that encodes the catalytic subunit 5 of PP2A was studied using both loss-of-function and gain-of-function analyses. Loss-of-function mutant pp2a-c5-1 displayed more impaired growth during root and shoot development, whereas overexpression of PP2A-C5 conferred better root and shoot growth under different salt treatments, indicating that PP2A-C5 plays an important role in plant growth under salt conditions. Double knockout mutants of pp2a-c5-1 and salt overly sensitive (sos) mutants sos1-1, sos2-2 or sos3-1 showed additive sensitivity to NaCl, indicating that PP2A-C5 functions in a pathway different from the SOS signalling pathway. Using yeast two-hybrid analysis, four vacuolar membrane chloride channel (CLC) proteins, AtCLCa, AtCLCb, AtCLCc and AtCLCg, were found to interact with PP2A-C5. Moreover, overexpression of AtCLCc leads to increased salt tolerance and Cl- accumulation in transgenic Arabidopsis plants. These data indicate that PP2A-C5-mediated better growth under salt conditions might involve up-regulation of CLC activities on vacuolar membranes and that PP2A-C5 could be used for improving salt tolerance in crops. © 2016 The Authors Plant, Cell & Environment Published by John Wiley & Sons Ltd.

  8. Loss muinasjuturaamatust / Agu Veetamm

    Index Scriptorium Estoniae

    Veetamm, Agu, 1953-

    2004-01-01

    Ballindaloch on üks väheseid Shoti losse, kus omanikud aastaringselt elavad. 450 aastat on loss kuulunud Macpherson-Grantide suguvõsale. Praegu on lossi omanikuks Clare Nancy Macpherson-Grant Russell, kelle kujundatud on kiviktaimla ja rosaarium. Lossi ajaloost, omanikest, ümberehitustest, ringkäigust lossis, pargist. 14 ill

  9. Experimental circulation loss study

    OpenAIRE

    Lund, Sigurd

    2013-01-01

    Circulation losses could occur during any operation that involves pumping into a well. As of today, it is recognized as one of the most costly drilling problems. In some situation it might be hard to stop, and usually takes precious rig time to deal with the problem. In order to mitigate the risk of circulation loss solid pa...

  10. Grief following homicidal loss

    NARCIS (Netherlands)

    van Denderen, Mariëtte

    2017-01-01

    People confronted with homicidal loss have to cope with separation distress, related to their loss, and traumatic distress, associated with the circumstances surrounding the death. These reactions are related to complicated grief and posttraumatic stress symptoms. Based on a questionnaire study

  11. Hearing Loss and Cytomegalovirus.

    Science.gov (United States)

    Strauss, Melvin

    1997-01-01

    Cytomegalovirus is the most common cause of congenital virally induced hearing loss. Maternal infection is most often asymptomatic as is the infection in the newborn. Hearing loss occurs in both clinically apparent infection and in the asymptomatic infection. Current methods of detection, treatment, and prevention and research efforts are…

  12. Weight Loss Surgery

    Science.gov (United States)

    Weight loss surgery helps people with extreme obesity to lose weight. It may be an option if you cannot lose weight through diet and exercise or have serious health problems caused by obesity. There are different types of weight loss surgery. They often limit the amount of food ...

  13. Proven Weight Loss Methods

    Science.gov (United States)

    Fact Sheet Proven Weight Loss Methods What can weight loss do for you? Losing weight can improve your health in a number of ways. ... you feel better. There are proven ways to lose weight. You can find what works for you. Research ...

  14. Non pecuniary losses

    NARCIS (Netherlands)

    S.D. Lindenbergh (Siewert); P.M. Kippersluis (Peter)

    2009-01-01

    textabstractNon pecuniary losses can be characterized as losses that are suffered by damaging goods or interests which have in themselves no economic price or value on a financial market. Examples are damage to goods with a primarily sentimental value, such as an album of wedding photos, pain and

  15. Isolated Contralateral Sudden Sensorineural Hearing Loss: An Unusual Manifestation of Pontine Infarct

    OpenAIRE

    Eluvathingal Muttikkal, Thomas Jose; Kesser, Bradley W.; Mukherjee, Sugoto

    2014-01-01

    Unilateral, acute onset sensorineural hearing loss (“sudden sensorineural hearing loss” [SSNHL]) as an isolated event without other associated neurological deficits usually results from a lesion of the cochlea. Lesions in the ascending central auditory pathways cranial to the cochlear nucleus seldom result in unilateral hearing loss due to decussation of the central auditory pathways at multiple levels. We describe a patient with a tiny acute infarct in the right pons resulting in isolated ac...

  16. [Inner Ear Hearing Loss].

    Science.gov (United States)

    Hesse, G

    2016-06-01

    Hearing loss is one of the most dominant handicaps in modern societies, which additionally very often is not realized or not admitted. About one quarter of the general population suffers from inner ear hearing loss and is therefore restricted in communicational skills. Demographic factors like increasing age play an important role as well as environmental influences and an increasing sound and noise exposure especially in leisure activities. Thus borders between a "classical" presbyacusis - if it ever existed - and envirionmentally induced hearing loss disappear. Today restrictions in hearing ability develop earlier in age but at the same time they are detected and diagnosed earlier. This paper can eventually enlighten the wide field of inner ear hearing loss only fragmentarily; therefore mainly new research, findings and developments are reviewed. The first part discusses new aspects of diagnostics of inner ear hearing loss and different etiologies. © Georg Thieme Verlag KG Stuttgart · New York.

  17. Noise-Induced Hearing Loss

    Science.gov (United States)

    ... Hearing Loss Homepage Facts Noise-Induced Hearing Loss Genetics of Hearing Loss Screening & Diagnosis Types of Hearing Loss About Sound Treatment & Intervention Services Learning Language Bacterial Meningitis Studies Data & Statistics EHDI Annual Data 2015 ...

  18. The Effect of Adding Antimony Trioxide (Sb2O3 ‎On A.C Electrical Properties of (PVA-PEG Films

    Directory of Open Access Journals (Sweden)

    Akeel Shakir Alkelaby

    2017-12-01

    Full Text Available In this work, many samples have been prepared by adding Antimony Trioxide (Sb2O3 to the polyvinyl alcohol-poly ethylene glycol (PVA-PEG. The effect of the Sb2O3 added as a filler with different weight percentages on the A.C electrical properties have been investigated. The samples were prepared as films by solution cast technique. The experimental results of the A.C electrical properties show that the dielectric constant increase with the increasing frequency of applied electrical field and concentration of the Antimony Trioxide. Dielectric loss decrease with the increasing the frequency, while it increases with the increase of the concentration of the Antimony Trioxide. The A.C electrical conductivity increase with increasing the Antimony Trioxide contain and frequency for the composition.

  19. Dielectric properties, ac conductivity and thermal behaviour of flux grown cadmium titanate crystals

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Vineeta [Crystal Growth and Materials Research Laboratory, Department of Physics and Electronics, University of Jammu, Jammu 180 006 (India); Bamzai, K.K. [Crystal Growth and Materials Research Laboratory, Department of Physics and Electronics, University of Jammu, Jammu 180 006 (India); Kotru, P.N. [Crystal Growth and Materials Research Laboratory, Department of Physics and Electronics, University of Jammu, Jammu 180 006 (India)]. E-mail: pn_kotru@yahoo.com; Wanklyn, B.M. [Clarendon Laboratory, Department of Physics, University of Oxford, Oxford OX13 PU (United Kingdom)

    2006-06-15

    The dependence of loss tangent (tan {delta}) and both real and imaginary parts of the dielectric constant ({epsilon}' and {epsilon}'') on temperature in the range 298-923 K and frequency in the range 10{sup 3}-10{sup 6} Hz for flux grown CdTiO{sub 3} single crystals is reported. The ln {sigma} {sub ac} versus T plots suggest the conduction mechanism to be ionic hopping conduction. From ln {sigma} {sub ac} versus frequency curves, it can be seen that the slope decreases with the rise in temperature, suggesting that the ionic hopping conduction diminishes with the rise in temperature. The activation energy at various fixed frequencies is calculated from the slope of the graph between ln {sigma} {sub ac} versus 1/T (x10{sup 3} K{sup -1}). Thermal behaviour of flux grown CdTiO{sub 3} crystals using thermoanalytical techniques including TG, DTA and DTG is discussed. Thermal analysis suggests decomposition of CdTiO{sub 3} in the temperature interval of 1386-1693 K leading to the formation of TiO{sub 2} as the final product. Results obtained on application of TG based models viz. Horowitz-Metzger, Coats-Redfern and Piloyan-Novikova are reported. The results of kinetics of thermal decomposition suggest contracting cylinder model as the one that is relevant to the decomposition of CdTiO{sub 3}. The kinetic parameters viz. the order of reaction, activation energy, frequency factor, and entropy of activation using the above mentioned models are computed.

  20. Loss and Inductance Investigation in Superconducting Cable Conductors

    DEFF Research Database (Denmark)

    Olsen, Søren Krüger; Tønnesen, Ole; Træholt, Chresten

    1999-01-01

    An important parameter in the design and optimization of a superconducting cable conductor is the control of the current distribution among single tapes and layers. This distribution is to a large degree determined by inductances, since the resistances are low. The self and mutual inductances...... of the layers are therefore studied theoretically. The current distribution between the superconducting layers is monitored as a function of transport current, and the results are compared with the expected current distribution given by our electrical circuit model.The AC-losses are measured as a function...... of transport current and current distribution.This presentation is based on a number of experiments performed on prototype superconducting cable conductors. The critical current (1uV/cm) of the conductor at 77K was 1590 A (cable #1) and 3240 A (cable #2) respectively.At an rms current of 2 kA (50 Hz) the AC...

  1. Temas de Física para Ingeniería: Acústica

    OpenAIRE

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  2. Diphtheria and hearing loss.

    OpenAIRE

    Schubert, C. R.; Cruickshanks, K. J.; Wiley, T. L.; Klein, R.; Klein, B E; Tweed, T. S.

    2001-01-01

    OBJECTIVE: To determine if infectious diseases usually experienced in childhood have an effect on hearing ability later in life. METHODS: The Epidemiology of Hearing Loss Study (N = 3,753) is a population-based study of age-related hearing loss in adults aged 48 to 92 years in Beaver Dam, Wisconsin. As part of this study, infectious disease history was obtained and hearing was tested using pure-tone audiometry. Hearing loss was defined as a pure-tone average of thresholds at 500 Hz, 1,000 Hz,...

  3. AC propulsion system for an electric vehicle, phase 2

    Science.gov (United States)

    Slicker, J. M.

    1983-01-01

    A second-generation prototype ac propulsion system for a passenger electric vehicle was designed, fabricated, tested, installed in a modified Mercury Lynx vehicle and track tested at the Contractor's site. The system consisted of a Phase 2, 18.7 kw rated ac induction traction motor, a 192-volt, battery powered, pulse-width-modulated, transistorized inverter packaged for under rear seat installation, a 2-axis, 2-speed, automatically-shifted mechanical transaxle and a microprocessor-based powertrain/vehicle controller. A diagnostics computer to assist tuning and fault finding was fabricated. Dc-to-mechanical-system efficiency varied from 78% to 82% as axle speed/torque ranged from 159 rpm/788 nm to 65 rpm/328 nm. Track test efficiency results suggest that the ac system will be equal or superior to dc systems when driving urban cycles. Additional short-term work is being performed under a third contract phase (AC-3) to raise transaxle efficiency to predicted levels, and to improve starting and shifting characteristics. However, the long-term challenge to the system's viability remains inverter cost. A final report on the Phase 2 system, describing Phase 3 modifications, will be issued at the conclusion of AC-3.

  4. Unified Synthesis of Right Halves of Halichondrins A-C.

    Science.gov (United States)

    Yahata, Kenzo; Ye, Ning; Iso, Kentaro; Naini, Santhosh Reddy; Yamashita, Shuji; Ai, Yanran; Kishi, Yoshito

    2017-09-01

    The right halves of halichondrins A-C were synthesized by coupling the common C20-C37 building block 9 with the C1-C19 building blocks 10a-c, respectively. Catalytic, asymmetric Ni/Cr-mediated coupling was used for three C-C bond formations. For all cases, the stereochemistry was controlled with the Cr catalyst prepared from the chiral sulfonamide identified via the toolbox approach. For (3 + 4)-, (6 + 7)-, and (9 + 10)-couplings, the stereoselectivity of 28:1, >40:1, and ∼20:1 was achieved by the Cr catalysts prepared from (S)-H, (S)-I, and (R)-L, respectively. Unlike the first and second couplings, the third coupling used the structurally complex nucleophile. It was demonstrated that the coupling efficiency was excellent even with the electrophile/nucleophile molar ratio = 1.0/1.1. In addition, the third coupling was achieved with the substrate bearing a free hydroxyl group. The products obtained in the Ni/Cr-mediated couplings were converted to the right halves of halichondrins A-C in excellent overall yields. The right halves of halichondrins A-C (1a-c) were synthesized in 28, 24, and 24 steps from commercial d-galactal in 13.4%, 21.1%, and 16.7% overall yield, respectively.

  5. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  6. Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.

    Science.gov (United States)

    Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide

    2015-10-01

    Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  7. Cadmium-induced ethylene production and responses in Arabidopsis thaliana rely on ACS2 and ACS6 gene expression.

    Science.gov (United States)

    Schellingen, Kerim; Van Der Straeten, Dominique; Vandenbussche, Filip; Prinsen, Els; Remans, Tony; Vangronsveld, Jaco; Cuypers, Ann

    2014-08-01

    Anthropogenic activities cause metal pollution worldwide. Plants can absorb and accumulate these metals through their root system, inducing stress as a result of excess metal concentrations inside the plant. Ethylene is a regulator of multiple plant processes, and is affected by many biotic and abiotic stresses. Increased ethylene levels have been observed after exposure to excess metals but it remains unclear how the increased ethylene levels are achieved at the molecular level. In this study, the effects of cadmium (Cd) exposure on the production of ethylene and its precursor 1-aminocyclopropane-1-carboxylic acid (ACC), and on the expression of the ACC Synthase (ACS) and ACC Oxidase (ACO) multigene families were investigated in Arabidopsis thaliana. Increased ethylene release after Cd exposure was directly measurable in a system using rockwool-cultivated plants; enhanced levels of the ethylene precursor ACC together with higher mRNA levels of ethylene responsive genes: ACO2, ETR2 and ERF1 also indicated increased ethylene production in hydroponic culture. Regarding underlying mechanisms, it was found that the transcript levels of ACO2 and ACO4, the most abundantly expressed members of the ACO multigene family, were increased upon Cd exposure. ACC synthesis is the rate-limiting step in ethylene biosynthesis, and transcript levels of both ACS2 and ACS6 showed the highest increase and became the most abundant isoforms after Cd exposure, suggesting their importance in the Cd-induced increase of ethylene production. Cadmium induced the biosynthesis of ACC and ethylene in Arabidopsis thaliana plants mainly via the increased expression of ACS2 and ACS6. This was confirmed in the acs2-1acs6-1 double knockout mutants, which showed a decreased ethylene production, positively affecting leaf biomass and resulting in a delayed induction of ethylene responsive gene expressions without significant differences in Cd contents between wild-type and mutant plants.

  8. Cadmium-induced ethylene production and responses in Arabidopsis thaliana rely on ACS2 and ACS6 gene expression

    Science.gov (United States)

    2014-01-01

    Background Anthropogenic activities cause metal pollution worldwide. Plants can absorb and accumulate these metals through their root system, inducing stress as a result of excess metal concentrations inside the plant. Ethylene is a regulator of multiple plant processes, and is affected by many biotic and abiotic stresses. Increased ethylene levels have been observed after exposure to excess metals but it remains unclear how the increased ethylene levels are achieved at the molecular level. In this study, the effects of cadmium (Cd) exposure on the production of ethylene and its precursor 1-aminocyclopropane-1-carboxylic acid (ACC), and on the expression of the ACC Synthase (ACS) and ACC Oxidase (ACO) multigene families were investigated in Arabidopsis thaliana. Results Increased ethylene release after Cd exposure was directly measurable in a system using rockwool-cultivated plants; enhanced levels of the ethylene precursor ACC together with higher mRNA levels of ethylene responsive genes: ACO2, ETR2 and ERF1 also indicated increased ethylene production in hydroponic culture. Regarding underlying mechanisms, it was found that the transcript levels of ACO2 and ACO4, the most abundantly expressed members of the ACO multigene family, were increased upon Cd exposure. ACC synthesis is the rate-limiting step in ethylene biosynthesis, and transcript levels of both ACS2 and ACS6 showed the highest increase and became the most abundant isoforms after Cd exposure, suggesting their importance in the Cd-induced increase of ethylene production. Conclusions Cadmium induced the biosynthesis of ACC and ethylene in Arabidopsis thaliana plants mainly via the increased expression of ACS2 and ACS6. This was confirmed in the acs2-1acs6-1 double knockout mutants, which showed a decreased ethylene production, positively affecting leaf biomass and resulting in a delayed induction of ethylene responsive gene expressions without significant differences in Cd contents between wild-type and

  9. Analysis of power loss in Mn-Zn ferrites for switching power supplies

    Energy Technology Data Exchange (ETDEWEB)

    Otsuki, E.; Yamada, S. [Tokin Corporation, Sendai (Japan)

    1995-09-01

    Power loss in Mn-Zn ferrites for switching power supplies was investigated as a function of contents of Fe{sup 2+}, {gamma} and cation site deficiency, {delta} in spinel phase. The temperature, T{sub min}, where hysteresis loss attains a minimum, coincides with secondary peak temperature of initial permeability and decreases linearly with an increase in {gamma}. Ac resistivity at T{sub min} decreases {gamma} increases. At T{sub min}, {gamma} doesn`t affect the hysteresis loss, but has an influence on eddy current loss through ac resistivity, {rho}. It was found that P{sub e} = (total power loss minus hysteresis loss) can be divided into the eddy current loss and residual loss with P{sub e} - {rho}{sup -1} plots at T{sub min} experimentally. The eddy current loss obtained is consistent with the equation based on classical theory of magnetism. The content of cation site deficiency has no effect on the magnetic properties.

  10. AC Voltage Control of DC/DC Converters Based on Modular Multilevel Converters in Multi-Terminal High-Voltage Direct Current Transmission Systems

    Directory of Open Access Journals (Sweden)

    Rui Li

    2016-12-01

    Full Text Available The AC voltage control of a DC/DC converter based on the modular multilevel converter (MMC is considered under normal operation and during a local DC fault. By actively setting the AC voltage according to the two DC voltages of the DC/DC converter, the modulation index can be near unity, and the DC voltage is effectively utilized to output higher AC voltage. This significantly decreases submodule (SM capacitance and conduction losses of the DC/DC converter, yielding reduced capital cost, volume, and higher efficiency. Additionally, the AC voltage is limited in the controllable range of both the MMCs in the DC/DC converter; thus, over-modulation and uncontrolled currents are actively avoided. The AC voltage control of the DC/DC converter during local DC faults, i.e., standby operation, is also proposed, where only the MMC connected on the faulty cable is blocked, while the other MMC remains operational with zero AC voltage output. Thus, the capacitor voltages can be regulated at the rated value and the decrease of the SM capacitor voltages after the blocking of the DC/DC converter is avoided. Moreover, the fault can still be isolated as quickly as the conventional approach, where both MMCs are blocked and the DC/DC converter is not exposed to the risk of overcurrent. The proposed AC voltage control strategy is assessed in a three-terminal high-voltage direct current (HVDC system incorporating a DC/DC converter, and the simulation results confirm its feasibility.

  11. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  12. Experimental Investigation of the Corona Discharge in Electrical Transmission due to AC/DC Electric Fields

    Directory of Open Access Journals (Sweden)

    Fuangpian Phanupong

    2016-01-01

    Full Text Available Nowadays, using of High Voltage Direct Current (HVDC transmission to maximize the transmission efficiency, bulk power transmission, connection of renewable power source from wind farm to the grid is of prime concern for the utility. However, due to the high electric field stress from Direct Current (DC line, the corona discharge can easily be occurred at the conductor surface leading to transmission loss. Therefore, the polarity effect of DC lines on corona inception and breakdown voltage should be investigated. In this work, the effect of DC polarity and Alternating Current (AC field stress on corona inception voltage and corona discharge is investigated on various test objects, such as High Voltage (HV needle, needle at ground plane, internal defect, surface discharge, underground cable without cable termination, cable termination with simulated defect and bare overhead conductor. The corona discharge is measured by partial discharge measurement device with high-frequency current transformer. Finally, the relationship between supply voltage and discharge intensity on each DC polarity and AC field stress can be successfully determined.

  13. Understanding Grief and Loss

    Science.gov (United States)

    ... time. The grieving person’s age and gender The life history of the person who is grieving, including previous experiences with loss The grieving person’s personality and coping style The support available from friends and family The ...

  14. Coping with Memory Loss

    Science.gov (United States)

    ... professional. What Causes Memory Loss? Anything that affects cognition—the process of thinking, learning, and remembering—can ... Stages of Alzheimer's Disease More in Consumer Updates Animal & Veterinary Children's Health Cosmetics Dietary Supplements Drugs Food ...

  15. Hearing loss - infants

    Science.gov (United States)

    ... brain after birth, such as meningitis or measles Problems with the structure of the inner ear Tumors Central hearing loss results from damage to the auditory nerve itself, or the brain pathways that lead ...

  16. Hearing Loss: Screening Newborns

    Science.gov (United States)

    ... of this page please turn JavaScript on. Feature: Hearing Loss Screening Newborns Past Issues / Spring 2015 Table ... deafness, which account for most cases. Screening Newborns' Hearing Now Standard In 1993, children born in the ...

  17. Weight Loss & Acute Porphyria

    Science.gov (United States)

    ... APF You are here Home Diet and Nutrition Weight loss & acute Porphyria Being overweight is a particular problem ... of carbohydrate and energy in an effort to lose weight can worsen these diseases. Severe acute attacks have ...

  18. Female Pattern Hair Loss

    Science.gov (United States)

    ... of hormone imbalance, such as excess facial or body hair, a hormone evaluation should be done. Hormonal changes ... any sudden physical or psychological stress to the body. These types of hair loss are "Telogen Effluvium" and are usually temporary. ...

  19. Muscle function loss

    Science.gov (United States)

    ... myelopathy), or brain damage ( stroke or other brain injury) The loss of muscle function after these types of events can be ... Periodic paralysis Focal nerve injury Polio Spinal cord injury Stroke

  20. Energetic Particle Loss Estimates in W7-X

    Science.gov (United States)

    Lazerson, Samuel; Akaslompolo, Simppa; Drevlak, Micheal; Wolf, Robert; Darrow, Douglass; Gates, David; W7-X Team

    2017-10-01

    The collisionless loss of high energy H+ and D+ ions in the W7-X device are examined using the BEAMS3D code. Simulations of collisionless losses are performed for a large ensemble of particles distributed over various flux surfaces. A clear loss cone of particles is present in the distribution for all particles. These simulations are compared against slowing down simulations in which electron impact, ion impact, and pitch angle scattering are considered. Full device simulations allow tracing of particle trajectories to the first wall components. These simulations provide estimates for placement of a novel set of energetic particle detectors. Recent performance upgrades to the code are allowing simulations with > 1000 processors providing high fidelity simulations. Speedup and future works are discussed. DE-AC02-09CH11466.

  1. Measurement of nonlinear AC dissipation current waveform in oil-film composite insulating system. Abura-film fukugo zetsuenkei ni okeru hisenkei koryu sonshitsu denryuhakei no kansoku

    Energy Technology Data Exchange (ETDEWEB)

    Tokoro, T. (Gifu National College of Technology, Gifu (Japan)); Nagao, M.; Kosaki, M. (Toyohashi University of Technology, Aichi (Japan))

    1991-01-15

    Nonlinear AC dissipation current waveforms associated with a Garton effect were observed on an oil-film composite insulating system by the previously reported measuring method of dissipation microcurrent waveforms in AC electric fields. A laminated composite of polypropylene and oxidized insulating oil was used as a specimen, and dielectric loss tangents (tan {delta}) were measured by applying AC voltage of 50-400Hz to it. The tan {delta} increased up to a peak value with the applied voltage, and its peak point shifted toward a high voltage side decreasing the peak value with an increase in frequency, indicating the influence of a Garton effect. The amplitude of AC dissipation current waveforms associated with a Garton effect increased up to a peak value with the applied voltage corresponding to the tan {delta}, and the phase of the peak point delayed with an increase in frequency. As a result, the generation behavior of nonlinear AC dissipation current could be observed through applied voltage and frequency as parameters. 5 refs., 6 figs.

  2. Field resistance to the Bacillus thuringiensis protein Cry1Ac expressed in Bollgard(®) hybrid cotton in pink bollworm, Pectinophora gossypiella (Saunders), populations in India.

    Science.gov (United States)

    Mohan, Komarlingam S; Ravi, Kadanur C; Suresh, Pennadam J; Sumerford, Douglas; Head, Graham P

    2016-04-01

    Bollgard(®) cotton, expressing Cry1Ac insecticidal protein, was approved for commercial planting in India in 2002, and by 2009 constituted 87% of the Indian crop, reducing losses from lepidopteran pests, including pink bollworm (PBW), Pectinophora gossypiella. Inadequate control of PBW in fields of single-gene Bollgard cotton was reported in 2009; surveys revealed heavy infestations of PBW in Bollgard, restricted to Gujarat state, but not elsewhere in India. Bioassays of PBW strains from Bollgard bolls showed that, while susceptible PBW could not complete development to third and later instar at 10.0 µg Cry1Ac mL(-1) , 66.1% of larvae from Gujarat Bollgard strains could. A field-resistant strain, further selected in the laboratory, had susceptibility to Cry1Ac reduced by >2000-fold. Resistance to Cry1Ac did not confer cross-resistance to the Cry2Ab2 protein. In 2010, Bollgard fields in Gujarat continued to be infested with PBW, and many Bollgard fields in the adjoining states of Maharashtra and Madhya Pradesh showed high-level infestation by PBW. Inadequate planting of refuges for PBW is the likely explanation for the field resistance to Bt cotton observed in Gujarat. These findings underscore the higher vulnerability of single-gene Bt products relative to dual-gene products expressing Cry1Ac and Cry2Ab2, and the increased risk of resistance evolution with low refuge compliance. © 2015 Society of Chemical Industry.

  3. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  4. Particle manipulation using 3D ac electro-osmotic micropumps

    Science.gov (United States)

    Hilber, W.; Weiss, B.; Mikolasek, M.; Holly, R.; Hingerl, K.; Jakoby, B.

    2008-06-01

    We present a novel mechanism of particle manipulation in alternating-current (ac)- driven electro-osmotic micropumps, utilizing the tunable ratio of viscous drag, inertial and dielectrophoretic forces. The latter are induced by three-dimensional (3D) stepped electrode arrays in the channel, which are driven by ac voltages enabling so-called 3D-ac-electro-osmotic pumping, as has been proposed recently. Due to size- and density-dependent differences in polarizability, targeted particles in the fluid stream can be slowed down or even pinned above the electrode structures solely by adjusting the operation parameters of the pump. Hence the presented device, fabricated in SU-8/glass technology, enables simultaneous pumping and manipulation of particles in suspension.

  5. Hair Loss Myths.

    Science.gov (United States)

    DiMarco, Gabriella; McMichael, Amy

    2017-07-01

    INTRODUCTION: Hair loss is a common complaint seen in dermatology clinics. From frustration and attempts at self-help, patients with hair loss may present to the dermatologist with false beliefs, or myths, about the causes of their condition and what treatments are effective. METHODS: We identified 12 common myths about hair loss, categorized as myths about minoxidil treatment, vitamin and mineral supplements, natural topical treatments, and hair care practices. We performed a PubMed search to find evidence to support or refute each myth. RESULTS: We found that there is little evidence to support many of these common hair loss myths. In some cases, randomized controlled trials have investigated the effects of particular therapies and point to the effectiveness of certain hair loss treatments. DISCUSSION: In many cases, there have not been sufficient randomized controlled trials to evaluate the effect of different therapies and hair care practices on hair loss. It is best to guide patients toward treatments with a long track record of efficacy and away from those where little is known scientifically. J Drugs Dermatol. 2017;16(7):690-694..

  6. Atmosphere Impact Losses

    Science.gov (United States)

    Schlichting, Hilke E.; Mukhopadhyay, Sujoy

    2018-02-01

    Determining the origin of volatiles on terrestrial planets and quantifying atmospheric loss during planet formation is crucial for understanding the history and evolution of planetary atmospheres. Using geochemical observations of noble gases and major volatiles we determine what the present day inventory of volatiles tells us about the sources, the accretion process and the early differentiation of the Earth. We further quantify the key volatile loss mechanisms and the atmospheric loss history during Earth's formation. Volatiles were accreted throughout the Earth's formation, but Earth's early accretion history was volatile poor. Although nebular Ne and possible H in the deep mantle might be a fingerprint of this early accretion, most of the mantle does not remember this signature implying that volatile loss occurred during accretion. Present day geochemistry of volatiles shows no evidence of hydrodynamic escape as the isotopic compositions of most volatiles are chondritic. This suggests that atmospheric loss generated by impacts played a major role during Earth's formation. While many of the volatiles have chondritic isotopic ratios, their relative abundances are certainly not chondritic again suggesting volatile loss tied to impacts. Geochemical evidence of atmospheric loss comes from the {}3He/{}^{22}Ne, halogen ratios (e.g., F/Cl) and low H/N ratios. In addition, the geochemical ratios indicate that most of the water could have been delivered prior to the Moon forming impact and that the Moon forming impact did not drive off the ocean. Given the importance of impacts in determining the volatile budget of the Earth we examine the contributions to atmospheric loss from both small and large impacts. We find that atmospheric mass loss due to impacts can be characterized into three different regimes: 1) Giant Impacts, that create a strong shock transversing the whole planet and that can lead to atmospheric loss globally. 2) Large enough impactors (m_{cap} ≳ √{2

  7. Modeling and Correcting the Time-Dependent ACS PSF

    Science.gov (United States)

    Rhodes, Jason; Massey, Richard; Albert, Justin; Taylor, James E.; Koekemoer, Anton M.; Leauthaud, Alexie

    2006-01-01

    The ability to accurately measure the shapes of faint objects in images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST) depends upon detailed knowledge of the Point Spread Function (PSF). We show that thermal fluctuations cause the PSF of the ACS Wide Field Camera (WFC) to vary over time. We describe a modified version of the TinyTim PSF modeling software to create artificial grids of stars across the ACS field of view at a range of telescope focus values. These models closely resemble the stars in real ACS images. Using 10 bright stars in a real image, we have been able to measure HST s apparent focus at the time of the exposure. TinyTim can then be used to model the PSF at any position on the ACS field of view. This obviates the need for images of dense stellar fields at different focus values, or interpolation between the few observed stars. We show that residual differences between our TinyTim models and real data are likely due to the effects of Charge Transfer Efficiency (CTE) degradation. Furthermore, we discuss stochastic noise that is added to the shape of point sources when distortion is removed, and we present MultiDrizzle parameters that are optimal for weak lensing science. Specifically, we find that reducing the MultiDrizzle output pixel scale and choosing a Gaussian kernel significantly stabilizes the resulting PSF after image combination, while still eliminating cosmic rays/bad pixels, and correcting the large geometric distortion in the ACS. We discuss future plans, which include more detailed study of the effects of CTE degradation on object shapes and releasing our TinyTim models to the astronomical community.

  8. Beamforming transmission in IEEE 802.11ac under time-varying channels.

    Science.gov (United States)

    Yu, Heejung; Kim, Taejoon

    2014-01-01

    The IEEE 802.11ac wireless local area network (WLAN) standard has adopted beamforming (BF) schemes to improve spectral efficiency and throughput with multiple antennas. To design the transmit beam, a channel sounding process to feedback channel state information (CSI) is required. Due to sounding overhead, throughput increases with the amount of transmit data under static channels. Under practical channel conditions with mobility, however, the mismatch between the transmit beam and the channel at transmission time causes performance loss when transmission duration after channel sounding is too long. When the fading rate, payload size, and operating signal-to-noise ratio are given, the optimal transmission duration (i.e., packet length) can be determined to maximize throughput. The relationship between packet length and throughput is also investigated for single-user and multiuser BF modes.

  9. Single stage buck-boost DC-AC neutral point clamped inverter

    DEFF Research Database (Denmark)

    Mo, Wei; Loh, Poh Chiang; Andrew, A.

    2012-01-01

    This paper proposes a new single stage buck-boost DC-AC neutral point clamped inverter topology which integrates the cascaded configurations of recently introduced inductor-capacitor-capacitor-transformer impedance source network (by Adamowicz) and classic NPC configuration. As a consequence...... windings thus preventing the core from saturation; lowers the voltage stresses and power losses of inverter switches and reduces the sizes of filtering devices and as well as obtains better output performance compared to the original two-level Z-source inverters. A phase disposition pulse width modulation...... technique with minimum switching counts is implemented for the proposed topology. Simulation results as well as experimental results are presented to verify the behaviors of proposed configuration....

  10. The ac propulsion system for an electric vehicle, phase 1

    Science.gov (United States)

    Geppert, S.

    1981-01-01

    A functional prototype of an electric vehicle ac propulsion system was built consisting of a 18.65 kW rated ac induction traction motor, pulse width modulated (PWM) transistorized inverter, two speed mechanically shifted automatic transmission, and an overall drive/vehicle controller. Design developmental steps, and test results of individual components and the complex system on an instrumented test frame are described. Computer models were developed for the inverter, motor and a representative vehicle. A preliminary reliability model and failure modes effects analysis are given.

  11. ENOSTOPENJSKI DC-AC PRETVORNIK ZA SOLARNE SISTEME

    OpenAIRE

    Konjedic, Tine

    2009-01-01

    V diplomskem delu so predstavljene posamezne komponente fotonapetostnih sistemov, podpore proizvodnji električne energije iz obnovljivih virov in osnove DC-DC ter DC-AC pretvornikov. Opisano je načrtovanje in preizkušanje enostopenjskega DC-AC pretvornika, ki se lahko uporablja kot omrežni razsmernik v sistemu sončne elektrarne. Za proženje stikal je uporabljena pulzno-širinska modulacija, ki je izvedena z uporabo digitalnega signalnega procesorja. Z namenom uvrstitve pretvornika v fotonapeto...

  12. Droop-free Distributed Control for AC Microgrids

    DEFF Research Database (Denmark)

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.

    2016-01-01

    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...

  13. Productos «Celotex» para acondicionamientos Acústicos

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-02-01

    Full Text Available Not availableBajo la denominación general «Celotex», que es un nombre registrado, la Casa Americana The Celotex Corporation, cuyo domicilio social es 120 South, La Salle Street, Chicago J. lllinois, fabrica diversos materiales para fines de acondicionamiento acústico elaborados, según los tipos de que se trate, con fibra de caña de azúcar, lanas minerales, acero, amianto, etc., perforados o no y de acuerdo con el efecto estético y acústico que se desee obtener.

  14. El acondicionamiento acústico de una sala de conciertos

    OpenAIRE

    MONTANER SOLBES, SALVADOR

    2012-01-01

    El trabajo que se presenta a continuación se centra en el acondicionamiento acústico de una sala previamente existente, en un edificio de Valencia cuyo fin va a ser albergar un auditorio para música de cámara o grupos musicales de cuerda de tamaño reducido. La sala a diseñar se encuentra en un edificio con unas dimensiones limitadas y situado entre plantas. Se parte de las condiciones visuales y acústicas, para modificar y perfeccionar la geometría de la sala, y después se pasa al revestimie...

  15. Power converters and AC electrical drives with linear neural networks

    CERN Document Server

    Cirrincione, Maurizio

    2012-01-01

    The first book of its kind, Power Converters and AC Electrical Drives with Linear Neural Networks systematically explores the application of neural networks in the field of power electronics, with particular emphasis on the sensorless control of AC drives. It presents the classical theory based on space-vectors in identification, discusses control of electrical drives and power converters, and examines improvements that can be attained when using linear neural networks. The book integrates power electronics and electrical drives with artificial neural networks (ANN). Organized into four parts,

  16. AC and Phase Sensing of Nanowires for Biosensing

    Directory of Open Access Journals (Sweden)

    Marco Crescentini

    2016-04-01

    Full Text Available Silicon nanowires are label-free sensors that allow real-time measurements. They are economical and pave the road for point-of-care applications but require complex readout and skilled personnel. We propose a new model and technique for sensing nanowire sensors using alternating currents (AC to capture both magnitude and phase information from the sensor. This approach combines the advantages of complex impedance spectroscopy with the noise reduction performances of lock-in techniques. Experimental results show how modifications of the sensors with different surface chemistries lead to the same direct-current (DC response but can be discerned using the AC approach.

  17. Alternating current loss reduction for rectangular busbars by covering their edges with low permeable magnetic caps

    Energy Technology Data Exchange (ETDEWEB)

    Sasada, Ichiro, E-mail: sasada@ence.kyushu-u.ac.jp [Applied Science for Electronics and Materials, Kyushu University, Kasuga (Japan)

    2014-05-07

    A method to reduce ac conductive losses in a thin rectangular busbar made of copper is presented. The method is based on a technique, which makes the distribution of the ac current in the cross section of a busbar flatter. Edges of a thin busbar are covered with low permeability magnetic thin layers as caps. The magnetic cap makes the impedance experienced by the current flowing near the edge comparatively larger so that currents cannot get crowded near the edges of a busbar. This method is numerically verified.

  18. Alternating current loss reduction for rectangular busbars by covering their edges with low permeable magnetic caps

    Science.gov (United States)

    Sasada, Ichiro

    2014-05-01

    A method to reduce ac conductive losses in a thin rectangular busbar made of copper is presented. The method is based on a technique, which makes the distribution of the ac current in the cross section of a busbar flatter. Edges of a thin busbar are covered with low permeability magnetic thin layers as caps. The magnetic cap makes the impedance experienced by the current flowing near the edge comparatively larger so that currents cannot get crowded near the edges of a busbar. This method is numerically verified.

  19. Leakage current and commutation losses reduction in electric drives for Hybrid Electric Vehicle

    Science.gov (United States)

    Miliani, El Hadj

    2014-06-01

    Nowadays, leakage current and inverter losses, produced by adjustable-speed AC drive systems become one of the main interested subject for researchers on Electric Vehicle (EV) and Hybrid Electric Vehicle (HEV) technology. The continuous advancements in solid state device engineering have considerably minimized the switching transients for power switches but the high dv/dt and high switching frequency have caused many adverse effects such as shaft voltage, bearing current, leakage current and electromagnetic interference (EMI). The major objective of this paper is to investigate and suppress of the adverse effects of a PWM inverter feeding AC motor in EV and HEV. A technique to simultaneously reduce the leakage current and the switching losses is presented in this paper. Based on a discontinuous space vector pulse width modulation (DSVPWM) and a modular switches gate resistance, inverter losses and leakage current are reduced. Algorithms are presented and implemented on a DSP controller and experimental results are presented.

  20. Cloning of the Aegiceras corniculatum class I chitinase gene (AcCHI I) and the response of AcCHI I mRNA expression to cadmium stress.

    Science.gov (United States)

    Wang, Li-Ying; Wang, You-Shao; Cheng, Hao; Zhang, Jing-Ping; Yeok, Foong Swee

    2015-10-01

    Chitinases in terrestrial plants have been reported these are involved in heavy metal tolerance/detoxification. This is the first attempt to reveal chitinase gene (AcCHI I) and its function on metal detoxification in mangroves Aegiceras corniculatum. RT-PCR and RACE techniques were used to clone AcCHI I, while real-time quantitative PCR was employed to assess AcCHI I mRNA expressions in response to Cadmium (Cd). The deduced AcCHI I protein consists of 316 amino acids, including a signal peptide region, a chitin-binding domain (CBD) and a catalytic domain. Protein homology modeling was performed to identify potential features in AcCHI I. The CBD structure of AcCHI I might be critical for metal tolerance/homeostasis of the plant. Clear tissue-specific differences in AcCHI I expression were detected, with higher transcript levels detected in leaves. Results demonstrated that a short duration of Cd exposure (e.g., 3 days) promoted AcCHI I expression in roots. Upregulated expression was also detected in leaves under 10 mg/kg Cd concentration stress. The present study demonstrates that AcCHI I may play an important role in Cd tolerance/homeostasis in the plant. Further studies of the AcCHI I protein, gene overexpression, the promoter and upstream regulation will be necessary for clarifying the functions of AcCHI I.

  1. Optimal Power Flow Modelling and Analysis of Hybrid AC-DC Grids with Offshore Wind Power Plant

    DEFF Research Database (Denmark)

    Dhua, Debasish; Huang, Shaojun; Wu, Qiuwei

    2017-01-01

    , it is essential to develop a suitable model and apply optimization algorithms for different application scenarios. The objective of this work is to develop a generalized model and evaluate the Optimal Power Flow (OPF) solutions in a hybrid AC/DC system including HVDC (LCC based) and offshore WPP (VSC based......, the wind power production level also plays a major role in a hybrid system on transmission loss evaluation. The developed model is tested in Low, Medium and High wind power production levels to determine the objective function of the OPF solution. MATLAB Optimization Toolbox and MATLAB script are used...

  2. Weight loss update.

    Science.gov (United States)

    1996-11-01

    Unwanted weight loss in people with HIV can be caused by one or more factors simultaneously. A two-pronged approach that addresses the factors causing weight loss and malnutrition, and maintaining or gaining weight is critical. Many opportunistic infections (OIs) can cause diarrhea, but both the drugs used to treat diarrhea and the infections themselves can contribute to weight loss. Lactose intolerance is a common cause of diarrhea in people living with HIV. Because some of the drugs used to treat HIV and OIs are packaged with lactose, it may be necessary to replace the enzymes needed to break down lactose. Appetite loss may also contribute to wasting, and the lack of nutrients from a lost appetite can tax the body and further aggravate the problem. Appetite stimulants, vitamin supplements, or weight gain products that promote the building of protein are possible treatment options. Lean body mass production may require the use of anabolic (protein building) steroids or testosterone replacement therapy. Another wasting intervention option involves recombinant human growth hormone (rHGH), however, unsubstantiated safety concerns have arisen on the use of rHGH, and may require increased monitoring. Finally, counteracting weight loss may require adjusting the elevated levels of an immune system chemical called tumor necrosis factor (TNF) with thalidomide. Because of thalidomide's association with birth defects, sexually active heterosexual women should be advised to use multiple contraceptive mechanisms.

  3. Congenital sensorineural hearing loss

    Energy Technology Data Exchange (ETDEWEB)

    Mafee, M.F.; Selis, J.E.; Yannias, D.A.; Valvassori, G.E.; Pruzansky, S.; Applebaum, E.L.; Capek, V.

    1984-02-01

    The ears of 47 selected patients with congenital sensorineural hearing loss were examined with complex-motion tomography. The patients were divided into 3 general categories: those with a recognized syndrome, those with sensorineural hearing loss unrelated to any known syndrome, and those with microtia. A great variety of inner ear anomalies was detected, but rarely were these characteristic of a particular clinical entity. The most common finding was the Mondini malformation or one of its variants. Isolated dysplasia of the internal auditory canal or the vestibular aqueduct may be responsible for sensorineural hearing loss in some patients. Patients with microtia may also have severe inner ear abnormalities despite the fact that the outer and inner ears develop embryologically from completely separate systems.

  4. Perceptions of breath alcohol concentration (BrAC) levels among a sample of bar patrons with BrAC values of 0.08% or higher.

    Science.gov (United States)

    Martin, Ryan J; Chaney, Beth H; Cremeens-Matthews, Jennifer; Vail-Smith, Karen

    2016-09-01

    Breath alcohol concentration (BrAC) is a commonly used measure of alcohol intoxication. Because of the potential negative consequences of excessive alcohol consumption, it is important to examine how accurately intoxicated individuals can estimate their BrAC values, especially individuals over the legal BrAC driving threshold (i.e., 0.08%). To better understand perceptions of BrAC values among intoxicated individuals, this field study examined actual BrAC values and BrAC range estimates (0.08% and above, 0.02-0.07%, less than 0.02%) among a sample of bar patrons (N = 454) with BrAC levels at 0.08% or higher. Bivariate and multivariate analyses were conducted to examine the relationship between actual BrAC values and perceived BrAC levels. We also examined whether the following demographic and drinking variables were associated with underestimating BrAC in this sample: gender, age, race, college student status, plans to get home, and hazardous drinking. Results indicated that the majority (60.4%) of participants underestimated their BrAC (i.e., less than 0.08%) and lower BrAC values correlated with underestimating BrAC ranges (p < .001, 95% CI[0.2, 0.6]). Further, females (p = .001, 95% CI[1.3, 3.3]) and participants under 21 (p = .039, 95% CI = 1.0, 2.6) were significantly more likely to estimate their BrAC to be less than 0.08%, which is concerning given that young (less than 21) intoxicated females are a group at high risk for sexual assault on college campuses. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  5. Obtaining continuous BrAC/BAC estimates in the field: A hybrid system integrating transdermal alcohol biosensor, Intellidrink smartphone app, and BrAC Estimator software tools.

    Science.gov (United States)

    Luczak, Susan E; Hawkins, Ashley L; Dai, Zheng; Wichmann, Raphael; Wang, Chunming; Rosen, I Gary

    2017-12-02

    Biosensors have been developed to measure transdermal alcohol concentration (TAC), but converting TAC into interpretable indices of blood/breath alcohol concentration (BAC/BrAC) is difficult because of variations that occur in TAC across individuals, drinking episodes, and devices. We have developed mathematical models and the BrAC Estimator software for calibrating and inverting TAC into quantifiable BrAC estimates (eBrAC). The calibration protocol to determine the individualized parameters for a specific individual wearing a specific device requires a drinking session in which BrAC and TAC measurements are obtained simultaneously. This calibration protocol was originally conducted in the laboratory with breath analyzers used to produce the BrAC data. Here we develop and test an alternative calibration protocol using drinking diary data collected in the field with the smartphone app Intellidrink to produce the BrAC calibration data. We compared BrAC Estimator software results for 11 drinking episodes collected by an expert user when using Intellidrink versus breath analyzer measurements as BrAC calibration data. Inversion phase results indicated the Intellidrink calibration protocol produced similar eBrAC curves and captured peak eBrAC to within 0.0003%, time of peak eBrAC to within 18min, and area under the eBrAC curve to within 0.025% alcohol-hours as the breath analyzer calibration protocol. This study provides evidence that drinking diary data can be used in place of breath analyzer data in the BrAC Estimator software calibration procedure, which can reduce participant and researcher burden and expand the potential software user pool beyond researchers studying participants who can drink in the laboratory. Copyright © 2017. Published by Elsevier Ltd.

  6. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  7. Weight Loss Nutritional Supplements

    Science.gov (United States)

    Eckerson, Joan M.

    Obesity has reached what may be considered epidemic proportions in the United States, not only for adults but for children. Because of the medical implications and health care costs associated with obesity, as well as the negative social and psychological impacts, many individuals turn to nonprescription nutritional weight loss supplements hoping for a quick fix, and the weight loss industry has responded by offering a variety of products that generates billions of dollars each year in sales. Most nutritional weight loss supplements are purported to work by increasing energy expenditure, modulating carbohydrate or fat metabolism, increasing satiety, inducing diuresis, or blocking fat absorption. To review the literally hundreds of nutritional weight loss supplements available on the market today is well beyond the scope of this chapter. Therefore, several of the most commonly used supplements were selected for critical review, and practical recommendations are provided based on the findings of well controlled, randomized clinical trials that examined their efficacy. In most cases, the nutritional supplements reviewed either elicited no meaningful effect or resulted in changes in body weight and composition that are similar to what occurs through a restricted diet and exercise program. Although there is some evidence to suggest that herbal forms of ephedrine, such as ma huang, combined with caffeine or caffeine and aspirin (i.e., ECA stack) is effective for inducing moderate weight loss in overweight adults, because of the recent ban on ephedra manufacturers must now use ephedra-free ingredients, such as bitter orange, which do not appear to be as effective. The dietary fiber, glucomannan, also appears to hold some promise as a possible treatment for weight loss, but other related forms of dietary fiber, including guar gum and psyllium, are ineffective.

  8. AC conductivity and dielectric behavior of polyaniline/sodium metavenadate (PANI/NaVO{sub 3}) composites

    Energy Technology Data Exchange (ETDEWEB)

    Machappa, T. [Department of Physics, Gulbarga University, Gulbarga 585 106, Karnataka (India); Ambika Prasad, M.V.N., E-mail: Prasad1_Amb@rediffmail.co [Department of Materials Science, Gulbarga University, Gulbarga 585 106, Karnataka (India)

    2009-11-15

    The conducting polyaniline/sodium metavenadate (PANI/NaVO{sub 3}) composites were synthesized by single step in situ polymerization technique by placing finely grinded powder of NaVO{sub 3} during the polymerization of aniline. The formation of mixed phases of the polymer together with the conducting emeraldine salt phase was confirmed by spectroscopic techniques like FTIR. SEM images indicated a systematic morphological variation of particles aggregated in the composite matrix as compared to the pristine PANI. AC conductivity and dielectric behavior of these composites were investigated in the frequency range 50 Hz to 5 MHz. It is found that AC conductivity obeyed the power law index and the variation of conductivity with wt% of NaVO{sub 3} could be related to conductivity relaxation phenomenon. These composites have shown high dielectric constant, which is related to polarization. It is seen that both dielectric constant and dielectric loss decrease with increase in frequency. Variations in measured parameters of AC response with increasing frequency of these composites are found to follow systematic trends that are similar to those observed with temperature and doping.

  9. Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

    Indian Academy of Sciences (India)

    A series of ammonia treated Mo/Activated Carbon (AC) catalysts were synthesized by wet impregnation method by nominal incorporation of 5, 10 and 15 wt% of molybdenum. The calcined catalysts (500◦C, 4 h, N₂ flow) were subjected to a stepwise ammonia treatment at temperatures from 25 up to 700◦C. This work ...

  10. Efficient method for AC transmission network expansion planning

    Energy Technology Data Exchange (ETDEWEB)

    Rahmani, M. [Electrical Engineering Department, Shahid Bahonar University of Kerman, Kerman (Iran); Faculdade de Engenharia de Ilha Solteira, UNESP - Univ Estadual Paulista, Departamento de Engenharia Eletrica, Ilha Solteira, SP (Brazil); Rashidinejad, M. [Electrical Engineering Department, Shahid Bahonar University of Kerman, Kerman (Iran); Carreno, E.M. [Centro de Engenharia, Universidade Estadual do Oeste de Parana, UNIOESTE, Foz do Iguacu - PR (Brazil); Romero, R. [Faculdade de Engenharia de Ilha Solteira, UNESP - Univ Estadual Paulista, Departamento de Engenharia Eletrica, Ilha Solteira, SP (Brazil)

    2010-09-15

    A combinatorial mathematical model in tandem with a metaheuristic technique for solving transmission network expansion planning (TNEP) using an AC model associated with reactive power planning (RPP) is presented in this paper. AC-TNEP is handled through a prior DC model while additional lines as well as VAr-plants are used as reinforcements to cope with real network requirements. The solution of the reinforcement stage can be obtained by assuming all reactive demands are supplied locally to achieve a solution for AC-TNEP and by neglecting the local reactive sources, a reactive power planning (RPP) will be managed to find the minimum required reactive power sources. Binary GA as well as a real genetic algorithm (RGA) are employed as metaheuristic optimization techniques for solving this combinatorial TNEP as well as the RPP problem. High quality results related with lower investment costs through case studies on test systems show the usefulness of the proposal when working directly with the AC model in transmission network expansion planning, instead of relaxed models. (author)

  11. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    in a quantum dot have been theoretically studied. The non-equilibrium noise has been suggested [7] as a cause of both the low temperature dephasing saturation [8] and the anomalously large ensemble averaged persistent current [9]. Here we study the effect of high-frequency ac field on the mesoscopic fluctuations of.

  12. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    guar, a galactomannan obtained from the Indian cluster bean. ∗. Author for correspondence (dppadiyan@msuniv.ac.in). Cyamposis tetragonolobus is a water soluble polysaccharide. It is an excellent stiffener and the absence of toxicity allows its use in the textile, pharmaceutical, biomedical, cosmetic and food industries ...

  13. Rethinking Rectification: AC-DC Power Supply in Package

    DEFF Research Database (Denmark)

    Pejtersen, Jens; Knott, Arnold; Jørgensen, Ivan Harald Holger

    Rectification of AC mains voltage is almost exclusively implemented with passive diode bridge rectifiers for power applications below 100 W. The diode bridge rectifier is reliable, cost effective and easy to use. But it is also lossy, nonlinear and passive. Thus reducing the power conversion...

  14. Electrostatic suppression of the Leidenfrost state using AC electric fields

    Science.gov (United States)

    Ozkan, Onur; Shahriari, Arjang; Bahadur, Vaibhav

    2017-10-01

    The formation of a vapor layer at the solid-liquid interface at high temperatures (Leidenfrost phenomenon) degrades heat transfer substantially. Application of an electric field in this vapor layer can fundamentally eliminate the Leidenfrost state by electrostatically attracting liquid towards the surface. This study analyzes the influence of AC electric fields on electrostatic suppression of the Leidenfrost state; previous studies have only utilized DC electric fields. In particular, the influence of the frequency of the AC waveform on Leidenfrost state suppression is analyzed using high speed visualization of liquid-vapor instabilities and heat transfer measurements of evaporating droplets. It is seen that the extent of suppression is reduced with increasing AC frequency. At sufficiently high frequencies, the influence of an applied voltage is completely negated, and electrostatic suppression of the Leidenfrost state can be completely eliminated. A first-order electromechanical model is used to explain the frequency-dependent reduction in the electrostatic attraction force on the Leidenfrost droplet. Overall, this work highlights the importance of AC frequency as a tool to control the extent of suppression and the boiling heat transfer rate.

  15. THERMOELECTRIC SEMICONDUCTOR ENERGY CONVERTER TO RECTIFY THE AC VOLTAGE

    Directory of Open Access Journals (Sweden)

    T. A. Ismailov

    2014-01-01

    Full Text Available The paper discusses existing means for rectifying alternating electrical signal with inherent advantages and disadvantages. The proposed design of the AC voltage, made on the basis of the thermoelectric Converter using renewable solar energy. Made a rough calculation of this device. 

  16. 78 FR 42567 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-16

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION ACS Wireless, Inc.; Notice of Application June 25, 2013. Correction In notice document 2013-15658 beginning on page 39345 in the issue of Monday, July 1, 2013, make the following correction: On page 39345...

  17. Active Power Regulation based on Droop for AC Microgrid

    DEFF Research Database (Denmark)

    Li, Chendan; Coelho, Ernane A. A.; Firoozabadi, Mehdi Savaghebi

    2015-01-01

    In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed to succes...

  18. Evaluation of ac conductivity behaviour of graphite filled ...

    Indian Academy of Sciences (India)

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled ...

  19. The Shortest Competition Judgment Ever : AC-Treuhand II

    NARCIS (Netherlands)

    Vedder, Hans; Busscher, Rick Johannes; Herz, Martin

    2015-01-01

    Competition law judgments are notorious for their length. An extreme example is the 5134 paragraph judgment in Cement. In most cases the appeal judgment is significantly shorter, as with the 391 paragraphs in the appeal in Cement. AC-Treuhand is no exception to that rule, but it takes it to the

  20. Investigations on gradient ac conductivity characteristics of bamboo ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 29; Issue 2. Investigations on gradient a.c. conductivity characteristics of ... presence of moisture in bamboo, which liberated on heating. Sharp peak is observed in case of sample 4, which is inner most strip. Maximum sharp peak is observed at lowest 4 kHz frequency.

  1. Recurrent Pregnancy Loss

    Directory of Open Access Journals (Sweden)

    Véronique Piroux

    1997-01-01

    Full Text Available Antiphospholipid antibodies (APA are associated with thrombosis, thrombocytopenia and fetal loss but they occur in a variety of diseases. Despite many efforts, a correlation between the specificity of particular subgroups of APA and particular clinical situations remains to be established. The antigens at the origin of APA remain to be identified. We discuss here the possible links between cell apoptosis or necrosis, leading to plasma membrane alterations, and the occurrence of APA in response to sustained stimulation. The pathogenic potential of APA is also considered with respect to recurrent pregnancy loss.

  2. Side Effects: Hair Loss (Alopecia)

    Science.gov (United States)

    Hair loss, also called alopecia, is a side effect of cancer treatments, such as chemotherapy and radiation therapy. Learn how to cope with and manage hair loss. Listen to tips from others who have experienced hair loss.

  3. Aragonite coating solutions (ACS) based on artificial seawater

    Energy Technology Data Exchange (ETDEWEB)

    Tas, A. Cuneyt, E-mail: c_tas@hotmail.com

    2015-03-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  4. Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

    Directory of Open Access Journals (Sweden)

    Vinod Kumar Singh

    2016-09-01

    Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

  5. Blindness and vision loss

    Science.gov (United States)

    ... have low vision, you may have trouble driving, reading, or doing small tasks such as sewing or ... lost vision. You should never ignore vision loss, thinking it will get better. Contact an ... A.D.A.M.'s editorial policy , editorial process and privacy policy . A.D.A.M. is ...

  6. Experimental circulation loss study

    OpenAIRE

    Lund, Sigurd

    2013-01-01

    Master's thesis in Petroleum engineering Circulation losses could occur during any operation that involves pumping into a well. As of today, it is recognized as one of the most costly drilling problems. In some situation it might be hard to stop, and usually takes precious rig time to deal with the problem. In order to mitigate the risk...

  7. Biologicals and bone loss

    NARCIS (Netherlands)

    Krieckaert, C.L.M.; Lems, W.F.

    2012-01-01

    Inflammatory joint diseases are associated with extra-articular side effects including bone involvement.There is an increased risk of osteoporotic fractures. The pathogeneses of local and generalized bone loss share a common pathway. Early and active rheumatoid arthritis is associated with

  8. Degreaser Reduces Solvent Loss

    Science.gov (United States)

    Du Fresne, E. R.

    1985-01-01

    Escape of solvent minimized by second cooling coil. Degreaser suppresses solvent-vapor loss through parts-basket dragout and air drafts. Within C02 blanket, convection repeatedly exposes C02/solvent mixture to cold spot created by C02 coil. Solvent vapor condenses, then runs down via through to cold tank. This small expenditure of C02 minimizes health and environmental hazards.

  9. Heat loss from Buildings

    DEFF Research Database (Denmark)

    Karlsson, Kenneth; Næraa, Rikke

    1997-01-01

    Determination of heat loss coefficients for buildings in Denmark. The coefficient are determined for 15 building groups and 3 year intervals. They are based on the BBR-registre and assumptions of U-values(W/K*m2)and computed in a simple spreed sheet model.The results are used in the REVEILLE...

  10. Responding to Amphibian Loss

    NARCIS (Netherlands)

    Mendelson III, J.R.; Lips, K.R.; Gagliardo, R.W.; Rabb, G.B.; Collins, J.P.; Diffendorfer, J.E.; Daszak, P.; Ibáñez D., R.; Zippel, K.C.; Lawson, D.P.; Wright, K.M.; Stuart, S.N.; Gascon, C.; da Silva, H.R.; Burrowes, P.A.; Joglar, R.L.; La Marca, E.; Lötters, S.; du Preez, L.H.; Weldon, C.; Hyatt, A.; Rodriguez-Mahecha, J.V.; Hunt, S.; Robertson, H.; Lock, B.; Raxworthy, C.J.; Frost, D.R.; Lacy, R.C.; Alford, R.A.; Campbell, J.A.; Parra-Olea, G.; Bolaños, F.; Calvo Domingo, J.J.; Halliday, T.; Murphy, J.B.; Wake, M.H.; Coloma, L.A.; Kuzmin, S.L.; Price, M.S.; Howell, K.M.; Lau, M.; Pethiyagoda, R.; Boone, M.; Lannoo, M.J.; Blaustein, A.R.; Dobson, A.; Griffiths, R.A.; Crump, M.L.; Wake, D.B.; Brodie Jr, E.D.

    2006-01-01

    In their Policy Forum "Confronting amphibian declines and extinctions" (7 July, p. 48), J. R. Mendelson III and colleagues offer a strategy for "stopping" the widespread losses of frogs, toads, and salamanders. Disease research and captive breeding figure prominently in their call for action.

  11. Measuring Gearbox Torque Loss

    Science.gov (United States)

    Schmidt, L. F.

    1986-01-01

    Accuracy increased by measuring small torque differences directly. Input and output torques are balanced by mechanical linkage in transmission-testing apparatus. Force applied to load cell proportional to frictional torque loss in transmission. Apparatus measures portion of input torque lost to friction in automotive transmissions or other gearbox. Apparatus more sensitive than previous measuring systems.

  12. A new hobo, Ac, Tam3 transposable element, hopper, from Bactrocera dorsalis is distantly related to hobo and Ac

    Science.gov (United States)

    A new transposable element from the hobo, Ac, TamJ transposon family was isolated as a genomic clone from the oriental fruit fly, BactrOCi!ro dorsalis. It is approximately 3.1 kb in length with 19-bp inverted terminal repeat sequences having a single mismatch.Though sharing several amino acid sequen...

  13. A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

    Science.gov (United States)

    Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

    2017-05-01

    Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

  14. Comparative Analysis of Voltage Control in Battery Power Converters for Inverter-Based AC Microgrids

    National Research Council Canada - National Science Library

    Chae, Woo-Kyu; Won, Jong-Nam; Lee, Hak-Ju; Kim, Jae-Eon; Kim, Jaehong

    2016-01-01

    .... The energy storage system power converters generally form the local AC bus voltage. This grid-forming operation requires fast and robust voltage control to properly maintain a stable energy flow and high power quality in the local AC bus...

  15. UARS PEM Level 2 VMAG AC V001 (UARPE2VMAGAC) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  16. Recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices.

    Science.gov (United States)

    Sasaki, Naoki

    2012-01-01

    AC electrokinetics is a generic term that refers to an induced motion of particles and fluids under nonuniform AC electric fields. The AC electric fields are formed by application of AC voltages to microelectrodes, which can be easily integrated into microfluidic devices by standard microfabrication techniques. Moreover, the magnitude of the motion is large enough to control the mass transfer on the devices. These advantages are attractive for biomolecular analysis on the microfluidic devices, in which the characteristics of small space and microfluidics have been mainly employed. In this review, I describe recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices. The applications include fluid pumping and mixing by AC electrokinetic flow, and manipulation of biomolecules such as DNA and proteins by various AC electrokinetic techniques. Future prospects for highly functional biomolecular analysis on microfluidic devices with the aid of AC electrokinetics are also discussed.

  17. Data of evolutionary structure change: 1AC6A-1TVDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AC6A-1TVDA 1AC6 1TVD A A DSVTQTEGQVALSEEDFLTIHCNYSASG-YPALFWYVQYPGEGPQFLFRASRDKEK...N--KLTFGAGTKLTIKP DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPD-----YSFQF---VFYGDDSRSEGADFT...RFSVKHILTQKAFHLVISPVRTEDSATYYCAFTLPPPTDKLIFGKGTRVTVEP EEE EEEEEE EEEEEEEEEE - EEEEEEE EEE... 1TVD A 1TVDA

  18. Data of evolutionary structure change: 1AC6B-1TVDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AC6B-1TVDA 1AC6 1TVD B A DSVTQTEGQVALSEEDFLTIHCNYSASG-YPALFWYVQYPGEGPQFLFRASRDKEK...N--KLTFGAGTKLTIKP DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPD-----YSFQF---VFYGDDSRSEGADFT...RFSVKHILTQKAFHLVISPVRTEDSATYYCAFTLPPPTDKLIFGKGTRVTVEP EEE EEE EEEEEEEE - EEEEEEE EEE EEEEE-----------... 1TVD A 1TVDA

  19. Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Rudy Ariyanto

    2017-11-01

    Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

  20. Risk of fetal loss associated with invasive testing following combined first-trimester screening for Down syndrome

    DEFF Research Database (Denmark)

    Wulff, C. B.; Gerds, T. A.; Rode, L

    2016-01-01

    OBJECTIVE: To assess prospectively the risk of fetal loss associated with chorionic villus sampling (CVS) and amniocentesis (AC) following combined first-trimester screening (cFTS) for Down syndrome. METHODS: This was a nationwide population-based study (Danish Fetal Medicine Database, 2008......-2010) including 147 987 women with singleton pregnancy who underwent cFTS. Propensity score stratification was used to assess the risk of fetal loss with and without invasive testing. Analyses were performed between 3 and 21 days after cFTS for CVS and between 28 and 42 days after cFTS for AC. Results...... are reported as average risk differences with 95% CIs. RESULTS: The risks of miscarriage and stillbirth were not higher in women exposed to CVS or AC compared with unexposed women, independent of the analysis time-point. The average effect of CVS on risk of miscarriage was -0.08% (95% CI, -0.64; 0.47) at 3...

  1. Understanding Loss Deductions for Timber

    Science.gov (United States)

    John Greene; Michael Jacobson

    1998-01-01

    Forestland owners whose timber has been destroyed may be eligible to take a deduction for the loss on their federal income tax. The loss must be physical in nature and caused by an identifiable event or combination of events that has run its course. There are two types of losses from natural events. Casualty losses are sudden, unexpected, and unusual - as from a fire...

  2. Individual Hearing Loss

    Directory of Open Access Journals (Sweden)

    Sébastien Santurette

    2016-06-01

    Full Text Available It is well-established that hearing loss does not only lead to a reduction of hearing sensitivity. Large individual differences are typically observed among listeners with hearing impairment in a wide range of suprathreshold auditory measures. In many cases, audiometric thresholds cannot fully account for such individual differences, which make it challenging to find adequate compensation strategies in hearing devices. How to characterize, model, and compensate for individual hearing loss were the main topics of the fifth International Symposium on Auditory and Audiological Research (ISAAR, held in Nyborg, Denmark, in August 2015. The following collection of papers results from some of the work that was presented and discussed at the symposium.

  3. 21 CFR 880.5510 - Non-AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Non-AC-powered patient lift. 880.5510 Section 880... Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...

  4. Decisions under unpredictable losses

    Directory of Open Access Journals (Sweden)

    Ali Ahmed

    2007-10-01

    Full Text Available An experimental test of the descriptive adequacy of the extit{restated diversification principle} is presented. The principle postulates that risk-averse utility maximizers will pool risks for their mutual benefit, even if information is missing about the probabilities of losses. It is enough for people to assume that they face equal risks when they pool risks. The results of the experiment support the principle.

  5. Human Hearing Loss

    OpenAIRE

    Ware, Stacy Lee

    2014-01-01

    Hearing loss affects as much as 5% of the global human population and its negative consequences, often exacerbated by cultural bias or distributive injustice, include delayed cognitive and language development, learning deficits and poor academic performance, chronic unemployment and dependency, poverty, elevated risk of harm and poor health. This paper is based on a review of the academic literature as well as other credible published resources to identify the principal causes of hearing los...

  6. ADT fast losses MD

    CERN Document Server

    Priebe, A; Dehning, B; Redaelli, S; Salvachua Ferrando, BM; Sapinski, M; Solfaroli Camillocci, M; Valuch, D

    2013-01-01

    The fast beam losses in the order of 1 ms are expected to be a potential major luminosity limitation for higher beam energies after the LHC long shutdown (LS1). Therefore a Quench Test is planned in the winter 2013 to estimate the quench limit in this timescale and revise the current models. This experiment was devoted to determination the LHC Transverse Damper (ADT) as a system for fast losses induction. A non-standard operation of the ADT was used to develop the beam oscillation instead of suppressing them. The sign flip method had allowed us to create the fast losses within several LHC turns at 450 GeV during the previous test (26th March 2012). Thus, the ADT could be potentially used for the studies of the UFO ("Unidentied Falling Object") impact on the cold magnets. Verification of the system capability and investigations of the disturbed beam properties were the main objectives of this MD. During the experiment, the pilot bunches of proton beam were excited independently in the horizontal and vertical ...

  7. EPICS communication loss management

    Science.gov (United States)

    Hill, J. O.

    1994-12-01

    In a distributed control system there are multiple processors interconnected by a communications media such as a LAN. Plant I/O points are often divided between these processors according to the number of points that a processor can promptly service and according to processor locations which minimize field wiring. A robust distributed control system should properly respond to temporary loss of communication with any portion of the system. This temporary loss could be caused by hardware or software failures or it could be caused by reconfiguring or rebooting other portions of the system. For the Experimental Physics and Industrial Control System we have handled these temporary outages consistently and reliably. This capability makes it possible for distributed functions such as loop closure, sequencing, archiving, or operator consoles to take proper action at the beginning and end of the loss of communication with another part of the system. The control system continues to function in a degraded mode while some of its subsystems are not responding and resumes normal operation once a subsystem is restored.

  8. Ac magnetic susceptibility study of in vivo nanoparticle biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez, L; Veintemillas-Verdaguer, S; Serna, C J; Morales, M P [Instituto de Ciencia de Materiales de Madrid, ICMM-CSIC, Sor Juana Ines de la Cruz 3, Cantoblanco 28049, Madrid (Spain); MejIas, R; Barber, D F [Centro Nacional de BiotecnologIa, CNB-CSIC, Darwin 3, Cantoblanco 28049, Madrid (Spain); Lazaro, F J, E-mail: lucia@icmm.csic.es [Departamento de Ciencia y Tecnologia de Materiales y Fluidos, Universidad de Zaragoza, Maria de Luna 3, 50018, Zaragoza (Spain)

    2011-06-29

    We analysed magnetic nanoparticle biodistribution, before and after cytokine conjugation, in a mouse model by ac susceptibility measurements of the corresponding resected tissues. Mice received repeated intravenous injections of nanoparticle suspension for two weeks and they were euthanized 1 h after the last injection. In general, only 10% of the total injected nanoparticles after multiple exposures were found in tissues. The rest of the particles may probably be metabolized or excreted by the organism. Our findings indicate that the adsorption of interferon to DMSA-coated magnetic nanoparticles changes their biodistribution, reducing the presence of nanoparticles in lungs and therefore their possible toxicity. The specific targeting of the particles to tumour tissues by the use of an external magnetic field has also been studied. Magnetic nanoparticles were observed by transmission electron microscopy in the targeted tissue and quantified by ac magnetic susceptibility.

  9. TINGKAT KEPUASAN PENGGUNA WEBSITE www.unud.ac.id

    Directory of Open Access Journals (Sweden)

    Rr.Sanita Eling Cipta Nesa

    2015-10-01

    Full Text Available Popularitas link suatu situs website dapat ditingkatkan semaksimal mungkin dengan menganalisis dan mengevaluasi tingkat kepuasan penggunanya. Penelitian ini bertujuan untuk menganalisis perkembangan situs website Universitas Udayana (UNUD sejauh mana tingkat kepuasan pengguna website www.unud.ac.id. Analisis tingkat kepuasan pengguna menggunakan kuesioner dengan metode variabel pernyataan End-User Computing Satisfaction (EUCS dan diukur dengan metode Kano. Customer Satisfaction Index (CSI digunakan untuk mengukuran skala tingkat kepuasan pengguna website. Analisis tingkat kepuasan pengguna website UNUD dengan metode Kano menyatakan bahwa sebagian besar atribut website berada pada kategori indifferent, namun atribut Homepages dan Accuracy pada kategori Must-be, dan Atribut Hits pada kategori Reverse. Pengolahan data CSI didapatkan nilai sebesar 69,23% sehingga konsumen dapat dikatakan “PUAS” dengan fasilitas dan kelengkapan isi yang disediakan website www.unud.ac.id.

  10. Variable speed ac motor - A continuous pole printing technology

    Science.gov (United States)

    Morash, R. T.; Barber, R. J.; Roesel, J. F., Jr.

    A description is given of a simply constructed, brushless, commutatorless ac motor that offers significant improvements over conventional induction or synchronous motors. The design makes it possible for the speed to be precisely and readily varied and for the motor to operate with ac currents of any reasonable frequency over a wide range of voltages. In essence, it is a synchronous motor that can operate at speeds well above and below 'normal speed' synchronous conditions. When operated as a constant speed machine, its efficiency is such that it holds promise for reducing electrical energy consumption in the U.S. by 3 to 4 percent. Underlying the design is a magnetizable layer on the surface of the rotor that can be continuously remagnetized while the machine is in operation. A 25-hp motor developed for use with high inertia loads is discussed.

  11. Final Report for the Advanced Camera for Surveys (ACS)

    Science.gov (United States)

    2004-01-01

    ACS was launched aboard the Space Shuttle Columbia just before dawn on March 1, 2002. At the time of liftoff, the Hubble Space Telescope (HST) was reflecting the early morning sun as it moved across the sky. After successfully docking with HST, several components were replaced. One of the components was the Advanced Camera for Surveys built by Ball Aerospace & Technologies Corp. (BATC) in Boulder, Colorado. Over the life of the HST contract at BATC, hundreds of employees had the pleasure of working on the concept, design, fabrication, assembly, and test of ACS. Those employees thank NASA - Goddard Space Flight Center and the science team at Johns Hopkins University (JHU) for the opportunity to participate in building a great science instrument for HST.

  12. Photovoltaic Inverter Controllers Seeking AC Optimal Power Flow Solutions

    Energy Technology Data Exchange (ETDEWEB)

    Dall' Anese, Emiliano; Dhople, Sairaj V.; Giannakis, Georgios B.

    2016-07-01

    This paper considers future distribution networks featuring inverter-interfaced photovoltaic (PV) systems, and addresses the synthesis of feedback controllers that seek real- and reactive-power inverter setpoints corresponding to AC optimal power flow (OPF) solutions. The objective is to bridge the temporal gap between long-term system optimization and real-time inverter control, and enable seamless PV-owner participation without compromising system efficiency and stability. The design of the controllers is grounded on a dual ..epsilon..-subgradient method, while semidefinite programming relaxations are advocated to bypass the non-convexity of AC OPF formulations. Global convergence of inverter output powers is analytically established for diminishing stepsize rules for cases where: i) computational limits dictate asynchronous updates of the controller signals, and ii) inverter reference inputs may be updated at a faster rate than the power-output settling time.

  13. On-Chip AC self-test controller

    Science.gov (United States)

    Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY

    2009-09-29

    A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

  14. SNL software manual for the ACS Data Analytics Project.

    Energy Technology Data Exchange (ETDEWEB)

    Stearley, Jon R.; McLendon, William Clarence, III; Rodrigues, Arun F.; Williams, Aaron S.; Hooper, Russell Warren; Robinson, David Gerald; Stickland, Michael G.

    2011-10-01

    In the ACS Data Analytics Project (also known as 'YumYum'), a supercomputer is modeled as a graph of components and dependencies, jobs and faults are simulated, and component fault rates are estimated using the graph structure and job pass/fail outcomes. This report documents the successful completion of all SNL deliverables and tasks, describes the software written by SNL for the project, and presents the data it generates. Readers should understand what the software tools are, how they fit together, and how to use them to reproduce the presented data and additional experiments as desired. The SNL YumYum tools provide the novel simulation and inference capabilities desired by ACS. SNL also developed and implemented a new algorithm, which provides faster estimates, at finer component granularity, on arbitrary directed acyclic graphs.

  15. Offshore windfarm connection with low frequency AC transmission technology

    DEFF Research Database (Denmark)

    Qin, Nan; Xu, Zhao; You, Shi

    2009-01-01

    developed, which consists of three parts, the fixed-speed wind turbine representing a wind farm, the transmission line and the frequency converter. Although the transmission capability is greatly improved by the LFAC system, simulation shows it gives negative influences on the wind turbine operation due......This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared...... to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...

  16. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    DEFF Research Database (Denmark)

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig

    2016-01-01

    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling. The vol......This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling....... The voltage control was evaluated with either active or reactive independent phase load current control. The control performance in field operation in a residential grid situated in Bornholm, Denmark was investigated for different use cases....

  17. Magnetization loss for stacks of ReBCO tapes

    Science.gov (United States)

    Bykovsky, N.; De Marzi, G.; Uglietti, D.; Bruzzone, P.; Muzzi, L.

    2017-02-01

    The AC loss measurements of the high temperature superconductor (HTS) cable prototype in the EDIPO test facility motivated detailed investigations of the loss contributions from the tape, strand and cable stages of the HTS fusion conductor design proposed at the Swiss Plasma Center. As an initial step of the task, magnetization tests of soldered stacks of HTS tapes were carried out at temperatures of 5 and 77 {{K}} and magnetic fields up to 12 {{T}} using the vibrating sample magnetometer technique. The influence on the magnetization loss of the number of tapes, width of the tape, field’s orientation and tape’s manufacturer is studied experimentally performing both the major and minor magnetization loops with different ramp rates of the applied magnetic field. In order to validate the test results, a numerical model is developed and presented in this work. From the numerical model we also deduced an analytical approach for the magnetization loss in the stacks of tapes with arbitrary number of tapes in the critical state model. Comparison between the measured and estimated magnetization loss of the cable prototypes is reported as well.

  18. DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-05-01

    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  19. Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis

    Energy Technology Data Exchange (ETDEWEB)

    Hossan, Mohammad Robiul [School of Mechanical and Materials Engineering, Washington State University, Pullman, WA 99164-2920 (United States); Department of Engineering and Physics, University of Central Oklahoma, Edmond, OK 73034-5209 (United States); Dillon, Robert [Department of Mathematics, Washington State University, Pullman, WA 99164-3113 (United States); Dutta, Prashanta, E-mail: dutta@mail.wsu.edu [School of Mechanical and Materials Engineering, Washington State University, Pullman, WA 99164-2920 (United States)

    2014-08-01

    Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface–immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices.

  20. Ac Synchronous Servo Based On The Armature Voltage Prediction Model

    Science.gov (United States)

    Hoshino, Akihiro; Kuromaru, Hiroshi; Kobayashi, Shinichi

    1987-10-01

    A new control method of the AC synchro-nous servo-system (Brushless DC servo-system) is discussed. The new system is based on the armature voltage prediction model. Without a resolver-digital-conver-ter nor a tachometer-generator, the resolver provides following three signals to the system immediately, they are the current command, the induced voltage, and the rotor speed. The new method realizes a simple hardware configuration. Experimental results show a good performance of the system.

  1. MD 349: Impedance Localization with AC-dipole

    CERN Document Server

    Biancacci, Nicolo; Metral, Elias; Salvant, Benoit; Papotti, Giulia; Persson, Tobias Hakan Bjorn; Tomas Garcia, Rogelio; CERN. Geneva. ATS Department

    2016-01-01

    The purpose of this MD is to measure the distribution of the transverse impedance of the LHC by observing the phase advance variation with intensity between the machine BPMs. Four injected bunches with different intensities are excited with an AC dipole and the turn by turn data is acquired from the BPM system. Through post-processing analysis the phase variation along the machine is depicted and, from this information, first conclusions of the impedance distribution can be drawn.

  2. Optimal Design of Hybrid AC/DC Microgrids

    OpenAIRE

    Lotfi,Hossein; Khodaei, Amin; Bahramirad, Shay; Bollen, Math

    2017-01-01

    DC loads (such as computers, data centres, electric vehicle chargers, and LED lamps) and dc distributed energy resources (such as fuel cells, solar photovoltaics, and energy storages) are rapidly growing in electric power systems, so dc systems are being introduced as emerging practical investment solutions compared to traditional ac options. DC microgrids offer several advantages such as the elimination of need for synchronizing generators and easier supply of dc loads. Hybrid microgrids can...

  3. Prototipo acústico adaptable. Para espacios multifuncionales

    Directory of Open Access Journals (Sweden)

    Constanza Ipinza Olatte

    2017-04-01

    Full Text Available Este artículo presenta la primera etapa de la investigación “Prototipo Acústico Adaptable –para espacios multifuncionales–”, desarrollado en la Escuela de Arquitectura de la Universidad de Santiago de Chile. El objetivo de ella ha sido diseñar y construir un dispositivo de geometría articulada que permita calibrar la acústica del espacio, en función de las necesidades de recepción de los usuarios. Se revisa la base teórica de la propuesta a partir del concepto de arquitectura líquida, que en su fundamentación pretende incorporar la dimensión dinámica del tiempo en la condición material de los espacios. Asimismo, se examina el término acústica variable, que aborda técnicamente la versatilidad del acontecimiento sonoro en un despliegue de técnicas activas o pasivas. Luego se presenta la metodología a través del diseño, basada en el modelo propuesto por Lucien Blessing, que formula un proceso desde la definición de los criterios, hasta la concreción formal del diseño en la construcción del modelo. Finalmente, se presentan los parámetros de validación del diseño que apuntan a la prosecución de su desarrollo en una segunda etapa. En ella, el objetivo será optimizar el modelo y mejorar las transformaciones del ambiente acústico material, espacial y temporal, como se ha propuesto.

  4. Pancreatectomy risk calculator: an ACS-NSQIP resource

    Science.gov (United States)

    Parikh, Purvi; Shiloach, Mira; Cohen, Mark E; Bilimoria, Karl Y; Ko, Clifford Y; Hall, Bruce L; Pitt, Henry A

    2010-01-01

    Background The morbidity of pancreatoduodenectomy remains high and the mortality may be significantly increased in high-risk patients. However, a method to predict post-operative adverse outcomes based on readily available clinical data has not been available. Therefore, the objective was to create a ‘Pancreatectomy Risk Calculator’ using the American College of Surgeons-National Surgical Quality Improvement Program (ACS-NSQIP) database. Methods The 2005–2008 ACS-NSQIP data on 7571 patients undergoing proximal (n =4621), distal (n =2552) or total pancreatectomy (n =177) as well as enucleation (n =221) were analysed. Pre-operative variables (n =31) were assessed for prediction of post-operative mortality, serious morbidity and overall morbidity using a logistic regression model. Statistically significant variables were ranked and weighted to create a common set of predictors for risk models for all three outcomes. Results Twenty pre-operative variables were statistically significant predictors of post-operative mortality (2.5%), serious morbidity (21%) or overall morbidity (32%). Ten out of 20 significant pre-operative variables were employed to produce the three mortality and morbidity risk models. The risk factors included age, gender, obesity, sepsis, functional status, American Society of Anesthesiologists (ASA) class, coronary heart disease, dyspnoea, bleeding disorder and extent of surgery. Conclusion The ACS-NSQIP ‘Pancreatectomy Risk Calculator’ employs 10 easily assessable clinical parameters to assist patients and surgeons in making an informed decision regarding the risks and benefits of undergoing pancreatic resection. A risk calculator based on this prototype will become available in the future as on online ACS-NSQIP resource. PMID:20815858

  5. AC system stabilization via phase shift transformer with thyristor commutation

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Jose Carlos de; Guimaraes, Geraldo Caixeta; Moraes, Adelio Jose [Uberlandia Univ., MG (Brazil); Abreu, Jose Policarpo G. de [Escola Federal de Engenharia de Itajuba, MG (Brazil); Oliveira, Edimar Jose de [Juiz de Fora Univ., MG (Brazil)

    1994-12-31

    This article aims to present initially the constructive and operative forms of a phase-shift autotransformer which provides both magnitude and phase angle change through thyristor commutation, including a technic to reduce the number of thyristors. Following, it is proposed a control system to make such equipment an efficient AC system stabilizing tool. It is presented some simulation results to show the operation of this transformer in an electrical system. (author) 3 refs., 11 figs., 3 tabs.

  6. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan

    2014-09-22

    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  7. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-04-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the

  8. A Novel Protection Scheme against Fault Resistance for AC Microgrid

    Directory of Open Access Journals (Sweden)

    Xinrui Liu

    2017-01-01

    Full Text Available The faults characteristics of the lines in AC microgrid are weakened due to the fault resistance, which may refuse protection action. To solve the problems caused by different types of the faults through fault resistance (FTFR, the faults where the fault point resistance is greater than zero in AC microgrid, a novel FTFR protection scheme based on the active power of 0-frame component or d-frame component consumed by fault resistance is proposed in this paper as the backup protection of FTFR. This proposed protection scheme utilizes the active power of 0-frame component or d-frame component consumed by fault resistance to identify internal FTFR and external faults. It performs well in grid-connected mode and islanded mode by adopting self-adaptive threshold and is not affected by the factors such as the fault position and the fault resistance value. The theoretical analysis and various simulations show that this protection scheme can identify and isolate different types of internal FTFR in AC microgrid with high reliability and high sensitivity.

  9. New Subarray Readout Patterns for the ACS Wide Field Channel

    Science.gov (United States)

    Golimowski, D.; Anderson, J.; Arslanian, S.; Chiaberge, M.; Grogin, N.; Lim, Pey Lian; Lupie, O.; McMaster, M.; Reinhart, M.; Schiffer, F.; Serrano, B.; Van Marshall, M.; Welty, A.

    2017-04-01

    At the start of Cycle 24, the original CCD-readout timing patterns used to generate ACS Wide Field Channel (WFC) subarray images were replaced with new patterns adapted from the four-quadrant readout pattern used to generate full-frame WFC images. The primary motivation for this replacement was a substantial reduction of observatory and staff resources needed to support WFC subarray bias calibration, which became a new and challenging obligation after the installation of the ACS CCD Electronics Box Replacement during Servicing Mission 4. The new readout patterns also improve the overall efficiency of observing with WFC subarrays and enable the processing of subarray images through stages of the ACS data calibration pipeline (calacs) that were previously restricted to full-frame WFC images. The new readout patterns replace the original 512×512, 1024×1024, and 2048×2046-pixel subarrays with subarrays having 2048 columns and 512, 1024, and 2048 rows, respectively. Whereas the original square subarrays were limited to certain WFC quadrants, the new rectangular subarrays are available in all four quadrants. The underlying bias structure of the new subarrays now conforms with those of the corresponding regions of the full-frame image, which allows raw frames in all image formats to be calibrated using one contemporaneous full-frame "superbias" reference image. The original subarrays remain available for scientific use, but calibration of these image formats is no longer supported by STScI.

  10. The ACS-NUCL Division 50th Anniversary: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-01-10

    The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.

  11. Simulation of the AC corona phenomenon with experimental validation

    Science.gov (United States)

    Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R.

    2017-11-01

    The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach.

  12. Aislamiento acústico a ruido aéreo en acristalamientos de vidrio

    Directory of Open Access Journals (Sweden)

    Escuder Silla, E.

    2007-08-01

    Full Text Available In this paper, the Ookura & Saito model is applied to determine the Airborne Sound Insulation of glazing systems. In particular, the calculations that appear are for monolithic glasses of different thicknesses and laminated glasses from different types. There are different prediction models of the airborne acoustic behaviour of multilayer panels (and the laminated glasses can be considered like such. In all of them, the input data are the elastic constants and the loss factor. The monolithic glasses and the intermediate layer have been characterized according to different Standards. The results are compared with experimental measurements and data of the study of Marsh (1, obtaining a range of acceptable adjustment.

    En este artículo se aplica el modelo de Ookura & Saito para determinar el aislamiento acústico a ruido aéreo de sistemas constructivos basados en vidrios. En concreto, los cálculos que se presentan son para vidrios monolíticos de distintos espesores y para vidrios laminados de diferentes tipos. Existen diferentes modelos de predicción del comportamiento acústico a ruido aéreo de estructuras multicapa (y los vidrios laminados pueden considerarse como tales. En todos ellos, los datos de entrada son las constantes elásticas y el factor de pérdidas. Tanto los vidrios monolíticos como la capa intermedia se han caracterizado siguiendo diferentes normativas. Los resultados se comparan con medidas experimentales y con datos recogidos del estudio de Marsh (1, obteniéndose un grado de ajuste aceptable.

  13. In-silico determination of insecticidal potential of Vip3Aa-Cry1Ac fusion protein against Lepidopteran targets using molecular docking

    Directory of Open Access Journals (Sweden)

    Aftab eAhmad

    2015-12-01

    Full Text Available Study and research of Bt (Bacillus thuringiensis transgenic plants have opened new ways to combat insect pests. Over the decades, however, insect pests, especially the Lepidopteran, have developed tolerance against Bt delta-endotoxins. Such issues can be addressed through the development of novel toxins with greater toxicity and affinity against a broad range of insect receptors. In this computational study, functional domains of Bacillus thuringiensis crystal delta-endotoxin (Cry1Ac insecticidal protein and vegetative insecticidal protein (Vip3Aa have been fused to develop a broad-range Vip3Aa-Cry1Ac fusion protein. Cry1Ac and Vip3Aa are non-homologous insecticidal proteins possessing receptors against different targets within the midgut of insects. The insecticidal proteins were fused to broaden the insecticidal activity. Molecular docking analysis of the fusion protein against aminopeptidase-N (APN and cadherin receptors of five Lepidopteran insects (Agrotis ipsilon, Helicoverpa armigera, Pectinophora gossypiella, Spodoptera exigua and Spodoptera litura revealed that the Ser290, Ser293, Leu337, Thr340 and Arg437 residues of the fusion protein are involved in the interaction with insect receptors. The Helicoverpa armigera cadherin receptor, however, showed no interaction, which might be due to either loss or burial of interactive residues inside the fusion protein. These findings revealed that the Vip3Aa-Cry1Ac fusion protein has a strong affinity against Lepidopteran insect receptors and hence has a potential to be an efficient broad-range insecticidal protein.

  14. Calculation of the thermal solar contribution in facilities of ACS in buildings. Comparison between the method of strong simulation and F-Chart considering lost in the circuits; Calculo de la contribucion solar termica en instalaciones de ACS en edificios. Comparacion entre el metodo de simulacion dinamica y F-Chart considerando perdidas en los circuitos

    Energy Technology Data Exchange (ETDEWEB)

    Guillo, J. F.; Lucas, M.; Lucas, R.; Vicente, P. G.

    2008-07-01

    It has analyzed the impact of distribution losses in the size of solar installations by comparing two methods commonly used in calculating the contribution of solar residential building: f-chart and dynamic simulation. 3 schemes have been analysed in a building 22 houses and 70 occupants located in the IV and climate in the province of Alicante. For comparison between the two methodologies have been used for calculating the same values input from climate data as consumption of ACS. (Author)

  15. Working with the American Community Survey in R a guide to using the acs package

    CERN Document Server

    Glenn, Ezra Haber

    2016-01-01

    This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

  16. Control of hybrid AC/DC microgrid under islanding operational conditions

    DEFF Research Database (Denmark)

    Ding, G.; Gao, F.; Zhang, S.

    2014-01-01

    This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter...

  17. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  18. Female pattern hair loss

    Directory of Open Access Journals (Sweden)

    Archana Singal

    2013-01-01

    Full Text Available Female pattern hair loss (FPHL is a common cause of hair loss in women characterized by diffuse reduction in hair density over the crown and frontal scalp with retention of the frontal hairline. Its prevalence increases with advancing age and is associated with significant psychological morbidity. The pathophysiology of FPHL is still not completely understood and seems to be multifactorial. Although androgens have been implicated, the involvement of androgen-independent mechanisms is evident from frequent lack of clinical or biochemical markers of hyperandrogenism in affected women. The role of genetic polymorphisms involving the androgen and estrogen receptors is being increasingly recognized in its causation and predicting treatment response to anti-androgens. There are different clinical patterns and classifications of FPHL, knowledge of which facilitates patient management and research. Chronic telogen effluvium remains as the most important differential diagnosis. Thorough history, clinical examination, and evaluation are essential to confirm diagnosis. Patients with clinical signs of androgen excess require assessment of biochemical parameters and imaging studies. It is prudent to screen the patients for metabolic syndrome and cardiovascular risk factors. The treatment comprises medical and/or surgical modalities. Medical treatment should be initiated early as it effectively arrests hair loss progression rather than stimulating regrowth. Minoxidil continues to be the first line therapy whereas anti-androgens form the second line of treatment. The progressive nature of FPHL mandates long-term treatment for sustained effect. Medical therapy may be supplemented with cosmetic concealment in those desirous of greater hair density. Surgery may be worthwhile in some carefully selected patients.

  19. HEARING LOSS IN DECOMPRESSION

    Science.gov (United States)

    hearing loss is often reported. Most of this can readily be attributed to the residual effects of repeated aerotitis media, and is not sudden. A review of the topic of sudden deafness reveals that every large hospital where such records have been published sees every month about 1-2 patients whose sudden deafness is not easily explained. Possible causes have been suggested: acute neuritis of the VIIIth nerve, virus infection, vascular accident, vasomotor neurosis, acoustic trauma at levels of noise not usually noxious, collagen disease, transient ischemia from violent

  20. Differential expression of CD300a/c on human TH1 and TH17 cells

    Directory of Open Access Journals (Sweden)

    Borrego Francisco

    2011-11-01

    Full Text Available Abstract Background Human memory CD4+ T cells can be either CD300a/c+ or CD300a/c- and subsequent analyses showed that CD4+ effector memory T (TEM cells are mostly CD300a/c+, whereas CD4+ central memory T (TCM cells have similar frequencies of CD300a/c+ and CD300a/c- cells. Results Extensive phenotypical and functional characterization showed that in both TCM and TEM cells, the CD300a/c+ subset contained a higher number of TH1 (IFN-γ producing cells. Alternatively, TH17 (IL-17a producing cells tend to be CD300a/c-, especially in the TEM subset. Further characterization of the IL-17a+ cells showed that cells that produce only this cytokine are mostly CD300a/c-, while cells that produce IL-17a in combination with other cytokines, especially IFN-γ, are mostly CD300a/c+, indicating that the expression of this receptor is associated with cells that produce IFN-γ. Co-ligation of the TCR and CD300a/c in CD4+ T cells inhibited Ca2+ mobilization evoked by TCR ligation alone and modulated IFN-γ production on TH1 polarized cells. Conclusion We conclude that the CD300a/c receptors are differentially expressed on human TH1 and TH17 cells and that their ligation is capable of modulating TCR mediated signals.

  1. Magnetization Losses of Roebel Cable Samples with 2G YBCO Coated Conductor Strands

    CERN Document Server

    Yang, Y.; Falorio, I.; Young, E.A.; Kario, A.; Goldacker, W.; Dhallé, M. M. J.; van Nugteren, J.; Kirby, G.; Bottura, L.; Ballarino, A.

    2016-01-01

    Roebel cable with 2G YBCO strands is one of the promising HTS solutions of fully transposed high current conductors for high field accelerator magnets. Following the considerable research effort on the manufacturing of Roebel cables in recent years, sample conductors are now available in useful lengths with reproducible performances to allow detailed characterizations beyond the standard critical current measurements. The ac loss and strands coupling are of significant interest for the field quality of the accelerator magnets. We report a set of systematic ac loss measurements on two different Roebel cable samples prepared for the EuCARD2 collaboration. The measurements were performed over a wide range of temperature between 5 K and 90 K and the results were analyzed in the context of strands architecture and coupling. The results show that the transposed bundles are partially decoupled and the strands in transposition sections behave as an isolated single tape if the strands are insulated.

  2. Relations between ac-dc components and optical path length in photoplethysmography.

    Science.gov (United States)

    Lee, Chungkeun; Sik Shin, Hang; Lee, Myoungho

    2011-07-01

    Photoplethysmography is used in various areas such as vital sign measurement, vascular characteristics analysis, and autonomic nervous system assessment. Photoplethysmographic signals are composed of ac and dc, but it is difficult to find research about the interaction of photoplethysmographic components. This study suggested a model equation combining two Lambert-Beer equations at the onset and peak points of photoplethysmography to evaluate ac characteristics, and verified the model equation through simulation and experiment. In the suggested equation, ac was dependent on dc and optical path length. In the simulation, dc was inversely proportionate to ac sensitivity (slope), and ac and optical path length were proportionate. When dc increased from 10% to 90%, stabilized ac decreased from 1 to 0.89 ± 0.21, and when optical path length increased from 10% to 90%, stabilized ac increased from 1 to 1.53 ± 0.40.

  3. Reassembled Biosynthetic Pathway for a Large-scale Synthesis of CMP-Neu5Ac

    Science.gov (United States)

    Song, Jing; Zhang, Hesheng; Wu, Bingyuan; Zhang, Yingxin; Li, Hanfen; Xiao, Min; Wang, Peng George

    2003-01-01

    CMP-Neu5Ac is an important sugar nucleotide for biosynthesis of sialic acid and its conjugates. In this paper, a large-scale production system of CMP-Neu5Ac by a single strain is reported. The co-expression of Neu5Ac aldolase (EC4.1.3.3) and CMP-Neu5Ac synthetase (EC 2.7.7.43) was achieved by constructing individual genes into one plasmid and having a single culture that has both NeuAc aldolase and CMP-Neu5Ac synthetase activities. Overall this system only employed N-acetylmannosamine, excess of pyruvate and CTP to produce CMP-Neu5Ac. This work has demonstrated that a large-scale synthesis of sialic acid-derived oligosaccharides could be achieved economically and efficiently through a single, biosynthetic pathway engineered microorganism.

  4. Tragic loss at CERN

    CERN Multimedia

    CERN Ski Club

    2015-01-01

    Tragic loss at CERN The CERN community is mourning the tragic loss of two members of the CERN Ski Club. On Sunday, April 12, an avalanche buried four out of five skiers, taking part in a ski touring in the region of the Becs de Bosson in Valais (CH). The fifth skier, who had not been buried in the snow,  courageously managed to save two of the skiers, but Hervé Milcent, 49 years, federal ski instructor, and Mattieu Cattin, 33 years, were buried under two to three meters of snow, far down the avalanche slope, and did not survive, despite the fast arrival of the mountain rescue. In its 40 years of existence, the CERN Ski Club, one of the biggest in the Geneva area, has never been confronted with such a tragedy. The passing of Hervé and Matthieu has deeply shocked and saddened all volunteers of the Club as well as the entire alpine community. The ski touring section of the club would like to honour its friend Hervé, who joined the club in 1998. In 2003 he became res...

  5. Loss, yearning and curiosity

    Directory of Open Access Journals (Sweden)

    Dariusz Sośnicki

    2011-01-01

    Full Text Available In his piece, the author of the article ponders on the experience of loss in human life. It is this particular experience, as well as the accompanying longing, that form the basic components of an elegiac attitude. However, in its broader sense, loss becomes one of the most universal experiences in literature and the arts of the twentieth century. After all, they shared the conviction that reality, no matter how looked upon, was never fully accessible to us and that man always played a losing game with it. Contrary to outward appearances, the above also applies to the creators of avant-garde movements. An analysis of the poem Do NN***, written by Miron Białoszewski, carried out first within the context of elegy and then with reference to the techniques and the program of cubism, makes us aware that Białoszewski somehow evades both elegiac mood and the avant-garde principles such as they are underlined in its program. The driving force for his writing is then curiosity. And it is curiosity, and just curiosity, independent and one that cannot be reduced to just the desire to know, that forms the only real alternative that, in a way, always remains metaphysical.

  6. Development of Abnormal Operating Strategies for Loss of Ultimate Heat Sink (LOUHS) at Shutdown Mode in Westinghouse Type Nuclear Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Duk-Joo; Lee, Seung-Chan; Sung, Je-Joong; Ha, Sang Jun [KHNP CRI, Daejeon (Korea, Republic of); Hwang, Su-Hyun [FNC Tech. Co., Yongin (Korea, Republic of)

    2016-10-15

    Loss of all AC power is classified as one of multiple failure accident by regulatory guide of Korean accident management program. Therefore we need develop strategies for the abnormal operating procedure both of power operating and shutdown mode. This paper developed abnormal operating guideline for loss of all AC power by analysis of accident scenario in pressurized water reactor. This paper analyzed the extended SBO in shutdown operating mode and developed the operating strategy of the abnormal operation procedure. Operator action for the emergency are not required to take in 500 minutes and 60 minutes in intact and opened RCS state respectively.

  7. Breast Cancer and Bone Loss

    Science.gov (United States)

    ... Menopause Map Featured Resource Find an Endocrinologist Search Breast Cancer and Bone Loss July 2010 Download PDFs English ... G. Komen Foundation What is the link between breast cancer and bone loss? Certain treatments for breast cancer ...

  8. Loss of a spouse - resources

    Science.gov (United States)

    Resources - loss of a spouse ... The following organizations provide information on the loss of a spouse or significant other: GoodTherapy.org -- www.goodtherapy.org/learn-about-therapy/issues/grief National Institute on Aging -- www.nia.nih. ...

  9. Overweight, Obesity, and Weight Loss

    Science.gov (United States)

    ... Back to section menu Healthy Weight Weight and obesity Underweight Weight, fertility, and pregnancy Weight loss and ... section Home Healthy Weight Healthy Weight Weight and obesity Underweight Weight, fertility, and pregnancy Weight loss and ...

  10. Noise and Hearing Loss Prevention

    Science.gov (United States)

    ... visit this page: About CDC.gov . NOISE AND HEARING LOSS PREVENTION Recommend on Facebook Tweet Share Compartir Hearing ... noise levels cannot be adequately reduced. Noise and Hearing Loss on the NIOSH Science Blog Read and comment ...

  11. Hearing Loss and Older Adults

    Science.gov (United States)

    ... noise-induced hearing loss. Many construction workers, farmers, musicians, airport workers, yard and tree care workers, and ... Loss Do You Need a Hearing Test? News Brain training can improve our understanding of speech in ...

  12. Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

    Directory of Open Access Journals (Sweden)

    Pijar Riza Anugerah

    2015-10-01

    Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

  13. Pharmacokinetic Modeling of Absorption Behavior of 9-Aminocamptothecin (9-AC) Released from Colon-specific HPMA Copolymer–9-AC Conjugate in Rats

    Science.gov (United States)

    Gao, Song-Qi; Sun, Yongen; Kopečková, Pavla; Peterson, C. Matthew; Kopeček, Jindřich

    2011-01-01

    Purpose To quantitate and predict colon-specific 9-aminocamptothecin (9-AC) release from the N-(2-hydroxypropyl)methacrylamide (HPMA) copolymer–9-AC conjugate and its absorption behavior after oral administration in rats. Methods Drug distribution in the gastrointestinal (GI) tract and the plasma concentration-time profile of 9-AC released from the HPMA copolymer conjugate were predicted using the degradation, transit, and absorption rate constants in cecum. The fate of 9-AC in cecum and liver was measured by in-situ cecum absorption and liver perfusion. Results Following oral administration of the conjugate, 9-AC was released rapidly in cecum. Based on the pharmacokinetic model, up to 60% of the dose was in the cecum at ∼6 h, and 7% of the dose still remained there at 24 h. The predicted plasma concentration curve for released 9-AC after an oral dose of 3 mg/kg of 9-AC equivalent increased gradually and reached a peak of 98 nM at 7 h, then started decreasing slowly to 16 nM at 24 h. The bioavailability value was estimated as 0.31 after the first-pass elimination. Conclusions A pharmacokinetic model delineated the impact of GI transit, drug absorption rate, and first-pass metabolism on drug disposition following oral administration of HPMA copolymer–9-AC conjugate in rats. PMID:17929146

  14. Loss and terminal illness.

    Science.gov (United States)

    Benoliel, J Q

    1985-06-01

    The experience of terminal illness can best be viewed as a situation of multiple losses involving the dying person, family members and friends, and the health care providers engaged in offering services to them. It is a major transition during which the central participants must cope with the personal meanings of the forthcoming death as well as other losses brought about by the disease process, medical treatments, and the need to provide care for the dying person. How families adapt to the stresses and changes imposed by the experience of living with dying depends on their previous experiences with death, their established patterns of communication about serious matters, and their decision-making practices. Some individuals and families are at greater risk than others for developing maladaptive responses and behaviors during and after the experience of terminal illness. Risk factors to be considered in making hypotheses about the potential for maladaptive reactions include the strength of the attachment to the dying person, uncontrollable and distressing symptoms, and coping limitations associated with age and other factors contributing to increased vulnerability to the demands of continuous change. Working effectively with different kinds of families during the transition of terminal illness can best be accomplished within a conceptual framework built upon knowledge about people undergoing change. The concept of safe conduct can serve as an overall guide for the creation of nursing services designed to offer personalized care and accessibility of professional help at times of maximum need by the family. Assisting dying patients and their families toward the achievement of their personal goals is fundamental to the idea of safe conduct. The delivery of nursing care in terminal illness requires an orientation to assessment as an ongoing process that makes use of knowledge about disease processes, medical treatments, individual and group adaptations to loss, risk

  15. Weigth loss strategies

    Directory of Open Access Journals (Sweden)

    Magnus Benetti

    2004-06-01

    Full Text Available Although it does not represent a great isolated cause of death, obesity may be considered one of the greatest health problems nowadays because it is associated with several diseases. Inorder to avoid both increase and appearance of new cases of obesity, it is paramount that preventive measures should be taken. Prevention may be implemented through changes in lifestyle, such as eating habits re-education and the practice of physical exercises. The objective of this study was to review what type of physical exercise and also the strategies that may be adopted in exercise prescription of to optimize weight loss. It was observed that muscular resistance exercise combined with aerobic exercise seemed to produce the best results in weight loss programs because they help to increase resting metabolic rate, to keep and/or increase fat-free mass and optimize the rate of mobilization, and use of fat during weight loss. The weight loss goal seems to be successfully reached in programs that included resistance exercise, continuous and/or intermittent aerobic exercises which demand a high energy flow (70% VO2máx.. This process seemed to be more efficient because it afforded a greater total caloric expenditure; not only during exercise, but also because it triggered an increase in post-exercise oxygen consumption, thus causing fat to be used during this period. RESUMO A obesidade pode ser considerada um dos maiores problemas de saúde da atualidade por estar associada a inúmeras doenças, apesar de não representar uma grande causa isolada de morte. Para evitar tanto o crescimento como o surgimento de novos casos de obesidade, faz-se necessário que medidas de prevenção sejam tomadas. A prevenção é realizada através de mudanças no estilo de vida, como reeducação alimentar e inclusão da prática de exercícios físicos. O objetivo desta revisão foi abordar qual o tipo de exercício físico e também as estratégias que podem ser adotadas na

  16. Electromagnetic and mechanical AC loss of an ITER TF model coil conductor (DP4) under transverse cyclic loading

    NARCIS (Netherlands)

    Nijhuis, Arend; Noordman, Niels H.W.; ten Kate, Herman H.J.; Mitchell, Neil

    2000-01-01

    Energising a coil results in a transverse force on the strands pushing the cable towards one side of the jacket. This load causes a transverse compressive strain in strands and in particular in strand crossover points. Besides this, contact surfaces interfere by micro-sliding resulting in friction

  17. Low AC-loss MgB2 Superconductors for Turbo-Electric Aircraft Propulsion Systems Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The development of magnesium diboride (MgB2) superconducting wires makes possible the potential to have much lighter weight superconducting stator and rotor coils...

  18. Specific absorption rate dependence on temperature in magnetic field hyperthermia measured by dynamic hysteresis losses (ac magnetometry).

    Science.gov (United States)

    Garaio, Eneko; Sandre, Olivier; Collantes, Juan-Mari; Garcia, Jose Angel; Mornet, Stéphane; Plazaola, Fernando

    2015-01-09

    Magnetic nanoparticles (NPs) are intensively studied for their potential use for magnetic hyperthermia, a treatment that has passed a phase II clinical trial against severe brain cancer (glioblastoma) at the end of 2011. Their heating power, characterized by the 'specific absorption rate (SAR)', is often considered temperature independent in the literature, mainly because of the difficulties that arise from the measurement methodology. Using a dynamic magnetometer presented in a recent paper, we measure here the thermal dependence of SAR for superparamagnetic iron oxide (maghemite) NPs of four different size-ranges corresponding to mean diameters around 12 nm, 14 nm, 15 nm and 16 nm. The article reports a parametrical study extending from 10 to 60 °C in temperature, from 75 to 1031 kHz in frequency, and from 2 to 24 kA m(-1) in magnetic field strength. It was observed that SAR values of smaller NPs decrease with temperature whereas for the larger sample (16 nm) SAR values increase with temperature. The measured variation of SAR with temperature is frequency dependent. This behaviour is fully explained within the scope of linear response theory based on Néel and Brown relaxation processes, using independent magnetic measurements of the specific magnetization and the magnetic anisotropy constant. A good quantitative agreement between experimental values and theoretical values is confirmed in a tri-dimensional space that uses as coordinates the field strength, the frequency and the temperature.

  19. Experimental validation of a lap-type joint AC loss model with an ITER correction coil conductor joint

    NARCIS (Netherlands)

    Rolando, G.; Hansheng, F.; Hongwei, L.; Lin, W.; Wu, W.; Foussat, A.; Ilyin, Y.; Libeyre, P.; Nijhuis, Arend

    2014-01-01

    The ITER correction coils (CC) system features shaking hands lap-type joints to interface the terminations of the conductors. The feasibility of operating plasma scenarios depends on the ability of the magnets to retain sufficient temperature and current margins. In this respect, the joints

  20. The influence of Lorentz force on the ac loss in sub-size cable-in-conduit conductors for ITER

    NARCIS (Netherlands)

    Nijhuis, Arend; ten Kate, Herman H.J.; Bruzzone, Pierluigi

    1997-01-01

    The cable-in-conduit superconductors for the ITER coils have operating current in excess of 40 kA and function under last ramp conditions and fields up to 13 T. The transverse Lorentz force acting on strands may reduce the effective contact resistance between strands in the cable and as a