WorldWideScience

Sample records for ac linear positioning

  1. Stanford Linear Collider magnet positioning

    International Nuclear Information System (INIS)

    Wand, B.T.

    1991-08-01

    For the installation of the Stanford Linear Collider (SLC) the positioning and alignment of the beam line components was performed in several individual steps. In the following the general procedures for each step are outlined. The calculation of ideal coordinates for the magnets in the entire SLC will be discussed in detail. Special emphasis was given to the mathematical algorithms and geometry used in the programs to calculate these ideal positions. 35 refs., 21 figs

  2. Linear positivity and virtual probability

    International Nuclear Information System (INIS)

    Hartle, James B.

    2004-01-01

    We investigate the quantum theory of closed systems based on the linear positivity decoherence condition of Goldstein and Page. The objective of any quantum theory of a closed system, most generally the universe, is the prediction of probabilities for the individual members of sets of alternative coarse-grained histories of the system. Quantum interference between members of a set of alternative histories is an obstacle to assigning probabilities that are consistent with the rules of probability theory. A quantum theory of closed systems therefore requires two elements: (1) a condition specifying which sets of histories may be assigned probabilities and (2) a rule for those probabilities. The linear positivity condition of Goldstein and Page is the weakest of the general conditions proposed so far. Its general properties relating to exact probability sum rules, time neutrality, and conservation laws are explored. Its inconsistency with the usual notion of independent subsystems in quantum mechanics is reviewed. Its relation to the stronger condition of medium decoherence necessary for classicality is discussed. The linear positivity of histories in a number of simple model systems is investigated with the aim of exhibiting linearly positive sets of histories that are not decoherent. The utility of extending the notion of probability to include values outside the range of 0-1 is described. Alternatives with such virtual probabilities cannot be measured or recorded, but can be used in the intermediate steps of calculations of real probabilities. Extended probabilities give a simple and general way of formulating quantum theory. The various decoherence conditions are compared in terms of their utility for characterizing classicality and the role they might play in further generalizations of quantum mechanics

  3. Positive Quasi Linear Operator Formulation

    International Nuclear Information System (INIS)

    Berry, L.A.; Jaeger, E.F.

    2005-01-01

    Expressions for the RF quasi-linear operator are biquadratic sums over the Fourier modes (or FLR equivalent) that describe the RF electric field with a kernel that is a function of the two wave vectors, k-vector L and k-vector R , in the sum. As a result of either an implicit or explicit average over field lines or flux surfaces, this kernel only depends on one parallel wave vector, conventionally k R -vector. When k-vector is an independent component of the representation for E, the sums are demonstrably positive. However, except for closed field line systems, k-vector is dependent on the local direction of the equilibrium magnetic field, and, empirically, the absorbed energy and quasi-linear diffusion coefficients are observed to have negative features. We have formally introduced an independent k-vector sum by Fourier transforming the RF electric field (assuming straight field lines) using a field-line-length coordinate. The resulting expression is positive. We have modeled this approach by calculating the quasi linear operator for 'modes' with fixed k-vector. We form these modes by discretizing k-vector and then assigning all of the Fourier components with k-vectorthat fall within a given k-vector bin to that k-vector mode. Results will be shown as a function of the number of bins. Future work will involve implementing the expressions derived from the Fourier transform and evaluating the dependence on field line length

  4. AC impedance electrochemical modeling of lithium-ion positive electrodes

    International Nuclear Information System (INIS)

    Dees, D.; Gunen, E.; Abraham, D.; Jansen, A.; Prakash, J.

    2004-01-01

    Under Department of Energy's Advanced Technology Development Program,various analytical diagnostic studies are being carried out to examine the lithium-ion battery technology for hybrid electric vehicle applications, and a series of electrochemical studies are being conducted to examine the performance of these batteries. An electrochemical model was developed to associate changes that were observed in the post-test analytical diagnostic studies with the electrochemical performance loss during testing of lithium ion batteries. While both electrodes in the lithium-ion cell have been studied using a similar electrochemical model, the discussion here is limited to modeling of the positive electrode. The positive electrode under study has a composite structure made of a layered nickel oxide (LiNi 0.8 Co 0.15 Al 0.05 O 2 ) active material, a carbon black and graphite additive for distributing current, and a PVDF binder all on an aluminum current collector. The electrolyte is 1.2M LiPF 6 dissolved in a mixture of EC and EMC and a Celgard micro-porous membrane is used as the separator. Planar test cells (positive/separator/negative) were constructed with a special fixture and two separator membranes that allowed the placement of a micro-reference electrode between the separator membranes (1). Electrochemical studies including AC impedance spectroscopy were then conducted on the individual electrodes to examine the performance and ageing effects in the cell. The model was developed by following the work of Professor Newman at Berkeley (2). The solid electrolyte interface (SEI) region, based on post-test analytical results, was assumed to be a film on the oxide and an oxide layer at the surface of the oxide. A double layer capacity was added in parallel with the Butler-Volmer kinetic expression. The pertinent reaction, thermodynamic, and transport equations were linearized for a small sinusoidal perturbation (3). The resulting system of differential equations was solved

  5. Linear quadratic optimization for positive LTI system

    Science.gov (United States)

    Muhafzan, Yenti, Syafrida Wirma; Zulakmal

    2017-05-01

    Nowaday the linear quadratic optimization subject to positive linear time invariant (LTI) system constitute an interesting study considering it can become a mathematical model of variety of real problem whose variables have to nonnegative and trajectories generated by these variables must be nonnegative. In this paper we propose a method to generate an optimal control of linear quadratic optimization subject to positive linear time invariant (LTI) system. A sufficient condition that guarantee the existence of such optimal control is discussed.

  6. Improvement of the dynamic performance of an AC linear permanent magnet machine

    NARCIS (Netherlands)

    Jansen, J.W.; Lomonova, E.; Vandenput, A.J.A.; Compter, J.C.; Verweij, A.H.

    2003-01-01

    This paper discusses the controller design and test approaches leading to the performance improvement of a brushless 3-phase AC synchronous permanent magnet linear machine. The feasible controller design concept for the linear machine is presented and further implemented in Simulink and dSPACE. Two

  7. Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid

    Directory of Open Access Journals (Sweden)

    Dwi Riana Aryani

    2017-11-01

    Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.

  8. a Continuous-Time Positive Linear System

    Directory of Open Access Journals (Sweden)

    Kyungsup Kim

    2013-01-01

    Full Text Available This paper discusses a computational method to construct positive realizations with sparse matrices for continuous-time positive linear systems with multiple complex poles. To construct a positive realization of a continuous-time system, we use a Markov sequence similar to the impulse response sequence that is used in the discrete-time case. The existence of the proposed positive realization can be analyzed with the concept of a polyhedral convex cone. We provide a constructive algorithm to compute positive realizations with sparse matrices of some positive systems under certain conditions. A sufficient condition for the existence of a positive realization, under which the proposed constructive algorithm works well, is analyzed.

  9. Risk prediction of ventricular arrhythmias and myocardial function in Lamin A/C mutation positive subjects

    DEFF Research Database (Denmark)

    Hasselberg, Nina E; Edvardsen, Thor; Petri, Helle

    2014-01-01

    Mutations in the Lamin A/C gene may cause atrioventricular block, supraventricular arrhythmias, ventricular arrhythmias (VA), and dilated cardiomyopathy. We aimed to explore the predictors and the mechanisms of VA in Lamin A/C mutation-positive subjects.METHODS AND RESULTS: We included 41 Lamin A/C...

  10. DC and AC linear magnetic field sensor based on glass coated amorphous microwires with Giant Magnetoimpedance

    International Nuclear Information System (INIS)

    García-Chocano, Víctor Manuel; García-Miquel, Héctor

    2015-01-01

    Giant Magnetoimpedance (GMI) effect has been studied in amorphous glass-coated microwires of composition (Fe 6 Co 94 ) 72.5 Si 12.5 B 15 . The impedance of a 1.5 cm length sample has been characterized by using constant AC currents in the range of 400 µA–4 mA at frequencies from 7 to 15 MHz and DC magnetic fields from −900 to 900 A/m. Double peak responses have been obtained, showing GMI ratios up to 107%. A linear magnetic field sensor for DC and AC field has been designed, using two microwires connected in series with a magnetic bias of 400 A/m with opposite direction in each microwire in order to obtain a linear response from ±70 (A/m) rms for AC magnetic field, and ±100 A/m for DC magnetic field. A closed loop feedback circuit has been implemented to extend the linear range to ±1 kA/m for DC magnetic field. - Highlights: • Giant Magneto Impedance phenomenon has been studied in amorphous microwires. • A combination of two microwires with a bias field has been developed to get a linear response. • An electronic circuit has been developed to obtain a sensor with a linear response. • A feedback coil have been added to increase the measurable range of the sensor

  11. Positivity of linear maps under tensor powers

    Energy Technology Data Exchange (ETDEWEB)

    Müller-Hermes, Alexander, E-mail: muellerh@ma.tum.de; Wolf, Michael M., E-mail: m.wolf@tum.de [Zentrum Mathematik, Technische Universität München, 85748 Garching (Germany); Reeb, David, E-mail: reeb.qit@gmail.com [Zentrum Mathematik, Technische Universität München, 85748 Garching (Germany); Institute for Theoretical Physics, Leibniz Universität Hannover, 30167 Hannover (Germany)

    2016-01-15

    We investigate linear maps between matrix algebras that remain positive under tensor powers, i.e., under tensoring with n copies of themselves. Completely positive and completely co-positive maps are trivial examples of this kind. We show that for every n ∈ ℕ, there exist non-trivial maps with this property and that for two-dimensional Hilbert spaces there is no non-trivial map for which this holds for all n. For higher dimensions, we reduce the existence question of such non-trivial “tensor-stable positive maps” to a one-parameter family of maps and show that an affirmative answer would imply the existence of non-positive partial transpose bound entanglement. As an application, we show that any tensor-stable positive map that is not completely positive yields an upper bound on the quantum channel capacity, which for the transposition map gives the well-known cb-norm bound. We, furthermore, show that the latter is an upper bound even for the local operations and classical communications-assisted quantum capacity, and that moreover it is a strong converse rate for this task.

  12. Positivity of linear maps under tensor powers

    International Nuclear Information System (INIS)

    Müller-Hermes, Alexander; Wolf, Michael M.; Reeb, David

    2016-01-01

    We investigate linear maps between matrix algebras that remain positive under tensor powers, i.e., under tensoring with n copies of themselves. Completely positive and completely co-positive maps are trivial examples of this kind. We show that for every n ∈ ℕ, there exist non-trivial maps with this property and that for two-dimensional Hilbert spaces there is no non-trivial map for which this holds for all n. For higher dimensions, we reduce the existence question of such non-trivial “tensor-stable positive maps” to a one-parameter family of maps and show that an affirmative answer would imply the existence of non-positive partial transpose bound entanglement. As an application, we show that any tensor-stable positive map that is not completely positive yields an upper bound on the quantum channel capacity, which for the transposition map gives the well-known cb-norm bound. We, furthermore, show that the latter is an upper bound even for the local operations and classical communications-assisted quantum capacity, and that moreover it is a strong converse rate for this task

  13. Effects of Linear Falling Ramp Reset Pulse on Addressing Operation in AC PDP

    International Nuclear Information System (INIS)

    Liu Zujun; Liang Zhihu; Liu Chunliang; Meng Lingguo

    2006-01-01

    The effects of linear falling ramp reset pulse related to addressing operation in an alternating current plasma display panel (AC PDP) were studied. The wall charge waveforms were measured by the electrode balance method in a 12-inch coplanar AC PDP. The wall charge waveforms show the relationship between the slope ratio of the falling ramp reset pulse and the wall charges at the end of the falling ramp reset pulse which influences the addressing stability. Then the effects of the slope ratio of the linear falling ramp reset pulse on the addressing voltage and addressing time were investigated. The experimental results show that the minimum addressing voltage increases with the increase of the slope ratio of the falling ramp reset pulse, and so does the minimum addressing time. Based on the experimental results, the optimization of the addressing time and the slope ratio of the falling ramp pulse is discussed

  14. FAST COMPENSATION OF GLOBAL LINEAR COUPLING IN RHIC USING AC DIPOLES

    International Nuclear Information System (INIS)

    CALAGA, R.; FRANCHI, A., TOMAS, R.; CERN)

    2006-01-01

    Global linear coupling has been extensively studied in accelerators and several methods have been developed to compensate the coupling coefficient C using skew quadrupole families scans. However, scanning techniques can become very time consuming especially during the commissioning of an energy ramp. In this paper they illustrate a new technique to measure and compensate, in a single machine cycle, global linear coupling from turn-by-turn BPM data without the need of a skew quadrupole scan. The algorithm is applied to RHIC BPM data using AC dipoles and compared with traditional methods

  15. Novel AC Servo Rotating and Linear Composite Driving Device for Plastic Forming Equipment

    Science.gov (United States)

    Liang, Jin-Tao; Zhao, Sheng-Dun; Li, Yong-Yi; Zhu, Mu-Zhi

    2017-07-01

    The existing plastic forming equipment are mostly driven by traditional AC motors with long transmission chains, low efficiency, large size, low precision and poor dynamic response are the common disadvantages. In order to realize high performance forming processes, the driving device should be improved, especially for complicated processing motions. Based on electric servo direct drive technology, a novel AC servo rotating and linear composite driving device is proposed, which features implementing both spindle rotation and feed motion without transmission, so that compact structure and precise control can be achieved. Flux switching topology is employed in the rotating drive component for strong robustness, and fractional slot is employed in the linear direct drive component for large force capability. Then the mechanical structure for compositing rotation and linear motion is designed. A device prototype is manufactured, machining of each component and the whole assembly are presented respectively. Commercial servo amplifiers are utilized to construct the control system of the proposed device. To validate the effectiveness of the proposed composite driving device, experimental study on the dynamic test benches are conducted. The results indicate that the output torque can attain to 420 N·m and the dynamic tracking errors are less than about 0.3 rad in the rotating drive. the dynamic tracking errors are less than about 1.6 mm in the linear feed. The proposed research provides a method to construct high efficiency and accuracy direct driving device in plastic forming equipment.

  16. Entanglement witnesses arising from exposed positive linear maps

    OpenAIRE

    Ha, Kil-Chan; Kye, Seung-Hyeok

    2011-01-01

    We consider entanglement witnesses arising from positive linear maps which generate exposed extremal rays. We show that every entanglement can be detected by one of these witnesses, and this witness detects a unique set of entanglement among those. Therefore, they provide a minimal set of witnesses to detect all entanglement in a sense. Furthermore, if those maps are indecomposable then they detect large classes of entanglement with positive partial transposes which have nonempty relative int...

  17. The correction of linear lattice gradient errors using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Wang,G.; Bai, M.; Litvinenko, V.N.; Satogata, T.

    2009-05-04

    Precise measurement of optics from coherent betatron oscillations driven by ac dipoles have been demonstrated at RHIC and the Tevatron. For RHIC, the observed rms beta-beat is about 10%. Reduction of beta-beating is an essential component of performance optimization at high energy colliders. A scheme of optics correction was developed and tested in the RHIC 2008 run, using ac dipole optics for measurement and a few adjustable trim quadruples for correction. In this scheme, we first calculate the phase response matrix from the. measured phase advance, and then apply singular value decomposition (SVD) algorithm to the phase response matrix to find correction quadruple strengths. We present both simulation and some preliminary experimental results of this correction.

  18. Position sensor for linear synchronous motors employing halbach arrays

    Science.gov (United States)

    Post, Richard Freeman

    2014-12-23

    A position sensor suitable for use in linear synchronous motor (LSM) drive systems employing Halbach arrays to create their magnetic fields is described. The system has several advantages over previously employed ones, especially in its simplicity and its freedom from being affected by weather conditions, accumulated dirt, or electrical interference from the LSM system itself.

  19. Ideal Convergence of k-Positive Linear Operators

    Directory of Open Access Journals (Sweden)

    Akif Gadjiev

    2012-01-01

    Full Text Available We study some ideal convergence results of k-positive linear operators defined on an appropriate subspace of the space of all analytic functions on a bounded simply connected domain in the complex plane. We also show that our approximation results with respect to ideal convergence are more general than the classical ones.

  20. Ac-loss measurement of coated conductors: The influence of the pick-up coil position

    International Nuclear Information System (INIS)

    Schmidt, Curt

    2008-01-01

    The ac-loss measurement by the magnetization method requires calibration for obtaining absolute values. A convenient way of calibration is the calorimetric measurement which yields, within the measuring accuracy, absolute loss values. In the magnetization measurement the hysteresis loop of sample magnetization which determines the losses is measured via the integration of magnetic flux penetrating a pick-up coil. The ratio of flux integral to magnetization integral and hence the calibration factor is however, for a given pick-up coil geometry, not exactly a constant, but depends on the magnetization current pattern within the sample. Especially for thin tapes in perpendicular external field this effect has to be taken into consideration in order to avoid miss measurements. The relation between measured flux and sample magnetization was calculated for special cases of magnetization current distribution in the sample as a function of the pick-up coil position. Furthermore calibration factors were measured as a function of the ac-field amplitude and the result compared with available theoretical models. A good agreement was found between experiment and theory

  1. Linear micromechanical stepping drive for pinhole array positioning

    International Nuclear Information System (INIS)

    Endrödy, Csaba; Mehner, Hannes; Hoffmann, Martin; Grewe, Adrian

    2015-01-01

    A compact linear micromechanical stepping drive for positioning a 7 × 5.5 mm 2 optical pinhole array is presented. The system features a step size of 13.2 µm and a full displacement range of 200 µm. The electrostatic inch-worm stepping mechanism shows a compact design capable of positioning a payload 50% of its own weight. The stepping drive movement, step sizes and position accuracy are characterized. The actuated pinhole array is integrated in a confocal chromatic hyperspectral imaging system, where coverage of the object plane, and therefore the useful picture data, can be multiplied by 14 in contrast to a non-actuated array. (paper)

  2. A linear actuator for precision positioning of dual objects

    International Nuclear Information System (INIS)

    Peng, Yuxin; Cao, Jie; Guo, Zhao; Yu, Haoyong

    2015-01-01

    In this paper, a linear actuator for precision positioning of dual objects is proposed based on a double friction drive principle using a single piezoelectric element (PZT). The linear actuator consists of an electromagnet and a permanent magnet, which are connected by the PZT. The electromagnet serves as an object 1, and another object (object 2) is attached on the permanent magnet by the magnetic force. For positioning the dual objects independently, two different friction drive modes can be alternated by an on–off control of the electromagnet. When the electromagnet releases from the guide way, it can be driven by impact friction force generated by the PZT. Otherwise, when the electromagnet clamps on the guide way and remains stationary, the object 2 can be driven based on the principle of smooth impact friction drive. A prototype was designed and constructed and experiments were carried out to test the basic performance of the actuator. It has been verified that with a compact size of 31 mm (L) × 12 mm (W) × 8 mm (H), the two objects can achieve long strokes on the order of several millimeters and high resolutions of several tens of nanometers. Since the proposed actuator allows independent movement of two objects by a single PZT, the actuator has the potential to be constructed compactly. (paper)

  3. Incomplete factorization technique for positive definite linear systems

    International Nuclear Information System (INIS)

    Manteuffel, T.A.

    1980-01-01

    This paper describes a technique for solving the large sparse symmetric linear systems that arise from the application of finite element methods. The technique combines an incomplete factorization method called the shifted incomplete Cholesky factorization with the method of generalized conjugate gradients. The shifted incomplete Cholesky factorization produces a splitting of the matrix A that is dependent upon a parameter α. It is shown that if A is positive definite, then there is some α for which this splitting is possible and that this splitting is at least as good as the Jacobi splitting. The method is shown to be more efficient on a set of test problems than either direct methods or explicit iteration schemes

  4. Reliability and Validity Assessment of a Linear Position Transducer

    Science.gov (United States)

    Garnacho-Castaño, Manuel V.; López-Lastra, Silvia; Maté-Muñoz, José L.

    2015-01-01

    The objectives of the study were to determine the validity and reliability of peak velocity (PV), average velocity (AV), peak power (PP) and average power (AP) measurements were made using a linear position transducer. Validity was assessed by comparing measurements simultaneously obtained using the Tendo Weightlifting Analyzer Systemi and T-Force Dynamic Measurement Systemr (Ergotech, Murcia, Spain) during two resistance exercises, bench press (BP) and full back squat (BS), performed by 71 trained male subjects. For the reliability study, a further 32 men completed both lifts using the Tendo Weightlifting Analyzer Systemz in two identical testing sessions one week apart (session 1 vs. session 2). Intraclass correlation coefficients (ICCs) indicating the validity of the Tendo Weightlifting Analyzer Systemi were high, with values ranging from 0.853 to 0.989. Systematic biases and random errors were low to moderate for almost all variables, being higher in the case of PP (bias ±157.56 W; error ±131.84 W). Proportional biases were identified for almost all variables. Test-retest reliability was strong with ICCs ranging from 0.922 to 0.988. Reliability results also showed minimal systematic biases and random errors, which were only significant for PP (bias -19.19 W; error ±67.57 W). Only PV recorded in the BS showed no significant proportional bias. The Tendo Weightlifting Analyzer Systemi emerged as a reliable system for measuring movement velocity and estimating power in resistance exercises. The low biases and random errors observed here (mainly AV, AP) make this device a useful tool for monitoring resistance training. Key points This study determined the validity and reliability of peak velocity, average velocity, peak power and average power measurements made using a linear position transducer The Tendo Weight-lifting Analyzer Systemi emerged as a reliable system for measuring movement velocity and power. PMID:25729300

  5. Linear position sensitive neutron detector using fiber optic encoded scintillators

    International Nuclear Information System (INIS)

    Davidson, P.L.; Wroe, H.

    1983-01-01

    A linear position sensitive slow neutron detector with 3 mm resolution is described. It uses the fiber optic coding principle in which the resolution elements are separate pieces of lithium loaded glass scintillator each coupled by means of flexible polymer optical fibers to a unique combination of 3 photo multipliers (PM's) out of a bank of 12. A decoder circuit repsponds to a triple coincidence between PM outputs and generates a 12 bit work which identifies the scintillator element which stopped the incident neutron. Some details of the construction and decoding electronics are given together with test results obtained using a laboratory isotope neutron source and a monochomated, collimated neutron beam from a reactor. The count rate in the absence of neutron sources is 2 to 3 c min - 1 per element; the element to element variation in response to a uniform flux is a few percent for 95% of the elements; the resolution as measured by a 1 mm wide prode neutron beam is 3 mm; the relative long term stability is about 0.1% over 3 days and the detection efficiency measured by comparison with an end windowed, high pressure gas counter is about 65% at a neutron wavelength of 0.9A 0

  6. Linear electrostatic micromotors for nano- and micro-positioning

    Science.gov (United States)

    Baginsky, I. L.; Kostsov, Edvard G.

    2004-05-01

    The functioning of the linear step electrostatic film micromotors with the short controlling pulse (less then 100-200 ´s) is studied to create nano- and micro-positioners. The theoretical study of the step movement of the given mass in this time frame is carried out. The results of the experimental studies of the multipetal reciprocal micromotors created on the basis of La modified Ba0.5Sr0.5Nb2O6 ferroelectric films with 1-3 μm thickness are shown. The petals were made of beryllium bronze. It is shown that the electrostatic rolling can last less than 50 μs, and the process of separating two surfaces (the metal and the ferroelectric) can last less than 1 μs. These parameters allow one to operate the micromotor at 1-10 kHz frequency, and the propulsion force in the beginning (the first 20-100 μs) of the electrostatic rolling can be as high as 1-10 N per 1 mm2 of the rolling surface with the voltage pulse amplitude of 40-50 V. The possibility of obtaining moving plate (MP) step in the nanometer range is studied, as well as the precision of these steps during the continuous MP movement with the different clock frequencies and durations of the voltage pulses. The recommendations are given to improve the accuracy and the speed of the positioning in the nano- and micro-movement range. Possible fields of micromotor application are micromechanics, including precision micromechanics, microelectronics, microrobots, microoptics, microscanners, micropumps (e.g. in the jet printers), micro flying vehicles etc.

  7. Reliability and Validity Assessment of a Linear Position Transducer

    Directory of Open Access Journals (Sweden)

    Manuel V. Garnacho-Castaño

    2015-03-01

    Full Text Available The objectives of the study were to determine the validity and reliability of peak velocity (PV, average velocity (AV, peak power (PP and average power (AP measurements were made using a linear position transducer. Validity was assessed by comparing measurements simultaneously obtained using the Tendo Weightlifting Analyzer Systemi and T-Force Dynamic Measurement Systemr (Ergotech, Murcia, Spain during two resistance exercises, bench press (BP and full back squat (BS, performed by 71 trained male subjects. For the reliability study, a further 32 men completed both lifts using the Tendo Weightlifting Analyzer Systemz in two identical testing sessions one week apart (session 1 vs. session 2. Intraclass correlation coefficients (ICCs indicating the validity of the Tendo Weightlifting Analyzer Systemi were high, with values ranging from 0.853 to 0.989. Systematic biases and random errors were low to moderate for almost all variables, being higher in the case of PP (bias ±157.56 W; error ±131.84 W. Proportional biases were identified for almost all variables. Test-retest reliability was strong with ICCs ranging from 0.922 to 0.988. Reliability results also showed minimal systematic biases and random errors, which were only significant for PP (bias -19.19 W; error ±67.57 W. Only PV recorded in the BS showed no significant proportional bias. The Tendo Weightlifting Analyzer Systemi emerged as a reliable system for measuring movement velocity and estimating power in resistance exercises. The low biases and random errors observed here (mainly AV, AP make this device a useful tool for monitoring resistance training.

  8. Stability Tests of Positive Fractional Continuous-time Linear Systems with Delays

    Directory of Open Access Journals (Sweden)

    Tadeusz Kaczorek

    2013-06-01

    Full Text Available Necessary and sufficient conditions for the asymptotic stability of positive fractional continuous-time linear systems with many delays are established. It is shown that: 1 the asymptotic stability of the positive fractional system is independent of their delays, 2 the checking of the asymptotic stability of the positive fractional systems with delays can be reduced to checking of the asymptotic stability of positive standard linear systems without delays.

  9. POSITIVE SOLUTIONS TO SEMI-LINEAR SECOND-ORDER ORDINARY DIFFERENTIAL EQUATIONS IN BANACH SPACE

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    In this paper,we study the existence of positive periodic solution to some second- order semi-linear differential equation in Banach space.By the fixed point index theory, we prove that the semi-linear differential equation has two positive periodic solutions.

  10. Development of a sub-nanometer positioning device: combining a new linear motor with linear motion ball guide ways

    International Nuclear Information System (INIS)

    Otsuka, J; Tanaka, T; Masuda, I

    2010-01-01

    A new type of linear motor described in this note has some advantages compared with conventional motors. The attractive magnetic force between the stator (permanent magnets) and mover (armature) is diminished almost to zero. The efficiency is better because the magnetic flux leakage is very small, the size of motor is smaller and detent (force ripple) is smaller than for conventional motors. Therefore, we think that this motor is greatly suitable for ultra-precision positioning as an actuator. An ultra-precision positioning device using this motor and linear motion ball guide ways is newly developed by making the device very rigid and using a suitable control method. Moreover, the positioning performance is evaluated by a positioning resolution, and deviation and dispersion errors. As a result of repeated step response tests, the positioning resolution is 0.3 nm, with the deviation error and dispersion error (3σ) being sub-nanometer. Consequently, the positioning device achieves sub-nanometer positioning. (technical design note)

  11. On the Linearized Darboux Equation Arising in Isometric Embedding of the Alexandrov Positive Annulus

    Institute of Scientific and Technical Information of China (English)

    Chunhe LI

    2013-01-01

    In the present paper,the solvability condition of the linearized Gauss-Codazzi system and the solutions to the homogenous system are given.In the meantime,the Solvability of a relevant linearized Darboux equation is given.The equations are arising in a geometric problem which is concerned with the realization of the Alexandrov's positive annulus in R3.

  12. Analytical expression for position sensitivity of linear response beam position monitor having inter-electrode cross talk

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Mukesh, E-mail: mukeshk@rrcat.gov.in [Beam Diagnostics Section, Indus Operations, Beam Dynamics & Diagnostics Division, Raja Ramanna Centre for Advanced Technology, Indore, 452013 MP (India); Homi Bhabha National Institute, Training School Complex, Anushakti Nagar, Mumbai 400 094 (India); Ojha, A.; Garg, A.D.; Puntambekar, T.A. [Beam Diagnostics Section, Indus Operations, Beam Dynamics & Diagnostics Division, Raja Ramanna Centre for Advanced Technology, Indore, 452013 MP (India); Senecha, V.K. [Homi Bhabha National Institute, Training School Complex, Anushakti Nagar, Mumbai 400 094 (India); Ion Source Lab., Proton Linac & Superconducting Cavities Division, Raja Ramanna Centre for Advanced Technology, Indore, 452013 MP (India)

    2017-02-01

    According to the quasi electrostatic model of linear response capacitive beam position monitor (BPM), the position sensitivity of the device depends only on the aperture of the device and it is independent of processing frequency and load impedance. In practice, however, due to the inter-electrode capacitive coupling (cross talk), the actual position sensitivity of the device decreases with increasing frequency and load impedance. We have taken into account the inter-electrode capacitance to derive and propose a new analytical expression for the position sensitivity as a function of frequency and load impedance. The sensitivity of a linear response shoe-box type BPM has been obtained through simulation using CST Studio Suite to verify and confirm the validity of the new analytical equation. Good agreement between the simulation results and the new analytical expression suggest that this method can be exploited for proper designing of BPM.

  13. Non-monotone positive solutions of second-order linear differential equations: existence, nonexistence and criteria

    Directory of Open Access Journals (Sweden)

    Mervan Pašić

    2016-10-01

    Full Text Available We study non-monotone positive solutions of the second-order linear differential equations: $(p(tx'' + q(t x = e(t$, with positive $p(t$ and $q(t$. For the first time, some criteria as well as the existence and nonexistence of non-monotone positive solutions are proved in the framework of some properties of solutions $\\theta (t$ of the corresponding integrable linear equation: $(p(t\\theta''=e(t$. The main results are illustrated by many examples dealing with equations which allow exact non-monotone positive solutions not necessarily periodic. Finally, we pose some open questions.

  14. Linear quadratic Gaussian controller design for plasma current, position and shape control system in ITER

    International Nuclear Information System (INIS)

    Belyakov, V.; Kavin, A.; Rumyantsev, E.; Kharitonov, V.; Misenov, B.; Ovsyannikov, A.; Ovsyannikov, D.; Veremei, E.; Zhabko, A.; Mitrishkin, Y.

    1999-01-01

    This paper is focused on the linear quadratic Gaussian (LQG) controller synthesis methodology for the ITER plasma current, position and shape control system as well as power derivative management system. It has been shown that some poloidal field (PF) coils have less influence on reference plasma-wall gaps control during plasma disturbances and hence they have been used to reduce total control power derivative by means of the additional non-linear feedback. The design has been done on the basis of linear models. Simulation was provided for non-linear model and results are presented and discussed. (orig.)

  15. A characterization of positive linear maps and criteria of entanglement for quantum states

    International Nuclear Information System (INIS)

    Hou Jinchuan

    2010-01-01

    Let H and K be (finite- or infinite-dimensional) complex Hilbert spaces. A characterization of positive completely bounded normal linear maps from B(H) into B(K) is given, which particularly gives a characterization of positive elementary operators including all positive linear maps between matrix algebras. This characterization is then applied to give a representation of quantum channels (operations) between infinite-dimensional systems. A necessary and sufficient criterion of separability is given which shows that a state ρ on HxK is separable if and only if (ΦxI)ρ ≥ 0 for all positive finite-rank elementary operators Φ. Examples of NCP and indecomposable positive linear maps are given and are used to recognize some entangled states that cannot be recognized by the PPT criterion and the realignment criterion.

  16. A characterization of positive linear maps and criteria of entanglement for quantum states

    Science.gov (United States)

    Hou, Jinchuan

    2010-09-01

    Let H and K be (finite- or infinite-dimensional) complex Hilbert spaces. A characterization of positive completely bounded normal linear maps from {\\mathcal B}(H) into {\\mathcal B}(K) is given, which particularly gives a characterization of positive elementary operators including all positive linear maps between matrix algebras. This characterization is then applied to give a representation of quantum channels (operations) between infinite-dimensional systems. A necessary and sufficient criterion of separability is given which shows that a state ρ on HotimesK is separable if and only if (ΦotimesI)ρ >= 0 for all positive finite-rank elementary operators Φ. Examples of NCP and indecomposable positive linear maps are given and are used to recognize some entangled states that cannot be recognized by the PPT criterion and the realignment criterion.

  17. Giant negative linear compression positively coupled to massive thermal expansion in a metal-organic framework.

    Science.gov (United States)

    Cai, Weizhao; Katrusiak, Andrzej

    2014-07-04

    Materials with negative linear compressibility are sought for various technological applications. Such effects were reported mainly in framework materials. When heated, they typically contract in the same direction of negative linear compression. Here we show that this common inverse relationship rule does not apply to a three-dimensional metal-organic framework crystal, [Ag(ethylenediamine)]NO3. In this material, the direction of the largest intrinsic negative linear compression yet observed in metal-organic frameworks coincides with the strongest positive thermal expansion. In the perpendicular direction, the large linear negative thermal expansion and the strongest crystal compressibility are collinear. This seemingly irrational positive relationship of temperature and pressure effects is explained and the mechanism of coupling of compressibility with expansivity is presented. The positive coupling between compression and thermal expansion in this material enhances its piezo-mechanical response in adiabatic process, which may be used for designing new artificial composites and ultrasensitive measuring devices.

  18. A study on virtual source position for electron beams from a Mevatron MD linear accelerator

    International Nuclear Information System (INIS)

    Ravindran, B.P.

    1999-01-01

    The virtual source position (VSP) for electron beams of energies 5, 7, 9 10, 12 and 14 MeV and for the applicators (cones) available in the department have been measured for a Mevatron MD class linear accelerator. Different methods of obtaining the virtual source position for electron beams have been investigated in the present study. The results obtained have been compared with those of other workers. It is observed that the VSP is very much machine dependent and needs to be measured for each linear accelerator. The effect of shielding on virtual source position for the type of applicators available in the department has also been investigated. (author)

  19. Design and performance of vacuum capable detector electronics for linear position sensitive neutron detectors

    International Nuclear Information System (INIS)

    Riedel, R.A.; Cooper, R.G.; Funk, L.L.; Clonts, L.G.

    2012-01-01

    We describe the design and performance of electronics for linear position sensitive neutron detectors. The eight tube assembly requires 10 W of power and can be controlled via digital communication links. The electronics can be used without modification in vacuum. Using a transimpedance amplifier and gated integration, we achieve a highly linear system with coefficient of determinations of 0.9999 or better. Typical resolution is one percent of tube length.

  20. Design and performance of vacuum capable detector electronics for linear position sensitive neutron detectors

    Energy Technology Data Exchange (ETDEWEB)

    Riedel, R.A., E-mail: riedelra@ornl.gov [Oak Ridge National Laboratories, Oak Ridge, TN 37830 (United States); Cooper, R.G.; Funk, L.L.; Clonts, L.G. [Oak Ridge National Laboratories, Oak Ridge, TN 37830 (United States)

    2012-02-01

    We describe the design and performance of electronics for linear position sensitive neutron detectors. The eight tube assembly requires 10 W of power and can be controlled via digital communication links. The electronics can be used without modification in vacuum. Using a transimpedance amplifier and gated integration, we achieve a highly linear system with coefficient of determinations of 0.9999 or better. Typical resolution is one percent of tube length.

  1. Evaluation of the accuracy of linear and angular measurements on panoramic radiographs taken at different positions

    Energy Technology Data Exchange (ETDEWEB)

    Nikneshan, Sima; Emadi, Naghmeh [Dept. of Oral and Maxillofacial Radiology, Dental School, Shahid Beheshti University of Medical Sciences, Tehran (Iran, Islamic Republic of); Sharafi, Mohamad [Dept. of Oral and Maxillofacial Radiology, Dental School, Ilam University of Medical Sciences, Ilam (Iran, Islamic Republic of)

    2013-09-15

    This study assessed the accuracy of linear and angular measurements on panoramic radiographs taken at different positions in vitro. Two acrylic models were fabricated from a cast with normal occlusion. Straight and 75 degree mesially and lingually angulated pins were placed, and standardized panoramic radiographs were taken at standard position, at an 8 degree downward tilt of the occlusal plane compared to the standard position, at an 8 degree upward tilt of the anterior occlusal plane, and at a 10 degree downward tilt of the right and left sides of the model. On the radiographs, the length of the pins above (crown) and below (root) the occlusal plane, total pin length, crown-to-root ratio, and angulation of pins relative to the occlusal plane were calculated. The data were subjected to repeated measures ANOVA and LSD multiple comparisons tests. Significant differences were noted between the radiographic measurements and true values in different positions on both models with linear (P<0.001) and those with angulated pins (P<0.005). No statistically significant differences were observed between the angular measurements and baselines of the natural head posture at different positions for the linear and angulated pins. Angular measurements on panoramic radiographs were sufficiently accurate and changes in the position of the occlusal plane equal to or less than 10 degree had no significant effect on them. Some variations could exist in the pin positioning (head positioning), and they were tolerable while taking panoramic radiographs. Linear measurements showed the least errors in the standard position and 8 degree upward tilt of the anterior part of the occlusal plane compared to other positions.

  2. Position Control of Linear Synchronous Motor Drives with Exploitation of Forced Dynamics Control Principles

    Directory of Open Access Journals (Sweden)

    Jan Vittek

    2004-01-01

    Full Text Available Closed-loop position control of mechanisms directly driven by linear synchronous motors with permanent magnets is presented. The control strategy is based on forced dynamic control, which is a form of feedback linearisation, yielding a non-liner multivariable control law to obtain a prescribed linear speed dynamics together with the vector control condition of mutal orthogonality between the stator current and magnetic flux vectors (assuming perfect estimates of the plant parameters. Outer position control loop is closed via simple feedback with proportional gain. Simulations of the design control sysstem, including the drive with power electronic switching, predict the intended drive performance.

  3. Mover Position Detection for PMTLM Based on Linear Hall Sensors through EKF Processing.

    Science.gov (United States)

    Yan, Leyang; Zhang, Hui; Ye, Peiqing

    2017-04-06

    Accurate mover position is vital for a permanent magnet tubular linear motor (PMTLM) control system. In this paper, two linear Hall sensors are utilized to detect the mover position. However, Hall sensor signals contain third-order harmonics, creating errors in mover position detection. To filter out the third-order harmonics, a signal processing method based on the extended Kalman filter (EKF) is presented. The limitation of conventional processing method is first analyzed, and then EKF is adopted to detect the mover position. In the EKF model, the amplitude of the fundamental component and the percentage of the harmonic component are taken as state variables, and they can be estimated based solely on the measured sensor signals. Then, the harmonic component can be calculated and eliminated. The proposed method has the advantages of faster convergence, better stability and higher accuracy. Finally, experimental results validate the effectiveness and superiority of the proposed method.

  4. Linearization of Positional Response Curve of a Fiber-optic Displacement Sensor

    Science.gov (United States)

    Babaev, O. G.; Matyunin, S. A.; Paranin, V. D.

    2018-01-01

    Currently, the creation of optical measuring instruments and sensors for measuring linear displacement is one of the most relevant problems in the area of instrumentation. Fiber-optic contactless sensors based on the magneto-optical effect are of special interest. They are essentially contactless, non-electrical and have a closed optical channel not subject to contamination. The main problem of this type of sensors is the non-linearity of their positional response curve due to the hyperbolic nature of the magnetic field intensity variation induced by moving the magnetic source mounted on the controlled object relative to the sensing element. This paper discusses an algorithmic method of linearizing the positional response curve of fiber-optic displacement sensors in any selected range of the displacements to be measured. The method is divided into two stages: 1 - definition of the calibration function, 2 - measurement and linearization of the positional response curve (including its temperature stabilization). The algorithm under consideration significantly reduces the number of points of the calibration function, which is essential for the calibration of temperature dependence, due to the use of the points that randomly deviate from the grid points with uniform spacing. Subsequent interpolation of the deviating points and piecewise linear-plane approximation of the calibration function reduces the microcontroller storage capacity for storing the calibration function and the time required to process the measurement results. The paper also presents experimental results of testing real samples of fiber-optic displacement sensors.

  5. Correction of X-ray diffraction profiles in linear-type PSPC by position factor

    International Nuclear Information System (INIS)

    Takahashi, Toshio

    1992-01-01

    PSPC (Position Sensitive Proportional Counter) makes it possible to obtain one-dimentional diffraction profiles without mechanical scanning. In a linear-type PSPC, the obtained profiles need correcting, because the position factor influences the intensity of the diffracted X-ray beam and the counting rate at each position on PSPC. The distances from the specimen are not the same at the center and at the edge of the detector, and the intensity decreases at the edge because of radiation and absorption. The counting rate varies with the incident angle of the diffracted beam at each position on PSPC. The position factor f i at channel i of the multichannel-analyser is given by f i = cos 4 α i ·exp{-μR(1/cosα i -1)} where R is the distance between the specimen and the center of PSPC, μ is the linear absorption coefficient and α i is the incident angle of the diffracted beam at channel i. The background profiles of silica gel powder were measured with CrKα and CuKα. The parameters of the model function were fitted to the profiles by the non-linear least squares method. The agreement between these parameters and the calculated values shows that the position factor can correct the measured profiles properly. (author)

  6. Approximation of functions in two variables by some linear positive operators

    Directory of Open Access Journals (Sweden)

    Mariola Skorupka

    1995-12-01

    Full Text Available We introduce some linear positive operators of the Szasz-Mirakjan type in the weighted spaces of continuous functions in two variables. We study the degree of the approximation of functions by these operators. The similar results for functions in one variable are given in [5]. Some operators of the Szasz-Mirakjan type are examined also in [3], [4].

  7. Predictive IP controller for robust position control of linear servo system.

    Science.gov (United States)

    Lu, Shaowu; Zhou, Fengxing; Ma, Yajie; Tang, Xiaoqi

    2016-07-01

    Position control is a typical application of linear servo system. In this paper, to reduce the system overshoot, an integral plus proportional (IP) controller is used in the position control implementation. To further improve the control performance, a gain-tuning IP controller based on a generalized predictive control (GPC) law is proposed. Firstly, to represent the dynamics of the position loop, a second-order linear model is used and its model parameters are estimated on-line by using a recursive least squares method. Secondly, based on the GPC law, an optimal control sequence is obtained by using receding horizon, then directly supplies the IP controller with the corresponding control parameters in the real operations. Finally, simulation and experimental results are presented to show the efficiency of proposed scheme. Copyright © 2016 ISA. Published by Elsevier Ltd. All rights reserved.

  8. Chemical networks with inflows and outflows: a positive linear differential inclusions approach.

    Science.gov (United States)

    Angeli, David; De Leenheer, Patrick; Sontag, Eduardo D

    2009-01-01

    Certain mass-action kinetics models of biochemical reaction networks, although described by nonlinear differential equations, may be partially viewed as state-dependent linear time-varying systems, which in turn may be modeled by convex compact valued positive linear differential inclusions. A result is provided on asymptotic stability of such inclusions, and applied to a ubiquitous biochemical reaction network with inflows and outflows, known as the futile cycle. We also provide a characterization of exponential stability of general homogeneous switched systems which is not only of interest in itself, but also plays a role in the analysis of the futile cycle. 2009 American Institute of Chemical Engineers

  9. Positivity and job burnout in emergency personnel: examining linear and curvilinear relationship

    Directory of Open Access Journals (Sweden)

    Basińska Beata Aleksandra

    2017-06-01

    Full Text Available The aim of this study was to examine whether the relationship between the ratio of job-related positive to negative emotions (positivity ratio and job burnout is best described as linear or curvilinear. Participants were 89 police officers (12% women and 86 firefighters. The positivity ratio was evaluated using the Job-related Affective Wellbeing Scale (Van Katwyk, Fox, Spector, & Kelloway, 2000. Exhaustion and disengagement, two components of job burnout, were measured using the Oldenburg Burnout Inventory (Demerouti, Mostert, & Bakker, 2010. The results of regression analysis revealed that curvilinear relationships between the positivity ratio and two components of job burnout appeared to better fit the data than linear relationships. The relationship between the positivity ratio and exhaustion was curvilinear with a curve point at around 2.1. A similar curvilinear relationship, but with a lower curve point, i.e., around 1.8, was observed for disengagement. It seems that beyond certain values there may be hidden costs of maintaining positive emotions at work. Also, the unequal curve points for subscales suggest that different dimensions of work-related functioning are variously prone to such costs.

  10. Wireless Positioning Based on a Segment-Wise Linear Approach for Modeling the Target Trajectory

    DEFF Research Database (Denmark)

    Figueiras, Joao; Pedersen, Troels; Schwefel, Hans-Peter

    2008-01-01

    Positioning solutions in infrastructure-based wireless networks generally operate by exploiting the channel information of the links between the Wireless Devices and fixed networking Access Points. The major challenge of such solutions is the modeling of both the noise properties of the channel...... measurements and the user mobility patterns. One class of typical human being movement patterns is the segment-wise linear approach, which is studied in this paper. Current tracking solutions, such as the Constant Velocity model, hardly handle such segment-wise linear patterns. In this paper we propose...... a segment-wise linear model, called the Drifting Points model. The model results in an increased performance when compared with traditional solutions....

  11. Approximation Theorems for q- Analouge of a Linear Positive Operator by A. Lupas

    Directory of Open Access Journals (Sweden)

    Karunesh Kumar Singh

    2016-08-01

    Full Text Available The purpose of the present paper is to introduce $q-$ analouge of a sequence of linear and positive operators which was introduced by A. Lupas [2]. First, we estimate moments of the operators and then prove a basic convergence theorem. Next, a local direct approximation theorem is established. Further, we study the rate of convergence and point-wise estimate using the Lipschitz type maximal function.

  12. The linear variable differential transformer (LVDT) position sensor for gravitational wave interferometer low-frequency controls

    Energy Technology Data Exchange (ETDEWEB)

    Tariq, Hareem E-mail: htariq@ligo.caltech.edu; Takamori, Akiteru; Vetrano, Flavio; Wang Chenyang; Bertolini, Alessandro; Calamai, Giovanni; DeSalvo, Riccardo; Gennai, Alberto; Holloway, Lee; Losurdo, Giovanni; Marka, Szabolcs; Mazzoni, Massimo; Paoletti, Federico; Passuello, Diego; Sannibale, Virginio; Stanga, Ruggero

    2002-08-21

    Low-power, ultra-high-vacuum compatible, non-contacting position sensors with nanometer resolution and centimeter dynamic range have been developed, built and tested. They have been designed at Virgo as the sensors for low-frequency modal damping of Seismic Attenuation System chains in Gravitational Wave interferometers and sub-micron absolute mirror positioning. One type of these linear variable differential transformers (LVDTs) has been designed to be also insensitive to transversal displacement thus allowing 3D movement of the sensor head while still precisely reading its position along the sensitivity axis. A second LVDT geometry has been designed to measure the displacement of the vertical seismic attenuation filters from their nominal position. Unlike the commercial LVDTs, mostly based on magnetic cores, the LVDTs described here exert no force on the measured structure.

  13. Asynchronous L1-gain control of uncertain switched positive linear systems with dwell time.

    Science.gov (United States)

    Li, Yang; Zhang, Hongbin

    2018-04-01

    In this paper, dwell time (DT) stability, L 1 -gain performance analysis and asynchronous L 1 -gain controller design problems of uncertain switched positive linear systems (SPLSs) are investigated. Via a time-scheduled multiple linear co-positive Lyapunov function (TSMLCLF) approach, convex sufficient conditions of DT stability and L 1 -gain performance of SPLSs with interval and polytopic uncertainties are presented. Furthermore, by utilizing the feature that the TSMLCLF keeps decreasing even if the controller is running asynchronously with the system, the asynchronous L 1 -gain controller design problem of SPLSs with interval and polytopic uncertainties is investigated. Convex sufficient conditions of the existence of time-varying asynchronous state-feedback controller which can ensure the closed-loop system's positivity, stability and L 1 -gain performance are established, and the controller gain matrices can be calculated instantaneously online. The obtained L 1 -gain in the paper is standard. All the results are presented in terms of linear programming. A practical example is provided to show the effectiveness of the results. Copyright © 2018 ISA. Published by Elsevier Ltd. All rights reserved.

  14. Effects of socioeconomic position and social mobility on linear growth from early childhood until adolescence

    Directory of Open Access Journals (Sweden)

    Ana Paula Muraro

    Full Text Available ABSTRACT: Objective: To assess the effect of socioeconomic position (SEP in childhood and social mobility on linear growth through adolescence in a population-based cohort. Methods: Children born in Cuiabá-MT, central-western Brazil, were evaluated during 1994 - 1999. They were first assessed during 1999 - 2000 (0 - 5 years and again during 2009 - 2011 (10 - 17 years, and their height-for-age was evaluated during these two periods.Awealth index was used to classify the SEP of each child’s family as low, medium, or high. Social mobility was categorized as upward mobility or no upward mobility. Linear mixed models were used. Results: We evaluated 1,716 children (71.4% of baseline after 10 years, and 60.6% of the families showed upward mobility, with a higher percentage among the lowest economic classes. A higher height-for-age was also observed among those from families with a high SEP both in childhood (low SEP= -0.35 z-score; high SEP= 0.15 z-score, p < 0.01 and adolescence (low SEP= -0.01 z-score; high SEP= 0.45 z-score, p < 0.01, whereas upward mobility did not affect their linear growth. Conclusion: Expressive social mobility was observed, but SEP in childhood and social mobility did not greatly influence linear growth through childhood in this central-western Brazilian cohort.

  15. Solar receiver heliostat reflector having a linear drive and position information system

    Science.gov (United States)

    Horton, Richard H.

    1980-01-01

    A heliostat for a solar receiver system comprises an improved drive and control system for the heliostat reflector assembly. The heliostat reflector assembly is controllably driven in a predetermined way by a light-weight drive system so as to be angularly adjustable in both elevation and azimuth to track the sun and efficiently continuously reflect the sun's rays to a focal zone, i.e., heat receiver, which forms part of a solar energy utilization system, such as a solar energy fueled electrical power generation system. The improved drive system includes linear stepping motors which comprise low weight, low cost, electronic pulse driven components. One embodiment comprises linear stepping motors controlled by a programmed, electronic microprocessor. Another embodiment comprises a tape driven system controlled by a position control magnetic tape.

  16. Subcellular localization for Gram positive and Gram negative bacterial proteins using linear interpolation smoothing model.

    Science.gov (United States)

    Saini, Harsh; Raicar, Gaurav; Dehzangi, Abdollah; Lal, Sunil; Sharma, Alok

    2015-12-07

    Protein subcellular localization is an important topic in proteomics since it is related to a protein׳s overall function, helps in the understanding of metabolic pathways, and in drug design and discovery. In this paper, a basic approximation technique from natural language processing called the linear interpolation smoothing model is applied for predicting protein subcellular localizations. The proposed approach extracts features from syntactical information in protein sequences to build probabilistic profiles using dependency models, which are used in linear interpolation to determine how likely is a sequence to belong to a particular subcellular location. This technique builds a statistical model based on maximum likelihood. It is able to deal effectively with high dimensionality that hinders other traditional classifiers such as Support Vector Machines or k-Nearest Neighbours without sacrificing performance. This approach has been evaluated by predicting subcellular localizations of Gram positive and Gram negative bacterial proteins. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. An adaptive feedback controller for transverse angle and position jitter correction in linear particle beam accelerators

    International Nuclear Information System (INIS)

    Barr, D.S.

    1993-01-01

    It is desired to design a position and angle jitter control system for pulsed linear accelerators that will increase the accuracy of correction over that achieved by currently used standard feedback jitter control systems. Interpulse or pulse-to-pulse correction is performed using the average value of each macropulse. The configuration of such a system resembles that of a standard feedback correction system with the addition of an adaptive controller that dynamically adjusts the gain-phase contour of the feedback electronics. The adaptive controller makes changes to the analog feedback system between macropulses. A simulation of such a system using real measured jitter data from the Stanford Linear Collider was shown to decrease the average rms jitter by over two and a half times. The system also increased and stabilized the correction at high frequencies; a typical problem with standard feedback systems

  18. An adaptive feedback controller for transverse angle and position jitter correction in linear particle beam accelerators

    International Nuclear Information System (INIS)

    Barr, D.S.

    1992-01-01

    It is desired to design a position and angle jitter control system for pulsed linear accelerators that will increase the accuracy of correction over that achieved by currently used standard feedback jitter control systems. Interpulse or pulse-to-pulse correction is performed using the average value of each macropulse. The configuration of such a system resembles that of a standard feedback correction system with the addition of an adaptive controller that dynamically adjusts the gain-phase contour of the feedback electronics. The adaptive controller makes changes to the analog feedback system between macropulses. A simulation of such a system using real measured jitter data from the Stanford Linear Collider was shown to decrease the average rms jitter by over two and a half times. The system also increased and stabilized the correction at high frequencies; a typical problem with standard feedback systems

  19. Position and out-of-straightness measurement of a precision linear air-bearing stage by using a two-degree-of-freedom linear encoder

    International Nuclear Information System (INIS)

    Kimura, Akihide; Gao, Wei; Lijiang, Zeng

    2010-01-01

    This paper presents measurement of the X-directional position and the Z-directional out-of-straightness of a precision linear air-bearing stage with a two-degree-of-freedom (two-DOF) linear encoder, which is an optical displacement sensor for simultaneous measurement of the two-DOF displacements. The two-DOF linear encoder is composed of a reflective-type one-axis scale grating and an optical sensor head. A reference grating is placed perpendicular to the scale grating in the optical sensor head. Two-DOF displacements can be obtained from interference signals generated by the ±1 order diffracted beams from two gratings. A prototype two-DOF linear encoder employing the scale grating with the grating period of approximately 1.67 µm measured the X-directional position and the Z-directional out-of-straightness of the linear air-bearing stage

  20. Sliding-Mode Observer for Speed and Position Sensorless Control of Linear-PMSM

    Directory of Open Access Journals (Sweden)

    Kazraji Saeed Masoumi

    2014-05-01

    Full Text Available The paper presents a sliding-mode observer that utilizes sigmoid function for speed and position sensorless control of permanent-magnet linear synchronous motor (PMLSM. In conventional sliding mode observer method there are the chattering phenomenon and the phase lag. Thus, in order to avoid the usage of the low pass filter and the phase compensator based on back EMF, in this paper a sliding mode observer with sigmoid function for detecting the back EMF in a PMLSM is designed to estimate the speed and the position of the rotor. Most of conventional sliding mode observers use sign or saturation functions which need low pass filter in order to detect back electromotive force (back EMF. In this paper a sigmoid function is used instead of discontinuous sign function to decrease undesirable chattering phenomenon. By reducing the chattering, detecting of the back EMF can be made directly from switching signal without any low pass filter. Thus the delay time in the proposed observer is eliminated because of the low pass filter. Furthermore, there is no need to compensate phase fault in position and speed estimating of linear-PMSM. Advantages of the proposed observer have been shown by simulation with MATLAB software.

  1. Long bunch trains measured using a prototype cavity beam position monitor for the Compact Linear Collider

    Directory of Open Access Journals (Sweden)

    F. J. Cullinan

    2015-11-01

    Full Text Available The Compact Linear Collider (CLIC requires beam position monitors (BPMs with 50 nm spatial resolution for alignment of the beam line elements in the main linac and beam delivery system. Furthermore, the BPMs must be able to make multiple independent measurements within a single 156 ns long bunch train. A prototype cavity BPM for CLIC has been manufactured and tested on the probe beam line at the 3rd CLIC Test Facility (CTF3 at CERN. The transverse beam position is determined from the electromagnetic resonant modes excited by the beam in the two cavities of the pickup, the position cavity and the reference cavity. The mode that is measured in each cavity resonates at 15 GHz and has a loaded quality factor that is below 200. Analytical expressions for the amplitude, phase and total energy of signals from long trains of bunches have been derived and the main conclusions are discussed. The results of the beam tests are presented. The variable gain of the receiver electronics has been characterized using beam excited signals and the form of the signals for different beam pulse lengths with the 2/3  ns bunch spacing has been observed. The sensitivity of the reference cavity signal to charge and the horizontal position signal to beam offset have been measured and are compared with theoretical predictions based on laboratory measurements of the BPM pickup and the form of the resonant cavity modes as determined by numerical simulation. Finally, the BPM was calibrated so that the beam position jitter at the BPM location could be measured. It is expected that the beam jitter scales linearly with the beam size and so the results are compared to predicted values for the latter.

  2. Long bunch trains measured using a prototype cavity beam position monitor for the Compact Linear Collider

    Science.gov (United States)

    Cullinan, F. J.; Boogert, S. T.; Farabolini, W.; Lefevre, T.; Lunin, A.; Lyapin, A.; Søby, L.; Towler, J.; Wendt, M.

    2015-11-01

    The Compact Linear Collider (CLIC) requires beam position monitors (BPMs) with 50 nm spatial resolution for alignment of the beam line elements in the main linac and beam delivery system. Furthermore, the BPMs must be able to make multiple independent measurements within a single 156 ns long bunch train. A prototype cavity BPM for CLIC has been manufactured and tested on the probe beam line at the 3rd CLIC Test Facility (CTF3) at CERN. The transverse beam position is determined from the electromagnetic resonant modes excited by the beam in the two cavities of the pickup, the position cavity and the reference cavity. The mode that is measured in each cavity resonates at 15 GHz and has a loaded quality factor that is below 200. Analytical expressions for the amplitude, phase and total energy of signals from long trains of bunches have been derived and the main conclusions are discussed. The results of the beam tests are presented. The variable gain of the receiver electronics has been characterized using beam excited signals and the form of the signals for different beam pulse lengths with the 2 /3 ns bunch spacing has been observed. The sensitivity of the reference cavity signal to charge and the horizontal position signal to beam offset have been measured and are compared with theoretical predictions based on laboratory measurements of the BPM pickup and the form of the resonant cavity modes as determined by numerical simulation. Finally, the BPM was calibrated so that the beam position jitter at the BPM location could be measured. It is expected that the beam jitter scales linearly with the beam size and so the results are compared to predicted values for the latter.

  3. Characterization and linear array LA48 Commissioner for measuring the position of the multi leaf collimator

    International Nuclear Information System (INIS)

    Conles Picos, I.; Cenizo de Castro, E.; Aparicio martin, A. R.; Barrio Lazo, F.; Cesteros Morante, M. J.

    2011-01-01

    The protocol of Quality Control of electron accelerators for medical use of SEFM proposed for multi leaf collimation system (MLC) to verify the positioning of the blades connect. To do this you must find a system with sufficient accuracy and precision and, if possible, easy to assemble and offers real-time results. One of these teams is the Linear Array of PTW-Freiburg (LA48), which consists of a row of 47 ionization chambers, of 0008 cc and 8 mm apart from each other. In this paper, we describe our process of characterization and LA48 commissioner. (Author)

  4. Minimum Energy Control of 2D Positive Continuous-Discrete Linear Systems

    Directory of Open Access Journals (Sweden)

    Kaczorek Tadeusz

    2014-09-01

    Full Text Available The minimum energy control problem for the 2D positive continuous-discrete linear systems is formulated and solved. Necessary and sufficient conditions for the reachability at the point of the systems are given. Sufficient conditions for the existence of solution to the problem are established. It is shown that if the system is reachable then there exists an optimal input that steers the state from zero boundary conditions to given final state and minimizing the performance index for only one step (q = 1. A procedure for solving of the problem is proposed and illustrated by a numerical example.

  5. The development of an algebraic multigrid algorithm for symmetric positive definite linear systems

    Energy Technology Data Exchange (ETDEWEB)

    Vanek, P.; Mandel, J.; Brezina, M. [Univ. of Colorado, Denver, CO (United States)

    1996-12-31

    An algebraic multigrid algorithm for symmetric, positive definite linear systems is developed based on the concept of prolongation by smoothed aggregation. Coarse levels are generated automatically. We present a set of requirements motivated heuristically by a convergence theory. The algorithm then attempts to satisfy the requirements. Input to the method are the coefficient matrix and zero energy modes, which are determined from nodal coordinates and knowledge of the differential equation. Efficiency of the resulting algorithm is demonstrated by computational results on real world problems from solid elasticity, plate blending, and shells.

  6. The Validity and Reliability of the Gymaware Linear Position Transducer for Measuring Counter-Movement Jump Performance in Female Athletes

    Science.gov (United States)

    O'Donnell, Shannon; Tavares, Francisco; McMaster, Daniel; Chambers, Samuel; Driller, Matthew

    2018-01-01

    The current study aimed to assess the validity and test-retest reliability of a linear position transducer when compared to a force plate through a counter-movement jump in female participants. Twenty-seven female recreational athletes (19 ± 2 years) performed three counter-movement jumps simultaneously using the linear position transducer and…

  7. Characterization of the order relation on the set of completely n-positive linear maps between C*-algebras

    Directory of Open Access Journals (Sweden)

    Maria Joita

    2007-12-01

    Full Text Available In this paper we characterize the order relation on the set of all nondegenerate completely n-positive linear maps between C*-algebras in terms of a self-dual Hilbert module induced by each completely n-positive linear map.

  8. Influence of a high vacuum on the precise positioning using an ultrasonic linear motor.

    Science.gov (United States)

    Kim, Wan-Soo; Lee, Dong-Jin; Lee, Sun-Kyu

    2011-01-01

    This paper presents an investigation of the ultrasonic linear motor stage for use in a high vacuum environment. The slider table is driven by the hybrid bolt-clamped Langevin-type ultrasonic linear motor, which is excited with its different modes of natural frequencies in both lateral and longitudinal directions. In general, the friction behavior in a vacuum environment becomes different from that in an environment of atmospheric pressure and this difference significantly affects the performance of the ultrasonic linear motor. In this paper, to consistently provide stable and high power of output in a high vacuum, frequency matching was conducted. Moreover, to achieve the fine control performance in the vacuum environment, a modified nominal characteristic trajectory following control method was adopted. Finally, the stage was operated under high vacuum condition, and the operating performances were investigated compared with that of a conventional PI compensator. As a result, robustness of positioning was accomplished in a high vacuum condition with nanometer-level accuracy.

  9. Influence of a high vacuum on the precise positioning using an ultrasonic linear motor

    International Nuclear Information System (INIS)

    Kim, Wan-Soo; Lee, Dong-Jin; Lee, Sun-Kyu

    2011-01-01

    This paper presents an investigation of the ultrasonic linear motor stage for use in a high vacuum environment. The slider table is driven by the hybrid bolt-clamped Langevin-type ultrasonic linear motor, which is excited with its different modes of natural frequencies in both lateral and longitudinal directions. In general, the friction behavior in a vacuum environment becomes different from that in an environment of atmospheric pressure and this difference significantly affects the performance of the ultrasonic linear motor. In this paper, to consistently provide stable and high power of output in a high vacuum, frequency matching was conducted. Moreover, to achieve the fine control performance in the vacuum environment, a modified nominal characteristic trajectory following control method was adopted. Finally, the stage was operated under high vacuum condition, and the operating performances were investigated compared with that of a conventional PI compensator. As a result, robustness of positioning was accomplished in a high vacuum condition with nanometer-level accuracy.

  10. Effects of socioeconomic position and social mobility on linear growth from early childhood until adolescence.

    Science.gov (United States)

    Muraro, Ana Paula; Souza, Rita Adriana Gomes de; Rodrigues, Paulo Rogério Melo; Ferreira, Márcia Gonçalves; Sichieri, Rosely

    2017-01-01

    To assess the effect of socioeconomic position (SEP) in childhood and social mobility on linear growth through adolescence in a population-based cohort. Children born in Cuiabá-MT, central-western Brazil, were evaluated during 1994 - 1999. They were first assessed during 1999 - 2000 (0 - 5 years) and again during 2009 - 2011 (10 - 17 years), and their height-for-age was evaluated during these two periods.Awealth index was used to classify the SEP of each child's family as low, medium, or high. Social mobility was categorized as upward mobility or no upward mobility. Linear mixed models were used. We evaluated 1,716 children (71.4% of baseline) after 10 years, and 60.6% of the families showed upward mobility, with a higher percentage among the lowest economic classes. A higher height-for-age was also observed among those from families with a high SEP both in childhood (low SEP= -0.35 z-score; high SEP= 0.15 z-score, p childhood and social mobility did not greatly influence linear growth through childhood in this central-western Brazilian cohort.

  11. A 3D Printed Linear Pneumatic Actuator for Position, Force and Impedance Control

    Directory of Open Access Journals (Sweden)

    Jeremy Krause

    2018-05-01

    Full Text Available Although 3D printing has the potential to provide greater customization and to reduce the costs of creating actuators for industrial applications, the 3D printing of actuators is still a relatively new concept. We have developed a pneumatic actuator with 3D-printed parts and placed sensors for position and force control. So far, 3D printing has been used to create pneumatic actuators of the bellows type, thus having a limited travel distance, utilizing low pressures for actuation and being capable of only limited force production and response rates. In contrast, our actuator is linear with a large travel distance and operating at a relatively higher pressure, thus providing great forces and response rates, and this the main novelty of the work. We demonstrate solutions to key challenges that arise during the design and fabrication of 3D-printed linear actuators. These include: (1 the strategic use of metallic parts in high stress areas (i.e., the piston rod; (2 post-processing of the inner surface of the cylinder for smooth finish; (3 piston head design and seal placement for strong and leak-proof action; and (4 sensor choice and placement for position and force control. A permanent magnet placed in the piston head is detected using Hall effect sensors placed along the length of the cylinder to measure the position, and pressure sensors placed at the supply ports were used for force measurement. We demonstrate the actuator performing position, force and impedance control. Our work has the potential to open new avenues for creating less expensive, customizable and capable actuators for industrial and other applications.

  12. Development of an ultrasonic linear motor with ultra-positioning capability and four driving feet.

    Science.gov (United States)

    Zhu, Cong; Chu, Xiangcheng; Yuan, Songmei; Zhong, Zuojin; Zhao, Yanqiang; Gao, Shuning

    2016-12-01

    This paper presents a novel linear piezoelectric motor which is suitable for rapid ultra-precision positioning. The finite element analysis (FEA) was applied for optimal design and further analysis, then experiments were conducted to investigate its performance. By changing the input signal, the proposed motor was found capable of working in the fast driving mode as well as in the precision positioning mode. When working in the fast driving mode, the motor acts as an ultrasonic motor with maximum no-load speed up to 181.2mm/s and maximum thrust of 1.7N at 200Vp-p. Also, when working in precision positioning mode, the motor can be regarded as a flexible hinge piezoelectric actuator with arbitrary motion in the range of 8μm. The measurable minimum output displacement was found to be 0.08μm, but theoretically, can be even smaller. More importantly, the motor can be quickly and accurately positioned in a large stroke. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. Markov Jump Linear Systems-Based Position Estimation for Lower Limb Exoskeletons

    Directory of Open Access Journals (Sweden)

    Samuel L. Nogueira

    2014-01-01

    Full Text Available In this paper, we deal with Markov Jump Linear Systems-based filtering applied to robotic rehabilitation. The angular positions of an impedance-controlled exoskeleton, designed to help stroke and spinal cord injured patients during walking rehabilitation, are estimated. Standard position estimate approaches adopt Kalman filters (KF to improve the performance of inertial measurement units (IMUs based on individual link configurations. Consequently, for a multi-body system, like a lower limb exoskeleton, the inertial measurements of one link (e.g., the shank are not taken into account in other link position estimation (e.g., the foot. In this paper, we propose a collective modeling of all inertial sensors attached to the exoskeleton, combining them in a Markovian estimation model in order to get the best information from each sensor. In order to demonstrate the effectiveness of our approach, simulation results regarding a set of human footsteps, with four IMUs and three encoders attached to the lower limb exoskeleton, are presented. A comparative study between the Markovian estimation system and the standard one is performed considering a wide range of parametric uncertainties.

  14. Definition of a reference metrology network for the positioning of a large linear accelerator

    International Nuclear Information System (INIS)

    Becker, F.

    2003-12-01

    This thesis is a study of the Compact Linear Collider (CLIC) alignment system, a project of linear accelerator of about 30 km long of the European Organization for Nuclear Research (CERN). The pre-alignment tolerance on the transverse positions of the components of the CLIC linacs is typically ten microns over distances of 200 m. This research is a consequence of 10 years work, where several sets of special sensors dedicated to metrology have been adapted for the CLIC project. Most of these sensors deliver measurements linked to geometric references sensitive to gravity fluctuation. An important part of this work is therefore dedicated to study the gravity disruptions as a high level of accuracy is required. The parameters to take into account in the use of the hydrostatic leveling have thus been highlighted. A proposal of configuration of the system alignment based on a selection of sensors has also been given in this research. Computer models of different possible configurations have been presented. As the existing computing software was inappropriate, a new object oriented software package has been developed, to ensure future upgrades. An optimized configuration of the network has been defined from a set of simulations. Finally, due to problems in the use of hydrostatic leveling systems, a solution based on the use of a long laser beam as an alternative solution is discussed. (author)

  15. An Automated Magnet Positioning System For Use in the Next Linear Collider

    International Nuclear Information System (INIS)

    Viola, Robert J.

    2006-01-01

    The Next Linear Collider (NLC) is conceived as the world's most powerful electron-positron particle accelerator. Throughout the NLC, the beam itself will be used to measure errors in the positions of the lattice elements. This beam-based alignment strategy is an essential element of the NLC's design and precision adjustment systems have been identified as a critical enabling technology. Square One proposes a new type of precision manipulator that could be adapted for applications throughout the accelerator. As envisioned, this ''Tri-Sphere'' Adjustment System will possess up to six, non-redundant degrees of freedom, be capable of sub-micron resolutions and have ultimate load capacities in excess of 10,000 kg. The system will accommodate thermal expansions and contractions of the objects being supported and can be either motorized or manually actuated. Phase I development tasks will include detailed manipulator design, solution of the associated kinematic equations of motion and evaluation of actuators, gear reducers and transmission systems. The Phase I effort will culminate in the fabrication and full evaluation of a system prototype. A successfully developed Tri-Sphere manipulator could also be used to actively position critical fusion optics, adjust communication dishes or perform parts handling tasks in harsh manufacturing environments

  16. Data acquisition system for linear position sensitive detector based neutron diffractometer

    International Nuclear Information System (INIS)

    Pande, S.S.; Borkar, S.P.; Behere, A.; Prafulla, S.; Srivastava, V.D.; Mukhopadhyaya, P.K.; Ghodgaonkar, M.D.; Kataria, S.K.

    2003-03-01

    This data acquisition system is developed to serve the requirements of various linear 1PSD based neutron diffractometers. A neutron diffractometer uses a neutron beam as a probe to study the crystallographic properties of materials. Presently two multi-PSD and two single-PSD diffractometers are commissioned and a few more are being installed in Dhruva. This data acquisition system is installed at each of these - diffractometers. Different requirements of individual diffractometers were studied and reconciled to design a single data acquisition system, which can be easily configured or customized for individual setups. The charge division in a linear PSD is converted to a position output with the help of an RDC (Ratio ADC). The ftont-end electronics, which consist of preamplifiers and shaping amplifiers, provide an interface between a PSD and an RDC. A PC add-on card is designed around a Transputer. It can interface 16 RDCs, a few motor controls and on/off controls. Data acquisition and other controls are implemented in the Transputer program. A front-end Windows98 application merges the raw data of different RDCs to obtain the equiangular data. Through software the data acquisition system can be configured for diffetent diffractometers. Commercially available hardware is also integrated as,a part of the data acquisition system in some of the setups. The data acquisition system is working reliably as a part of two single PSD and two multi-PSD diffractometers. It can handle data rates upto 15 K/Sec without any loss of counts. It has played a significant role in providing improved throughput and utilization ofvarious diffractometers. The'data acquisition system and its different applications are presented in this report. (author)

  17. Positive solution of non-square fully Fuzzy linear system of equation in general form using least square method

    Directory of Open Access Journals (Sweden)

    Reza Ezzati

    2014-08-01

    Full Text Available In this paper, we propose the least square method for computing the positive solution of a non-square fully fuzzy linear system. To this end, we use Kaffman' arithmetic operations on fuzzy numbers \\cite{17}. Here, considered existence of exact solution using pseudoinverse, if they are not satisfy in positive solution condition, we will compute fuzzy vector core and then we will obtain right and left spreads of positive fuzzy vector by introducing constrained least squares problem. Using our proposed method, non-square fully fuzzy linear system of equations always has a solution. Finally, we illustrate the efficiency of proposed method by solving some numerical examples.

  18. Structure-activity relationships of the melanocortin tetrapeptide Ac-His-DPhe-Arg-Trp-NH(2) at the mouse melanocortin receptors: part 2 modifications at the Phe position.

    Science.gov (United States)

    Holder, Jerry Ryan; Bauzo, Rayna M; Xiang, Zhimin; Haskell-Luevano, Carrie

    2002-07-04

    The melanocortin pathway is an important participant in skin pigmentation, steroidogenesis, obesity, energy homeostasis and exocrine gland function. The centrally located melanocortin-3 and melanocortin-4 receptors (MC3R, MC4R) are involved in the metabolic and food intake aspects of energy homeostasis and are stimulated by melanocortin agonists such as alpha-melanocyte stimulation hormone (alpha-MSH). The melanocortin agonists contain the putative message sequence "His-Phe-Arg-Trp," and it has been well-documented that inversion of chirality of the Phe to DPhe results in a dramatic increase in melanocortin receptor potency. Herein, we report a tetrapeptide library, based upon the template Ac-His-DPhe-Arg-Trp-NH(2), consisting of 26 members that have been modified at the DPhe(7) position (alpha-MSH numbering) and pharmacologically characterized for agonist and antagonist activity at the mouse melanocortin receptors MC1R, MC3R, MC4R, and MC5R. The most notable results of this study include the identification of the tetrapeptide Ac-His-(pI)DPhe-Arg-Trp-NH(2) that is a full nanomolar agonist at the mMC1 and mMC5 receptors, a mMC3R partial agonist with potent antagonist activity (pA(2) = 7.25, K(i) = 56 nM) and, but unexpectedly, is a potent agonist at the mMC4R (EC(50) = 25 nM). This ligand possesses novel melanocortin receptor pharmacology, as compared to previously reported peptides, and is potentially useful for in vivo studies to differentiate MC3R vs MC4R physiological roles in animal models, such as primates, where "knockout" animals are not viable options. The DNal(2') substitution for DPhe resulted in a mMC3R partial agonist with antagonist activity (pA(2) = 6.5, K(i) = 295 nM) and a mMC4R (pA(2) = 7.8, K(i) = 17 nM) antagonist possessing 60- and 425-fold decreased potency, respectively, as compared with SHU9119 at these receptors. Examination of this DNal(2')-containing tetrapeptide at the F254S and F259S mutant mMC4Rs resulted in agonist activity of this m

  19. Kalman filter with a linear state model for PDR+WLAN positioning and its application to assisting a particle filter

    Science.gov (United States)

    Raitoharju, Matti; Nurminen, Henri; Piché, Robert

    2015-12-01

    Indoor positioning based on wireless local area network (WLAN) signals is often enhanced using pedestrian dead reckoning (PDR) based on an inertial measurement unit. The state evolution model in PDR is usually nonlinear. We present a new linear state evolution model for PDR. In simulated-data and real-data tests of tightly coupled WLAN-PDR positioning, the positioning accuracy with this linear model is better than with the traditional models when the initial heading is not known, which is a common situation. The proposed method is computationally light and is also suitable for smoothing. Furthermore, we present modifications to WLAN positioning based on Gaussian coverage areas and show how a Kalman filter using the proposed model can be used for integrity monitoring and (re)initialization of a particle filter.

  20. Structure-activity relationships of the melanocortin tetrapeptide Ac-His-DPhe-Arg-Trp-NH(2) at the mouse melanocortin receptors. 1. Modifications at the His position.

    Science.gov (United States)

    Holder, Jerry Ryan; Bauzo, Rayna M; Xiang, Zhimin; Haskell-Luevano, Carrie

    2002-06-20

    The melanocortin pathway is an important participant in obesity and energy homeostasis. The centrally located melanocortin-3 and melanocortin-4 receptors (MC3R, MC4R) are involved in the metabolic and food intake aspects of energy homeostasis and are stimulated by melanocortin agonists such as alpha-melanocyte stimulation hormone (alpha-MSH). The melanocortin agonists contain the putative message sequence "His-Phe-Arg-Trp", and it has been well documented that inversion of chirality of the Phe to DPhe results in a dramatic increase in melanocortin receptor potency. Herein, we report a tetrapeptide library based on the template Ac-His-DPhe-Arg-Trp-NH(2), consisting of 17 members that have been modified at the His(6) position (alpha-MSH numbering) and pharmacologically characterized for agonist activity at the mouse melanocortin receptors MC1R, MC3R, MC4R, and MC5R. These studies provide further experimental evidence that the His(6) position can determine MC4R versus MC3R agonist selectivity and that chemically nonreactive side chains may be substituted for the imidazole ring (generally needs to be side chain protected in synthetic schemes) in the design of MC4R-selective, small-molecule, non-peptide agonists. Specifically, the tetrapeptide containing the amino-2-naphthylcarboxylic acid (Anc) amino acid at the His position resulted in a potent agonist at the mMC4R (EC(50) = 21 nM), was a weak mMC3R micromolar antagonist (pA(2) = 5.6, K(i) = 2.5 microM), and possessed >4700-fold agonist selectivity for the MC4R versus the MC3R. Substitution of the His(6) amino acid in the tetrapeptide template by the Phe, Anc, 3-(2-thienyl)alanine (2Thi), and 3-(4-pyridinyl)alanine (4-Pal) resulted in equipotency or only up to a 7-fold decrease in potency, compared to the His(6)-containing tetrapeptide at the mMC4R, demonstrating that these amino acid side chains may be substituted for the imidazole in the design of MC4R-selective non-peptide molecules.

  1. Linear antenna of an arbitrary orientation and position in cylindric screen

    International Nuclear Information System (INIS)

    Prijmenko, S.D.; Papkovich, V.G.; Khizhnyak, N.A.

    1991-01-01

    An equation of the linear antenna in cylindric screen is formulated. Using the averaging method a solution of this equation for the antenna of arbitrary orientation which does not contact the screen walls or contacts them in one or two ends is received. The obtained asymptotic expression for stream permits to describe in a single manner the case of resonance and non-resonance scattering. These results may be applied in design of UHF and accelerating installations using cylindric screens charged with linear vibrators. 9 refs. (author)

  2. Structure-activity relationships of the melanocortin tetrapeptide Ac-His-DPhe-Arg-Trp-NH2 at the mouse melanocortin receptors. Part 3: modifications at the Arg position.

    Science.gov (United States)

    Holder, Jerry Ryan; Xiang, Zhimin; Bauzo, Rayna M; Haskell-Luevano, Carrie

    2003-01-01

    The melanocortin pathway is involved in the regulation of several physiological functions including skin pigmentation, steroidogenesis, obesity, energy homeostasis, and exocrine gland function. This melanocortin pathway consists of five known G-protein coupled receptors, endogenous agonists derived from the proopiomelanocortin (POMC) gene transcript, the endogenous antagonists Agouti and the Agouti-related protein (AGRP) and signals through the intracellular cAMP signal transduction pathway. The melanocortin-3 receptor (MC3R) and melanocortin-4 receptor (MC4R) located in the brain are implicated as participating in the metabolic and food intake aspects of energy homeostasis and are stimulated by melanocortin agonists such as alpha-melanocyte stimulation hormone (alpha-MSH). All the endogenous (POMC-derived) melanocortin agonists contain the putative message sequence "His-Phe-Arg-Trp." Herein, we report 12 tetrapeptides, based upon the template Ac-His(6)-DPhe(7)-Arg(8)-Trp(9)-NH(2) (alpha-MSH numbering) that have been modified at the Arg(8) position by neutral, basic, or acidic amino acid side chains. These peptides have been pharmacologically characterized for agonist activity at the mouse melanocortin receptors MC1R, MC3R, MC4R, and MC5R. The most notable results of this study include the observation that removal of the guanidinyl side chain moiety results in decreased melanocortin receptor potency, but that this Arg(8) side chain is not critical for melanocortin receptor agonist activity. Additionally, incorporation of the homoArg(8) residue results in 56-fold MC4R versus MC3R selectivity, and the Orn(8) residue results in 123-fold MC4R versus MC5R and 63-fold MC5R versus MC3R selectivity. Copyright 2002 Elsevier Science Inc.

  3. Experimental dead time corrections for a linear position-sensitive proportional counter

    International Nuclear Information System (INIS)

    Yelon, W.B.; Tompson, C.W.; Mildner, D.F.R.; Berliner, R.; Missouri Univ., Columbia

    1984-01-01

    Two simple counters included in the charge-digitization circuitry of a position-sensitive proportional counter using the charge division method for position encoding have enabled us to determine the dead time losses for the system. An interesting positional dependence of the dead time tau is observed, which agrees with a simple model. The system enables us to correct the experimental data for dead time and to be indifferent to the relatively slow analog-to-digital converters used in the system. (orig.)

  4. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  5. Non-target screening of Allura Red AC photodegradation products in a beverage through ultra high performance liquid chromatography coupled with hybrid triple quadrupole/linear ion trap mass spectrometry.

    Science.gov (United States)

    Gosetti, Fabio; Chiuminatto, Ugo; Mazzucco, Eleonora; Calabrese, Giorgio; Gennaro, Maria Carla; Marengo, Emilio

    2013-01-15

    The study deals with the identification of the degradation products formed by simulated sunlight photoirradiation in a commercial beverage that contains Allura Red AC dye. An UHPLC-MS/MS method, that makes use of hybrid triple quadrupole/linear ion trap, was developed. In the identification step the software tool information dependent acquisition (IDA) was used to automatically obtain information about the species present and to build a multiple reaction monitoring (MRM) method with the MS/MS fragmentation pattern of the species considered. The results indicate that the identified degradation products are formed from side-reactions and/or interactions among the dye and other ingredients present in the beverage (ascorbic acid, citric acid, sucrose, aromas, strawberry juice, and extract of chamomile flowers). The presence of aromatic amine or amide functionalities in the chemical structures proposed for the degradation products might suggest potential hazards to consumer health. Copyright © 2012 Elsevier Ltd. All rights reserved.

  6. Positioning of the rf potential minimum line of a linear Paul trap with micrometer precision

    DEFF Research Database (Denmark)

    Herskind, Peter Fønss; Dantan, Aurélien; Albert, Magnus

    2009-01-01

    We demonstrate a general technique to achieve a precise radial displacement of the nodal line of the radiofrequency (rf) field in a linear Paul trap. The technique relies on the selective adjustment of the load capacitance of the trap electrodes, achieved through the addition of capacitors...... to the basic resonant rf circuit used to drive the trap. Displacements of up to ~100 µm with micrometer precision are measured using a combination of fluorescence images of ion Coulomb crystals and coherent coupling of such crystals to a mode of an optical cavity. The displacements are made without measurable...

  7. Successful use of a linear position-sensitive neutron detector in solid state physics and materials science

    International Nuclear Information System (INIS)

    Schefer, J.; Fischer, P.; Heer, H.; Isacson, A.; Koch, M.; Thut, R.

    1991-01-01

    The double axis multicounter diffractometer (DMC) installed at the 10 MW reactor SAPHIR (PSI) has been designed as a good flux-good resolution (presently Δd/d≥4x10 -3 ) neutron poder diffractometer. The detector bank is based on a commercial position-sensitive linear BF 3 detector which may be automatically and precisely positioned on air cushions on inexpensive floors. This detector type has an 80deg angular opening, not allowing any standard collimation in front of the detector. We therefore developed an oscillating collimator system allowing easy use of the instrument even with sample environments such as a dilution cryostat. (orig.)

  8. A Linear Programming Approach to Routing Control in Networks of Constrained Nonlinear Positive Systems with Concave Flow Rates

    Science.gov (United States)

    Arneson, Heather M.; Dousse, Nicholas; Langbort, Cedric

    2014-01-01

    We consider control design for positive compartmental systems in which each compartment's outflow rate is described by a concave function of the amount of material in the compartment.We address the problem of determining the routing of material between compartments to satisfy time-varying state constraints while ensuring that material reaches its intended destination over a finite time horizon. We give sufficient conditions for the existence of a time-varying state-dependent routing strategy which ensures that the closed-loop system satisfies basic network properties of positivity, conservation and interconnection while ensuring that capacity constraints are satisfied, when possible, or adjusted if a solution cannot be found. These conditions are formulated as a linear programming problem. Instances of this linear programming problem can be solved iteratively to generate a solution to the finite horizon routing problem. Results are given for the application of this control design method to an example problem. Key words: linear programming; control of networks; positive systems; controller constraints and structure.

  9. Accretion of Fat-Free Mass Rather Than Fat Mass in Infancy Is Positively Associated with Linear Growth in Childhood.

    Science.gov (United States)

    Admassu, Bitiya; Ritz, Christian; Wells, Jonathan C K; Girma, Tsinuel; Andersen, Gregers S; Belachew, Tefera; Owino, Victor; Michaelsen, Kim F; Abera, Mubarek; Wibaek, Rasmus; Friis, Henrik; Kæstel, Pernille

    2018-04-01

    We have previously shown that fat-free mass (FFM) at birth is associated with height at 2 y of age in Ethiopian children. However, to our knowledge, the relation between changes in body composition during early infancy and later linear growth has not been studied. This study examined the associations of early infancy fat mass (FM) and FFM accretion with linear growth from 1 to 5 y of age in Ethiopian children. In the infant Anthropometry and Body Composition (iABC) study, a prospective cohort study was carried out in children in Jimma, Ethiopia, followed from birth to 5 y of age. FM and FFM were measured ≤6 times from birth to 6 mo by using air-displacement plethysmography. Linear mixed-effects models were used to identify associations between standardized FM and FFM accretion rates during early infancy and linear growth from 1 to 5 y of age. Standardized accretion rates were obtained by dividing FM and FFM accretion by their respective SD. FFM accretion from 0 to 6 mo of age was positively associated with length at 1 y (β = 0.64; 95% CI: 0.19, 1.09; P = 0.005) and linear growth from 1 to 5 y (β = 0.63; 95% CI: 0.19, 1.07; P = 0.005). The strongest association with FFM accretion was observed at 1 y. The association with linear growth from 1 to 5 y was mainly engendered by the 1-y association. FM accretion from 0 to 4 mo was positively associated with linear growth from 1 to 5 y (β = 0.45; 95% CI: 0.02, 0.88; P = 0.038) in the fully adjusted model. In Ethiopian children, FFM accretion was associated with linear growth at 1 y and no clear additional longitudinal effect from 1 to 5 y was observed. FM accretion showed a weak association from 1 to 5 y. This trial was registered at www.controlled-trials.com as ISRCTN46718296.

  10. AC Initiation System.

    Science.gov (United States)

    An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

  11. Optoelectronic device for the measurement of the absolute linear position in the micrometric displacement range

    Science.gov (United States)

    Morlanes, Tomas; de la Pena, Jose L.; Sanchez-Brea, Luis M.; Alonso, Jose; Crespo, Daniel; Saez-Landete, Jose B.; Bernabeu, Eusebio

    2005-07-01

    In this work, an optoelectronic device that provides the absolute position of a measurement element with respect to a pattern scale upon switch-on is presented. That means that there is not a need to perform any kind of transversal displacement after the startup of the system. The optoelectronic device is based on the process of light propagation passing through a slit. A light source with a definite size guarantees the relation of distances between the different elements that constitute our system and allows getting a particular optical intensity profile that can be measured by an electronic post-processing device providing the absolute location of the system with a resolution of 1 micron. The accuracy of this measuring device is restricted to the same limitations of any incremental position optical encoder.

  12. Non-linear elasticity of extracellular matrices enables contractile cells to communicate local position and orientation.

    Directory of Open Access Journals (Sweden)

    Jessamine P Winer

    2009-07-01

    Full Text Available Most tissue cells grown in sparse cultures on linearly elastic substrates typically display a small, round phenotype on soft substrates and become increasingly spread as the modulus of the substrate increases until their spread area reaches a maximum value. As cell density increases, individual cells retain the same stiffness-dependent differences unless they are very close or in molecular contact. On nonlinear strain-stiffening fibrin gels, the same cell types become maximally spread even when the low strain elastic modulus would predict a round morphology, and cells are influenced by the presence of neighbors hundreds of microns away. Time lapse microscopy reveals that fibroblasts and human mesenchymal stem cells on fibrin deform the substrate by several microns up to five cell lengths away from their plasma membrane through a force limited mechanism. Atomic force microscopy and rheology confirm that these strains locally and globally stiffen the gel, depending on cell density, and this effect leads to long distance cell-cell communication and alignment. Thus cells are acutely responsive to the nonlinear elasticity of their substrates and can manipulate this rheological property to induce patterning.

  13. Voltage-probe-position dependence and magnetic-flux contribution to the measured voltage in ac transport measurements: which measuring circuit determines the real losses?

    International Nuclear Information System (INIS)

    Pe, T.; McDonald, J.; Clem, J.R.

    1995-01-01

    The voltage V ab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path C s through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path C s and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent ac loss (the time average of the product IV ab ) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) ac loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real ac losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit dimensions. Corresponding calculations also are presented for a sample of elliptical cross section

  14. The investigation of the decay of the deformed 167Yb, 164Tm, 225Ac, 221Fr nuclei. Beta-spectrograph with positional-sensitive detector

    International Nuclear Information System (INIS)

    Butabaev, Yu.S.

    1994-01-01

    The decay of the deformed 167 Yb, 164 Tm, 225 Ac, 221 Fr nuclei is investigated in this work. For 167 Yb and 164 Tm decays the specters of the conversion electrons were measured. 32 γ-transitions were found for 167 Yb decay, 6 of which were found for the first time. The multipolarities for 9 γ-transitions were found. For 164 Tm decay 23 new γ-transitions were found. The theoretical investigations of the collective states in the nucleus were carried out. Octupole-rotatory line with k=1 - was found in the measurement of conversion electrons specters of the short-life nuclei. Device' nonlinearity was 0,04%. Resolution was Δβρ/βρ 0,11%. Effective light yield was 1-2 %. The decay of 225 Ac and 221 Fr nuclei were investigated. The investigations of α-γ -coincidence, α-γ - rays were carried out. 24 new γ -transitions for 225 Ac and 13 ones for 221 Fr were found. The new levels and their intensities were defined more precisely. Intensity balance calculations were carried out and the full populations of the nuclear levels were calculated. (author). 3 tabs.; 10 figs

  15. Compact very low temperature scanning tunneling microscope with mechanically driven horizontal linear positioning stage.

    Science.gov (United States)

    Suderow, H; Guillamon, I; Vieira, S

    2011-03-01

    We describe a scanning tunneling microscope for operation in a dilution refrigerator with a sample stage which can be moved macroscopically in a range up to a cm and with an accuracy down to the tens of nm. The position of the tip over the sample as set at room temperature does not change more than a few micrometers when cooling down. This feature is particularly interesting for work on micrometer sized samples. Nanostructures can be also localized and studied, provided they are repeated over micrometer sized areas. The same stage can be used to approach a hard single crystalline sample to a knife and cleave it, or break it, in situ. In situ positioning is demonstrated with measurements at 0.1 K in nanofabricated samples. Atomic resolution down to 0.1 K and in magnetic fields of 8 T is demonstrated in NbSe(2). No heat dissipation nor an increase in mechanical noise has been observed at 0.1 K when operating the slider.

  16. About a Class of Positive Hybrid Dynamic Linear Systems and an Associate Extended Kalman-Yakubovich-Popov Lemma

    Directory of Open Access Journals (Sweden)

    M. De la Sen

    2017-01-01

    Full Text Available This paper formulates an “ad hoc” robust version under parametrical disturbances of the discrete version of the Kalman-Yakubovich-Popov Lemma for a class of positive hybrid dynamic linear systems which consist of a continuous-time system coupled with a discrete-time or a digital one. An extended discrete system, whose state vector contains both the digital one and the discretization of the continuous-time one at sampling instants, is a key analysis element in the formulation. The hyperstability and asymptotic hyperstability properties of the studied class of positive hybrid systems under feedback from any member of a nonlinear (and, eventually, time-varying class of controllers, which satisfies a Popov’s-type inequality, are also investigated as linked to the positive realness of the associated transfer matrices.

  17. Distributed transition-edge sensors for linearized position response in a phonon-mediated X-ray imaging spectrometer

    Science.gov (United States)

    Cabrera, Blas; Brink, Paul L.; Leman, Steven W.; Castle, Joseph P.; Tomada, Astrid; Young, Betty A.; Martínez-Galarce, Dennis S.; Stern, Robert A.; Deiker, Steve; Irwin, Kent D.

    2004-03-01

    For future solar X-ray satellite missions, we are developing a phonon-mediated macro-pixel composed of a Ge crystal absorber with four superconducting transition-edge sensors (TES) distributed on the backside. The X-rays are absorbed on the opposite side and the energy is converted into phonons, which are absorbed into the four TES sensors. By connecting together parallel elements into four channels, fractional total energy absorbed between two of the sensors provides x-position information and the other two provide y-position information. We determine the optimal distribution for the TES sub-elements to obtain linear position information while minimizing the degradation of energy resolution.

  18. A new amplifier for improving piezoelectric actuator linearity based on current switching in precision positioning

    International Nuclear Information System (INIS)

    Ru, Changhai; Chen, Liguo; Shao, Bing; Rong, Weibin; Sun, Lining

    2008-01-01

    Piezoelectric actuators have traditionally been driven by voltage amplifiers. When driven at large voltages these actuators exhibit a significant amount of distortion, known as hysteresis, which may reduce the stability robustness of the system in feedback control applications. Piezoelectric transducers are known to exhibit less hysteresis when driven with current or charge rather than voltage. Despite this advantage, such methods have found little practical application due to the poor low frequency response of present current and charge driver designs. In this paper, a new piezoelectric amplifier based on current switching is presented which can reduce hysteresis. Special circuits and a hybrid control algorithm realize quick and precise positioning. Experimental results demonstrate that the amplifier can be used for dynamic and static applications and low frequency bandwidths can also be achieved

  19. A Non-linear Model for Predicting Tip Position of a Pliable Robot Arm Segment Using Bending Sensor Data

    Directory of Open Access Journals (Sweden)

    Elizabeth I. SKLAR

    2016-04-01

    Full Text Available Using pliable materials for the construction of robot bodies presents new and interesting challenges for the robotics community. Within the EU project entitled STIFFness controllable Flexible & Learnable manipulator for surgical Operations (STIFF-FLOP, a bendable, segmented robot arm has been developed. The exterior of the arm is composed of a soft material (silicone, encasing an internal structure that contains air-chamber actuators and a variety of sensors for monitoring applied force, position and shape of the arm as it bends. Due to the physical characteristics of the arm, a proper model of robot kinematics and dynamics is difficult to infer from the sensor data. Here we propose a non-linear approach to predicting the robot arm posture, by training a feed-forward neural network with a structured series of pressures values applied to the arm's actuators. The model is developed across a set of seven different experiments. Because the STIFF-FLOP arm is intended for use in surgical procedures, traditional methods for position estimation (based on visual information or electromagnetic tracking will not be possible to implement. Thus the ability to estimate pose based on data from a custom fiber-optic bending sensor and accompanying model is a valuable contribution. Results are presented which demonstrate the utility of our non-linear modelling approach across a range of data collection procedures.

  20. On the use of iterative techniques for feedforward control of transverse angle and position jitter in linear particle beam accelerators

    International Nuclear Information System (INIS)

    Barr, D.S.

    1995-01-01

    It is possible to use feedforward predictive control for transverse position and trajectory-angle jitter correction. The control procedure is straightforward, but creation of the predictive filter is not as obvious. The two process tested were the least mean squares (LMS) and Kalman filter methods. The controller parameters calculated offline are downloaded to a real-time analog correction system between macropulses. These techniques worked well for both interpulse (pulse-to-pulse) correction and intrapulse (within a pulse) correction with the Kalman filter method being the clear winner. A simulation based on interpulse data taken at the Stanford Linear Collider showed an improvement factor of almost three in the average rms jitter over standard feedback techniques for the Kalman filter. An improvement factor of over three was found for the Kalman filter on intrapulse data taken at the Los Alamos Meson Physics Facility. The feedforward systems also improved the correction bandwidth. copyright 1995 American Institute of Physics

  1. On the use of iterative techniques for feedforward control of transverse angle and position jitter in linear particle beam accelerators

    International Nuclear Information System (INIS)

    Barr, D.S.

    1994-01-01

    It is possible to use feedforward predictive control for transverse position and trajectory-angle jitter correction. The control procedure is straightforward, but creation of the predictive filter is not as obvious. The two processes tested were the least mean squares (LMS) and Kalman inter methods. The controller parameters calculated offline are downloaded to a real-time analog correction system between macropulses. These techniques worked well for both interpulse (pulse-to-pulse) correction and intrapulse (within a pulse) correction with the Kalman filter method being the clear winner. A simulation based on interpulse data taken at the Stanford Linear Collider showed an improvement factor of almost three in the average rms jitter over standard feedback techniques for the Kalman filter. An improvement factor of over three was found for the Kalman filter on intrapulse data taken at the Los Alamos Meson Physics Facility. The feedforward systems also improved the correction bandwidth

  2. Large, Linear, and Tunable Positive Magnetoresistance of Mechanically Stable Graphene Foam-Toward High-Performance Magnetic Field Sensors.

    Science.gov (United States)

    Sagar, Rizwan Ur Rehman; Galluzzi, Massimiliano; Wan, Caihua; Shehzad, Khurram; Navale, Sachin T; Anwar, Tauseef; Mane, Rajaram S; Piao, Hong-Guang; Ali, Abid; Stadler, Florian J

    2017-01-18

    Here, we present the first observation of magneto-transport properties of graphene foam (GF) composed of a few layers in a wide temperature range of 2-300 K. Large room-temperature linear positive magnetoresistance (PMR ≈ 171% at B ≈ 9 T) has been detected. The largest PMR (∼213%) has been achieved at 2 K under a magnetic field of 9 T, which can be tuned by the addition of poly(methyl methacrylate) to the porous structure of the foam. This remarkable magnetoresistance may be the result of quadratic magnetoresistance. The excellent magneto-transport properties of GF open a way toward three-dimensional graphene-based magnetoelectronic devices.

  3. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  4. Low Offset AC Correlator.

    Science.gov (United States)

    This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

  5. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  6. Modulation of Quorum Sensing in a Gram-Positive Pathogen by Linear Molecularly Imprinted Polymers with Anti-infective Properties.

    Science.gov (United States)

    Motib, Anfal; Guerreiro, Antonio; Al-Bayati, Firas; Piletska, Elena; Manzoor, Irfan; Shafeeq, Sulman; Kadam, Anagha; Kuipers, Oscar; Hiller, Luisa; Cowen, Todd; Piletsky, Sergey; Andrew, Peter W; Yesilkaya, Hasan

    2017-12-22

    We describe the development, characterization, and biological testing of a new type of linear molecularly imprinted polymer (LMIP) designed to act as an anti-infective by blocking the quorum sensing (QS) mechanism and so abrogating the virulence of the pathogen Streptococcus pneumoniae. The LMIP is prepared (polymerized) in presence of a template molecule, but unlike in traditional molecular imprinting approaches, no cross-linker is used. This results in soluble low-molecular-weight oligomers that can act as a therapeutic agent in vitro and in vivo. The LMIP was characterized by mass spectrometry to determine its monomer composition. Fragments identified were then aligned along the peptide template by computer modeling to predict the possible monomer sequence of the LMIP. These findings provide a proof of principle that LMIPs can be used to block QS, thus setting the stage for the development of LMIPs a novel drug-discovery platform and class of materials to target Gram-positive pathogens. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Melanocortin tetrapeptide Ac-His-DPhe-Arg-Trp-NH2 modified at the para position of the benzyl side chain (DPhe): importance for mouse melanocortin-3 receptor agonist versus antagonist activity.

    Science.gov (United States)

    Proneth, Bettina; Pogozheva, Irina D; Portillo, Federico P; Mosberg, Henry I; Haskell-Luevano, Carrie

    2008-09-25

    The melanocortin-3 and -4 receptors (MC3R, MC4R) have been implicated in energy homeostasis and obesity. Whereas the physiological role of the MC4R is extensively studied, little is known about the MC3R. One caveat is the limited availability of ligands that are selective for the MC3R. Previous studies identified Ac-His-DPhe(p-I)-Arg-Trp-NH 2, which possessed partial agonist/antagonist pharmacology at the mMC3R while retaining full nanomolar agonist pharmacology at the mMC4R. These data allowed for the hypothesis that the DPhe position in melanocortin tetrapeptides can be used to examine ligand side-chain determinants important for differentiation of mMC3R agonist versus antagonist activity. A series of 15 DPhe (7) modified Ac-His-DPhe (7)-Arg-Trp-NH 2 tetrapeptides has been synthesized and pharmacologically characterized. Most notable results include the identification of modifications that resulted in potent antagonists/partial agonists at the mMC3R and full, potent agonists at the mMC4R. These SAR studies provide experimental evidence that the molecular mechanism of antagonism at the mMC3R differentiates this subtype from the mMC4R.

  8. Development of Bundle Position-Wise Linear Model for Predicting the Pressure Tube Diametral Creep in CANDU Reactors

    International Nuclear Information System (INIS)

    Lee, Jae Yong; Na, Man Gyun

    2011-01-01

    Diametral creep of the pressure tube (PT) is one of the principal aging mechanisms governing the heat transfer and hydraulic degradation of a heat transport system. PT diametral creep leads to diametral expansion that affects the thermal hydraulic characteristics of the coolant channels and the critical heat flux. Therefore, it is essential to predict the PT diametral creep in CANDU reactors, which is caused mainly by fast neutron irradiation, reactor coolant temperature and so forth. The currently used PT diametral creep prediction model considers the complex interactions between the effects of temperature and fast neutron flux on the deformation of PT zirconium alloys. The model assumes that long-term steady-state deformation consists of separable, additive components from thermal creep, irradiation creep and irradiation growth. This is a mechanistic model based on measured data. However, this model has high prediction uncertainty. Recently, a statistical error modeling method was developed using plant inspection data from the Bruce B CANDU reactor. The aim of this study was to develop a bundle position-wise linear model (BPLM) to predict PT diametral creep employing previously measured PT diameters and HTS operating conditions. There are twelve bundles in a fuel channel and for each bundle, a linear model was developed by using the dependent variables, such as the fast neutron fluxes and the bundle temperatures. The training data set was selected using the subtractive clustering method. The data of 39 channels that consist of 80 percent of a total of 49 measured channels from Units 2, 3 and 4 were used to develop the BPLM models. The remaining 10 channels' data were used to test the developed BPLM models. The BPLM was optimized by the maximum likelihood estimation method. The developed BPLM to predict PT diametral creep was verified using the operating data gathered from the Units 2,3 and 4 in Korea. Two error components for the BPLM, which are the epistemic

  9. Improving Power Quality in AC Supply Grids

    Directory of Open Access Journals (Sweden)

    Piotr Fabijański

    2015-12-01

    Full Text Available This paper describes a digital and actual model of the UPQC (Unified Power Quality Conditioner integrated system for power quality improvement. The UPQC’s design and its connection to an AC supply grid, 1-phase and 3-phase alike, provide effective compensation of unwanted interferences in the waveforms of load supply voltages and non-linear load currents. This article presents an overview of topologies and control strategies. The study of the UPQC confirmed its positive impact on the power quality. The electricity parameters were significantly improved. Total harmonic distortion in supply voltage THDu decreased six-fold to 1.89%, and total harmonic distortion in load current THDi decreased more than ten-fold to 2.38% for a non-linear load (uncontrolled bridge rectifier with load L. Additionally, symmetrisation of supply voltages and reactive power compensation Q of linear load was obtained. The UPQC integrated system for power quality improvement can be used wherever high-quality and PN-EN 50160 standard – compliant electricity is required.

  10. A superconducting linear motor drive for a positive displacement bellows pump for use in the g-2 cryogenics system

    International Nuclear Information System (INIS)

    Green, M.A.

    1994-10-01

    Forced two-phase cooling of indirectly cooled magnets requires circulation of liquid helium through the magnet cooling channel. A bellows helium pump is one possible way of providing helium flow to a magnet cooling system. Since the bellows type of helium pump is immersed in liquid helium, a superconducting linear motor drive appears to be an attractive option. This report describes a linear motor drive that employs oriented permanent magnet materials such as samarium-cobalt as the stator magnet system and a superconducting loud speaker voice coil type of drive as the armature of the linear motor. This report examines drive motor requirements for a helium pump

  11. Accretion of fat-free mass rather than fat mass in infancy is positively associated with linear growth in childhood

    DEFF Research Database (Denmark)

    Admassu Wossen, Bitiya; Ritz, Christian; Wells, Jonathan C K

    2018-01-01

    Background: We have previously shown that fat-free mass (FFM) at birth is associated with height at 2 y of age in Ethiopian children. However, to our knowledge, the relation between changes in body composition during early infancy and later linear growth has not been studied. Objective: This study...... examined the associations of early infancy fat mass (FM) and FFM accretion with linear growth from 1 to 5 y of age in Ethiopian children. Methods: In the infant Anthropometry and Body Composition (iABC) study, a prospective cohort study was carried out in children in Jimma, Ethiopia, followed from birth...... to 5 y of age. FM and FFM were measured ≤6 times from birth to 6 mo by using air-displacement plethysmography. Linear mixed-effects models were used to identify associations between standardized FM and FFM accretion rates during early infancy and linear growth from 1 to 5 y of age. Standardized...

  12. FLUIDIC AC AMPLIFIERS.

    Science.gov (United States)

    Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

  13. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  14. Existence of 2m-1 Positive Solutions for Sturm-Liouville Boundary Value Problems with Linear Functional Boundary Conditions on the Half-Line

    Directory of Open Access Journals (Sweden)

    Yanmei Sun

    2012-01-01

    Full Text Available By using the Leggett-Williams fixed theorem, we establish the existence of multiple positive solutions for second-order nonhomogeneous Sturm-Liouville boundary value problems with linear functional boundary conditions. One explicit example with singularity is presented to demonstrate the application of our main results.

  15. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  16. Automatic control system of a linear actuator for positioning samples to neutron irradiation using low cost open-hardware boards

    International Nuclear Information System (INIS)

    Cunya, Eduardo; Chan, Renzo; Pacheco, Adison

    2015-01-01

    This paper describes the design criteria and implementation of an automatic control system based on embedded electronic circuits (microcontrollers) of different architectures (RISC, ARM) and open source framework software CanFestival, to develop user applications. Electronic devices are autonomous and support the functionality required for communication and remote control of the linear actuator. (author)

  17. Modulation of Quorum Sensing in a Gram Positive Pathogen by Linear Imprinted Copolymers with anti-Infective Properties

    NARCIS (Netherlands)

    Motib, Anfal; Guerreiro, Antonio; Al-Bayati, Firas; Piletska, Elena; Manzoor, Irfan; Shafeeq, Sulman; Kadam, Anagha; Kuipers, Oscar; Hiller, Luisa; Cowen, Todd; Piletsky, Sergey; Andrew, Peter; Yesilkaya, Hasan

    2017-01-01

    Here we describe the development, characterization and biological testing of a new type of linear molecularly imprinted polymer (LMIP) designed to act as anti-infective by blocking the quorum sensing (QS) mechanism and so preventing virulence of the pathogen Streptococcus pneumoniae. The LMIP is

  18. Positive detection of exfoliated colon cancer cells on linear stapler cartridges was associated with depth of tumor invasion and preoperative bowel preparation in colon cancer.

    Science.gov (United States)

    Ikehara, Kishiko; Endo, Shungo; Kumamoto, Kensuke; Hidaka, Eiji; Ishida, Fumio; Tanaka, Jun-Ichi; Kudo, Shin-Ei

    2016-08-31

    The aim of this study was to investigate exfoliated cancer cells (ECCs) on linear stapler cartridges used for anastomotic sites in colon cancer. We prospectively analyzed ECCs on linear stapler cartridges used for anastomosis in 100 colon cancer patients who underwent colectomy. Having completed the functional end-to-end anastomosis, the linear stapler cartridges were irrigated with saline, which was collected for cytological examination and cytological diagnoses were made by board-certified pathologists based on Papanicolaou staining. The detection rate of ECCs on the linear stapler cartridges was 20 %. Positive detection of ECCs was significantly associated with depth of tumor invasion (p = 0.012) and preoperative bowel preparation (p = 0.003). There were no marked differences between ECC-positive and ECC-negative groups in terms of the operation methods, tumor location, histopathological classification, and surgical margins. Since ECCs were identified on the cartridge of the linear stapler used for anastomosis, preoperative mechanical bowel preparation using polyethylene glycol solution and cleansing at anastomotic sites using tumoricidal agents before anastomosis may be necessary to decrease ECCs in advanced colon cancer.

  19. Optimal design of a double-sided linear motor with a multi-segmented trapezoidal magnet array for a high precision positioning system

    International Nuclear Information System (INIS)

    Lee, Moon G.; Gweon, Dae-Gab

    2004-01-01

    A comparative analysis is performed for linear motors adopting conventional and multi-segmented trapezoidal (MST) magnet arrays, respectively, for a high-precision positioning system. The proposed MST magnet array is a modified version of a Halbach magnet array. The MST array has trapezoidal magnets with variable shape and dimensions while the Halbach magnet array generally has a rectangular magnet with identical dimensions. We propose a new model that can describe the magnetic field resulting from the complex-shaped magnets. The model can be applied to both MST and conventional magnet arrays. Using the model, a design optimization of the two types of linear motors is performed and compared. The magnet array with trapezoidal magnets can produce more force than one with rectangular magnets when they are arrayed in a linear motor where there is a yoke with high permeability. After the optimization and comparison, we conclude that the linear motor with the MST magnet array can generate more actuating force per volume than the motor with the conventional array. In order to satisfy the requirements of next generation systems such as high resolution, high speed, and long stroke, the use of a linear motor with a MST array as an actuator in a high precision positioning system is recommended from the results obtained here

  20. AcMNPV

    African Journals Online (AJOL)

    USER

    2010-08-16

    Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

  1. AC BREAKDOWN IN GASES

    Science.gov (United States)

    electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.

  2. THERMIONIC AC GENERATION

    Science.gov (United States)

    is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

  3. A method for simultaneous linear optics and coupling correction for storage rings with turn-by-turn beam position monitor data

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Xi [Brookhaven National Laboratory, Upton, Long Island, NY 11973 (United States); Huang, Xiaobiao, E-mail: xiahuang@slac.stanford.edu [SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States)

    2016-08-21

    We propose a method to simultaneously correct linear optics errors and linear coupling for storage rings using turn-by-turn (TbT) beam position monitor (BPM) data. The independent component analysis (ICA) method is used to isolate the betatron normal modes from the measured TbT BPM data. The betatron amplitudes and phase advances of the projections of the normal modes on the horizontal and vertical planes are then extracted, which, combined with dispersion measurement, are used to fit the lattice model. The fitting results are used for lattice correction. The method has been successfully demonstrated on the NSLS-II storage ring.

  4. A method for simultaneous linear optics and coupling correction for storage rings with turn-by-turn beam position monitor data

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Xi [Brookhaven National Lab. (BNL), Upton, NY (United States); Huang, Xiaobiao [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2016-08-01

    We propose a method to simultaneously correct linear optics errors and linear coupling for storage rings using turn-by-turn (TbT) beam position monitor (BPM) data. The independent component analysis (ICA) method is used to isolate the betatron normal modes from the measured TbT BPM data. The betatron amplitudes and phase advances of the projections of the normal modes on the horizontal and vertical planes are then extracted, which, combined with dispersion measurement, are used to fit the lattice model. Furthermore, the fitting results are used for lattice correction. Our method has been successfully demonstrated on the NSLS-II storage ring.

  5. Linear gate

    International Nuclear Information System (INIS)

    Suwono.

    1978-01-01

    A linear gate providing a variable gate duration from 0,40μsec to 4μsec was developed. The electronic circuity consists of a linear circuit and an enable circuit. The input signal can be either unipolar or bipolar. If the input signal is bipolar, the negative portion will be filtered. The operation of the linear gate is controlled by the application of a positive enable pulse. (author)

  6. The reliability of linear position transducer, force plate and combined measurement of explosive power-time variables during a loaded jump squat in elite athletes.

    Science.gov (United States)

    Hansen, Keir T; Cronin, John B; Newton, Michael J

    2011-03-01

    The purpose of this study was to determine the between day reliability of power-time measures calculated with data collected using the linear position transducer or the force plate independently, or a combination of the two technologies. Twenty-five male rugby union players performed three jump squats on two occasions one week apart. Ground reaction forces were measured via a force plate and position data were collected using a linear position transducer. From these data, a number of power-time variables were calculated for each method. The force plate, linear position transducer and a combined method were all found to be a reliable means of measuring peak power (ICC = 0.87-0.95, CV = 3.4%-8.0%). The absolute consistency of power-time measures varied between methods (CV = 8.0%-53.4%). Relative consistency of power-time measures was generally comparable between methods and measures, and for many variables was at an acceptable level (ICC = 0.77-0.94). Although a number of time-dependent power variables can be reliably calculated from data acquired from the three methods investigated, the reliability of a number of these measures is below that which is acceptable for use in research and for practical applications.

  7. Um estudo fonético-acústico do /R/ vocalizado em posição de coda silábica An acoustic-phonetic study of vocalized /R/ in syllable coda position

    Directory of Open Access Journals (Sweden)

    Cândida Mara Britto Leite

    2012-01-01

    Full Text Available Os principais objetivos deste trabalho, são: (i caracterizar, através de um estudo fonético-acústico, o /R/ vocalizado que ocorre em posição de coda silábica medial em dados de um informante natural do interior paulista e (ii estabelecer comparações entre as ocorrências de /R/, do glide [j] e da vogal anterior alta [i], além das comparações entre [j] e [i], pois algumas das realizações de /R/ se aproximam, auditivamente, das realizações desses dois últimos segmentos. As amostras foram exploradas quanto à frequência dos três primeiros formantes (F1, F2 e F3. Para análise dos dados, o referencial teórico adotado foi o da Teoria Acústica de Produção da Fala, conforme Fant (1960, somado aos pressupostos da Sociolinguística. Como resultado, a análise dos dados mostrou que diante de vogais /e/ e /a/, há vocalização do /R/ e (ii diante das vogais posteriores /ɔ/ e /u/, o /R/ não sofre o processo de vocalização e é produzido com retroflexão.This paper aims at (i characterizing, in a acoustic-phonetic approach, the vocalized /R/ that occurs in medial syllabic coda position, based on data collected with one informant from the countryside cities in São Paulo state and (ii contrasting occurrences of /R/, the glide [j], the high vowel [i]. It also compares [j] with [i], once some /R/ realizations are similar to [j] and [i] ones. The sample analysis focuses on the frequency of the first three formants (F1, F2 e F3. This data were recorded and we undertook acoustic analyses. The adopted theoretical reference was that of Acoustic Theory of Speech Production by Fant (1960, added to Sociolinguistic framework. The results suggest that (i before /e/ and /a/, /R/ is vocalized, and (ii before /ɔ/ and /u/, /R/ is produced as a retroflex sound and does not undergo vocalization.

  8. HbA1c Measured in Stored Erythrocytes Is Positively Linearly Associated with Mortality in Individuals with Diabetes Mellitus

    Science.gov (United States)

    Sluik, Diewertje; Boeing, Heiner; Montonen, Jukka; Kaaks, Rudolf; Lukanova, Annekatrin; Sandbaek, Annelli; Overvad, Kim; Arriola, Larraitz; Ardanaz, Eva; Saieva, Calogero; Grioni, Sara; Tumino, Rosario; Sacerdote, Carlotta; Mattiello, Amalia; Spijkerman, Annemieke M. W.; van der A, Daphne L.; Beulens, Joline W. J.; van Dieren, Susan; Nilsson, Peter M.; Groop, Leif C.; Franks, Paul W.; Rolandsson, Olov; Bueno-de-Mesquita, Bas; Nöthlings, Ute

    2012-01-01

    Introduction Observational studies have shown that glycated haemoglobin (HbA1c) is related to mortality, but the shape of the association is less clear. Furthermore, disease duration and medication may modify this association. This observational study explored the association between HbA1c measured in stored erythrocytes and mortality. Secondly, it was assessed whether disease duration and medication use influenced the estimates or were independently associated with mortality. Methods Within the European Prospective Investigation into Cancer and Nutrition a cohort was analysed of 4,345 individuals with a confirmed diagnosis of diabetes at enrolment. HbA1c was measured in blood samples stored up to 19 years. Multivariable Cox proportional hazard regression models for all-cause mortality investigated HbA1c in quartiles as well as per 1% increment, diabetes medication in seven categories of insulin and oral hypoglycaemic agents, and disease duration in quartiles. Results After a median follow-up of 9.3 years, 460 participants died. Higher HbA1c was associated with higher mortality: Hazard Ratio for 1%-increase was 1.11 (95% CI 1.06, 1.17). This association was linear (P-nonlinearity =0.15) and persistent across categories of medication use, disease duration, and co-morbidities. Compared with metformin, other medication types were not associated with mortality. Longer disease duration was associated with mortality, but not after adjustment for HbA1c and medication. Conclusion This prospective study showed that persons with lower HbA1c had better survival than those with higher HbA1c. The association was linear and independent of disease duration, type of medication use, and presence of co-morbidities. Any improvement of HbA1c appears to be associated with reduced mortality risk. PMID:22719972

  9. AC conductivity for a holographic Weyl semimetal

    Energy Technology Data Exchange (ETDEWEB)

    Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)

    2017-03-23

    We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.

  10. Design and Parametric Study of the Magnetic Sensor for Position Detection in Linear Motor Based on Nonlinear Parametric model order reduction.

    Science.gov (United States)

    Paul, Sarbajit; Chang, Junghwan

    2017-07-01

    This paper presents a design approach for a magnetic sensor module to detect mover position using the proper orthogonal decomposition-dynamic mode decomposition (POD-DMD)-based nonlinear parametric model order reduction (PMOR). The parameterization of the sensor module is achieved by using the multipolar moment matching method. Several geometric variables of the sensor module are considered while developing the parametric study. The operation of the sensor module is based on the principle of the airgap flux density distribution detection by the Hall Effect IC. Therefore, the design objective is to achieve a peak flux density (PFD) greater than 0.1 T and total harmonic distortion (THD) less than 3%. To fulfill the constraint conditions, the specifications for the sensor module is achieved by using POD-DMD based reduced model. The POD-DMD based reduced model provides a platform to analyze the high number of design models very fast, with less computational burden. Finally, with the final specifications, the experimental prototype is designed and tested. Two different modes, 90° and 120° modes respectively are used to obtain the position information of the linear motor mover. The position information thus obtained are compared with that of the linear scale data, used as a reference signal. The position information obtained using the 120° mode has a standard deviation of 0.10 mm from the reference linear scale signal, whereas the 90° mode position signal shows a deviation of 0.23 mm from the reference. The deviation in the output arises due to the mechanical tolerances introduced into the specification during the manufacturing process. This provides a scope for coupling the reliability based design optimization in the design process as a future extension.

  11. Characterization and linear array LA48 Commissioner for measuring the position of the multi leaf collimator; Caracterizacion y comisionado del linear array LA48 para medir el posicionamiento del colimador multilaminas

    Energy Technology Data Exchange (ETDEWEB)

    Conles Picos, I.; Cenizo de Castro, E.; Aparicio martin, A. R.; Barrio Lazo, F.; Cesteros Morante, M. J.

    2011-07-01

    The protocol of Quality Control of electron accelerators for medical use of SEFM proposed for multi leaf collimation system (MLC) to verify the positioning of the blades connect. To do this you must find a system with sufficient accuracy and precision and, if possible, easy to assemble and offers real-time results. One of these teams is the Linear Array of PTW-Freiburg (LA48), which consists of a row of 47 ionization chambers, of 0008 cc and 8 mm apart from each other. In this paper, we describe our process of characterization and LA48 commissioner. (Author)

  12. Mass of AC Andromedae

    International Nuclear Information System (INIS)

    King, D.S.; Cox, A.N.; Hodson, S.W.

    1975-01-01

    Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)

  13. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, G [Jefferson Lab (United States)

    2014-07-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  14. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  15. Dynamic characteristics of corona discharge generated under rainfall condition on AC charged conductors

    Science.gov (United States)

    Xu, Pengfei; Zhang, Bo; Wang, Zezhong; Chen, Shuiming; He, Jinliang

    2017-12-01

    By synchronous measurement of corona current and the water droplet deformation process on a conductor surface, different types of corona discharge are visualized when AC voltage is applied on a line-ground electrode system. The corona characteristics are closely related to the applied voltage and water supply rate. With the increase of AC voltage, the positive Taylor cone discharge firstly appears and then disappears, replaced by the dripping and crashing discharge. Furthermore, the number of pulses in each pulse train increases with the increase of applied voltage. The mechanism of the transfer from the positive Taylor cone discharge to the dripping and crashing discharge is found to be related to the oscillation process of the water droplet. The water supply rate also has a great influence on the characteristics of corona currents. The number of positive pulse trains increases linearly when the water supply rate gets larger, leading to a higher audible noise and radio interference level from the AC corona, which is quite different from that of the DC corona. The difference between the AC and DC coronas under rainfall conditions is analyzed finally.

  16. Ac irreversibility line of bismuth-based high temperature superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)

    1997-09-01

    We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}

  17. Ac irreversibility line of bismuth-based high temperature superconductors

    International Nuclear Information System (INIS)

    Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.

    1997-01-01

    We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society

  18. AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

    Science.gov (United States)

    El-Nahass, M. M.; Ali, H. A. M.

    2012-06-01

    AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

  19. Methodology to reduce 6D patient positional shifts into a 3D linear shift and its verification in frameless stereotactic radiotherapy

    Science.gov (United States)

    Sarkar, Biplab; Ray, Jyotirmoy; Ganesh, Tharmarnadar; Manikandan, Arjunan; Munshi, Anusheel; Rathinamuthu, Sasikumar; Kaur, Harpreet; Anbazhagan, Satheeshkumar; Giri, Upendra K.; Roy, Soumya; Jassal, Kanan; Kalyan Mohanti, Bidhu

    2018-04-01

    The aim of this article is to derive and verify a mathematical formulation for the reduction of the six-dimensional (6D) positional inaccuracies of patients (lateral, longitudinal, vertical, pitch, roll and yaw) to three-dimensional (3D) linear shifts. The formulation was mathematically and experimentally tested and verified for 169 stereotactic radiotherapy patients. The mathematical verification involves the comparison of any (one) of the calculated rotational coordinates with the corresponding value from the 6D shifts obtained by cone beam computed tomography (CBCT). The experimental verification involves three sets of measurements using an ArcCHECK phantom, when (i) the phantom was not moved (neutral position: 0MES), (ii) the position of the phantom shifted by 6D shifts obtained from CBCT (6DMES) from neutral position and (iii) the phantom shifted from its neutral position by 3D shifts reduced from 6D shifts (3DMES). Dose volume histogram and statistical comparisons were made between ≤ft and ≤ft . The mathematical verification was performed by a comparison of the calculated and measured yaw (γ°) rotation values, which gave a straight line, Y  =  1X with a goodness of fit as R 2  =  0.9982. The verification, based on measurements, gave a planning target volume receiving 100% of the dose (V100%) as 99.1  ±  1.9%, 96.3  ±  1.8%, 74.3  ±  1.9% and 72.6  ±  2.8% for the calculated treatment planning system values TPSCAL, 0MES, 3DMES and 6DMES, respectively. The statistical significance (p-values: paired sample t-test) of V100% were found to be 0.03 for the paired sample ≤ft and 0.01 for ≤ft . In this paper, a mathematical method to reduce 6D shifts to 3D shifts is presented. The mathematical method is verified by using well-matched values between the measured and calculated γ°. Measurements done on the ArcCHECK phantom also proved that the proposed methodology is correct. The post-correction of the

  20. Online Kidney Position Verification Using Non-Contrast Radiographs on a Linear Accelerator with on Board KV X-Ray Imaging Capability

    International Nuclear Information System (INIS)

    Willis, David J.; Kron, Tomas; Hubbard, Patricia; Haworth, Annette; Wheeler, Greg; Duchesne, Gillian M.

    2009-01-01

    The kidneys are dose-limiting organs in abdominal radiotherapy. Kilovoltage (kV) radiographs can be acquired using on-board imager (OBI)-equipped linear accelerators with better soft tissue contrast and lower radiation doses than conventional portal imaging. A feasibility study was conducted to test the suitability of anterior-posterior (AP) non-contrast kV radiographs acquired at treatment time for online kidney position verification. Anthropomorphic phantoms were used to evaluate image quality and radiation dose. Institutional Review Board approval was given for a pilot study that enrolled 5 adults and 5 children. Customized digitally reconstructed radiographs (DRRs) were generated to provide a priori information on kidney shape and position. Radiotherapy treatment staff performed online evaluation of kidney visibility on OBI radiographs. Kidney dose measured in a pediatric anthropomorphic phantom was 0.1 cGy for kV imaging and 1.7 cGy for MV imaging. Kidneys were rated as well visualized in 60% of patients (90% confidence interval, 34-81%). The likelihood of visualization appears to be influenced by the relative AP separation of the abdomen and kidneys, the axial profile of the kidneys, and their relative contrast with surrounding structures. Online verification of kidney position using AP non-contrast kV radiographs on an OBI-equipped linear accelerator appears feasible for patients with suitable abdominal anatomy. Kidney position information provided is limited to 2-dimensional 'snapshots,' but this is adequate in some clinical situations and potentially advantageous in respiratory-correlated treatments. Successful clinical implementation requires customized partial DRRs, appropriate imaging parameters, and credentialing of treatment staff.

  1. The 1 Repetition Maximum Mechanics of a High-Handle Hexagonal Bar Deadlift Compared With a Conventional Deadlift as Measured by a Linear Position Transducer.

    Science.gov (United States)

    Lockie, Robert G; Moreno, Matthew R; Lazar, Adrina; Risso, Fabrice G; Liu, Tricia M; Stage, Alyssa A; Birmingham-Babauta, Samantha A; Torne, Ibett A; Stokes, John J; Giuliano, Dominic V; Davis, DeShaun L; Orjalo, Ashley J; Callaghan, Samuel J

    2018-01-01

    Lockie, RG, Moreno, MR, Lazar, A, Risso, FG, Liu, TM, Stage, AA, Birmingham-Babauta, SA, Torne, IA, Stokes, JJ, Giuliano, DV, Davis, DL, Orjalo, AJ, and Callaghan, SJ. The 1 repetition maximum mechanics of a high-handle hexagonal bar deadlift compared with a conventional deadlift as measured by a linear position transducer. J Strength Cond Res 32(1): 150-161, 2018-The high-handle hexagonal bar deadlift (HHBD), a variation of the conventional deadlift (CD), is said to reduce the lift range of motion, which may change the mechanics of the lift. However, no research has investigated this. This study compared the mechanics between a 1 repetition maximum (1RM) CD and HHBD. Thirty-one strength-trained subjects (21 men, 10 women) completed a 1RM CD and HHBD. A linear position transducer measured lift distance, duration, and work; and peak and mean power, velocity, and force. The presence of a sticking region (SR) was determined for each lift. A repeated-measures analysis of variance (ANOVA) calculated differences between 1RM CD and HHBD mechanics. A one-way ANOVA compared the mechanics of each lift between subjects who exhibited an SR or not, and the SR between the CD and HHBD. Significance was set at p mechanics between subjects with or without an SR, and no differences in SR region distance or duration between the CD and HHBD. Greater force can be generated in the HHBD, which could have implications for strength-training adaptations over time.

  2. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  3. Superconducting ac cable

    Science.gov (United States)

    Schmidt, F.

    1980-11-01

    The components of a superconducting 110 kV ac cable for power ratings or = 2000 MVA were developed. The cable design is of the semiflexible type, with a rigid cryogenic envelope containing a flexible hollow coaxial cable core. The cable core consists of spirally wound Nb-A1 composite wires electrically insulated by high pressure polyethylene tape wrappings. A 35 m long single phase test cable with full load terminals rated at 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of this cable design.

  4. ac superconducting articles

    International Nuclear Information System (INIS)

    Meyerhoff, R.W.

    1977-01-01

    A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface

  5. Superconducting ac cable

    International Nuclear Information System (INIS)

    Schmidt, F.

    1980-01-01

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de

  6. Design, construction, and in vivo feasibility of a positioning device for irradiation of mice brains using a clinical linear accelerator and intensity modulated radiation therapy.

    Science.gov (United States)

    Rancilio, Nicholas J; Dahl, Shaun; Athanasiadi, Ilektra; Perez-Torres, Carlos J

    2017-12-01

    The goal of this study was to design a positioning device that would allow for selective irradiation of the mouse brain with a clinical linear accelerator. We designed and fabricated an immobilization fixture that incorporates three functions: head stabilizer (through ear bars and tooth bar), gaseous anesthesia delivery and scavenging, and tissue mimic/bolus. Cohorts of five mice were irradiated such that each mouse in the cohort received a unique dose between 1000 and 3000 cGy. DNA damage immunohistochemistry was used to validate an increase in biological effect as a function of radiation dose. Mice were then followed with hematoxylin and eosin (H&E) and anatomical magnetic resonance imaging (MRI). There was evidence of DNA damage throughout the brain proportional to radiation dose. Radiation-induced damage at the prescribed doses, as depicted by H&E, appeared to be constrained to the white matter consistent with radiological observation in human patients. The severity of the damage correlated with the radiation dose as expected. We have designed and manufactured a device that allows us to selectively irradiate the mouse brain with a clinical linear accelerator. However, some off-target effects are possible with large prescription doses.

  7. On the use of the autocorrelation and covariance methods for feedforward control of transverse angle and position jitter in linear particle beam accelerators

    International Nuclear Information System (INIS)

    Barr, D.S.

    1994-01-01

    It is desired to design a predictive feedforward transverse jitter control system to control both angle and position jitter in pulsed linear accelerators. Such a system will increase the accuracy and bandwidth of correction over that of currently available feedback correction systems. Intrapulse correction is performed. An offline process actually ''learns'' the properties of the jitter, and uses these properties to apply correction to the beam. The correction weights calculated offline are downloaded to a real-time analog correction system between macropulses. Jitter data were taken at the Los Alamos National Laboratory (LANL) Ground Test Accelerator (GTA) telescope experiment at Argonne National Laboratory (ANL). The experiment consisted of the LANL telescope connected to the ANL ZGS proton source and linac. A simulation of the correction system using this data was shown to decrease the average rms jitter by a factor of two over that of a comparable standard feedback correction system. The system also improved the correction bandwidth

  8. On the use of the autocorrelation and covariance methods for feedforward control of transverse angle and position jitter in linear particle beam accelerators

    International Nuclear Information System (INIS)

    Barr, D.S.

    1993-01-01

    It is desired to design a predictive feedforward transverse jitter control system to control both angle and position jitter in pulsed linear accelerators. Such a system will increase the accuracy and bandwidth of correction over that of currently available feedback correction systems. Intrapulse correction is performed. An offline process actually open-quotes learnsclose quotes the properties of the jitter, and uses these properties to apply correction to the beam. The correction weights calculated offline are downloaded to a real-time analog correction system between macropulses. Jitter data were taken at the Los Alamos National Laboratory (LANL) Ground Test Accelerator (GTA) telescope experiment at Argonne National Laboratory (ANL). The experiment consisted of the LANL telescope connected to the ANL ZGS proton source and linac. A simulation of the correction system using this data was shown to decrease the average rms jitter by a factor of two over that of a comparable standard feedback correction system. The system also improved the correction bandwidth

  9. Correlation of results obtained by in-vivo optical spectroscopy with measured blood oxygen saturation using a positive linear regression fit

    Science.gov (United States)

    McCormick, Patrick W.; Lewis, Gary D.; Dujovny, Manuel; Ausman, James I.; Stewart, Mick; Widman, Ronald A.

    1992-05-01

    Near infrared light generated by specialized instrumentation was passed through artificially oxygenated human blood during simultaneous sampling by a co-oximeter. Characteristic absorption spectra were analyzed to calculate the ratio of oxygenated to reduced hemoglobin. A positive linear regression fit between diffuse transmission oximetry and measured blood oxygenation over the range 23% to 99% (r2 equals .98, p signal was observed in the patient over time. The procedure was able to be performed clinically without difficulty; rSO2 values recorded continuously demonstrate the usefulness of the technique. Using the same instrumentation, arterial input and cerebral response functions, generated by IV tracer bolus, were deconvoluted to measure mean cerebral transit time. Date collected over time provided a sensitive index of changes in cerebral blood flow as a result of therapeutic maneuvers.

  10. ACS Postflash Characterization

    Science.gov (United States)

    Smith, Linda

    2011-10-01

    This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.

  11. Melanocortin Tetrapeptide Ac-His-DPhe-Arg-Trp-NH2 Modified at the Para Position of the Benzyl Side Chain (DPhe): Importance for Mouse Melanocortin-3 Receptor Agonist versus Antagonist Activity

    OpenAIRE

    Proneth, Bettina; Pogozheva, Irina D.; Portillo, Federico P.; Mosberg, Henry I.; Haskell-Luevano, Carrie

    2008-01-01

    The melanocortin-3 and -4 receptors (MC3R, MC4R) have been implicated in energy homeostasis and obesity. Whereas the physiological role of the MC4R is extensively studied, little is known about the MC3R. One caveat is the limited availability of ligands that are selective for the MC3R. Previous studies identified Ac-His-DPhe(p-I)-Arg-Trp-NH2, which possessed partial agonist/antagonist pharmacology at the mMC3R while retaining full nanomolar agonist pharmacology at the mMC4R. These data allowe...

  12. An apparatus for high speed measurements of small-angle x-ray scattering profiles with a linear position sensitive detector

    International Nuclear Information System (INIS)

    Hashimoto, Takeji; Suehiro, Shoji; Shibayama, Mitsuhiro; Saijo, Kenji; Kawai, Hiromichi

    1981-01-01

    An apparatus for high speed measurements of small-angle X-ray scattering (SAXS) is described. This apparatus utilizes a 12 kW rotating anode X-ray generator, a linear position sensitive proportional counter (multicathode delay line PSPC), and a two-parameter multichannel pulse height analyzer (MCA) with 12 kwords (16 bits/word) memory area available for SAXA intensity data as a function of position (scattering angles) and time slice. The two-parameter MCA is constructed within a microcomputer system, by utilizing its R/W memory for data storage, and the memory incrementing and real-time CRT display is implemented by using two direct memory access (DMA) controllers. The cycle time of the access is about 10 μs. The measuring time for SAXS profiles with this apparatus can be shortened approximately by three orders of magnitude in comparison with the measuring time with SAXS apparatuses utilizing a conventional step-scanning goniometer and a conventional X-ray tube, thus permitting time-resolved analyses of SAXS profiles. Some applications of the apparatus to dynamic SAXS measurements are presented for polymeric systems, the preliminary results of which seem to indicate the possibility of obtaining a new class of data on dynamics in structural transformation, deformation, formation and annihilation in the scale of a few tens to several hundred Angstroms. (author)

  13. Superconductive AC current limiter

    International Nuclear Information System (INIS)

    Bekhaled, M.

    1987-01-01

    This patent describes an AC current limiter for a power transport line including a power supply circuit and feeding a load circuit via an overload circuit-breaker member. The limiter comprises a transformer having a primary winding connected in series between the power supply circuit and the load circuit and at least one secondary winding of superconductor material contained in a cryogenic enclosure and short-circuited on itself. The leakage reactance of the transformer as seen from the primary winding is low, and the resistance of the at least one secondary winding when in the non-superconducting state and as seen from the primary is much greater than the nominal impedance of the transformer. The improvement whereby the at least one secondary winding of the transformer comprises an active winding in association with a set of auxiliary windings. The set of auxiliary windings is constituted by an even number of series-connected auxiliary windings wound in opposite directions, with the total number of turns in one direction being equal to the total number of turns in the opposite direction, and with the thermal capacity of the secondary winding as a whole being sufficiently high to limit the expansion thereof to a value which remains small during the time it takes the circuit-breaking member to operate

  14. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  15. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...

  16. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  17. Relationship between neighbourhood socioeconomic position and neighbourhood public green space availability: An environmental inequality analysis in a large German city applying generalized linear models.

    Science.gov (United States)

    Schüle, Steffen Andreas; Gabriel, Katharina M A; Bolte, Gabriele

    2017-06-01

    The environmental justice framework states that besides environmental burdens also resources may be social unequally distributed both on the individual and on the neighbourhood level. This ecological study investigated whether neighbourhood socioeconomic position (SEP) was associated with neighbourhood public green space availability in a large German city with more than 1 million inhabitants. Two different measures were defined for green space availability. Firstly, percentage of green space within neighbourhoods was calculated with the additional consideration of various buffers around the boundaries. Secondly, percentage of green space was calculated based on various radii around the neighbourhood centroid. An index of neighbourhood SEP was calculated with principal component analysis. Log-gamma regression from the group of generalized linear models was applied in order to consider the non-normal distribution of the response variable. All models were adjusted for population density. Low neighbourhood SEP was associated with decreasing neighbourhood green space availability including 200m up to 1000m buffers around the neighbourhood boundaries. Low neighbourhood SEP was also associated with decreasing green space availability based on catchment areas measured from neighbourhood centroids with different radii (1000m up to 3000 m). With an increasing radius the strength of the associations decreased. Social unequally distributed green space may amplify environmental health inequalities in an urban context. Thus, the identification of vulnerable neighbourhoods and population groups plays an important role for epidemiological research and healthy city planning. As a methodical aspect, log-gamma regression offers an adequate parametric modelling strategy for positively distributed environmental variables. Copyright © 2017 Elsevier GmbH. All rights reserved.

  18. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  19. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  20. Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

    Directory of Open Access Journals (Sweden)

    Vinod Kumar Singh

    2016-09-01

    Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

  1. Effect of electric fields on the stabilization of premixed laminar bunsen flames at low AC frequency: Bi-ionic wind effect

    KAUST Repository

    Kim, Minkuk

    2012-03-01

    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally by applying AC electric fields at low frequency below 60. Hz together with DC in the single electrode configuration. The blowoff velocity has been measured for varying AC voltage and frequency. A transition frequency between low and high frequency regimes has been identified near 40-50. Hz, where AC electric fields have minimal effect on flame stabilization. In the low frequency regime, the blowoff velocity decreased linearly with AC voltage such that the flames became less stable. This was consistent with the DC result, implying the influence of the ionic wind effect. The variation of blowoff velocity with AC frequency showed a non-monotonic behavior in that the velocity decreased and then increased, exhibiting minimum blowoff velocity near 6-8. Hz. Based on the molecular kinetic theory, the developing degree of ionic wind was derived. By considering the ionic wind effects arising from both positive and negative ions in a flame zone, the bi-ionic wind effect successfully explained the non-monotonic behavior of blowoff velocity with AC frequency in the low frequency regime. © 2011 The Combustion Institute.

  2. AC Application of HTS Conductors in Highly Dynamic Electric Motors

    International Nuclear Information System (INIS)

    Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K

    2006-01-01

    Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit

  3. Advanced AC Motor Control

    Energy Technology Data Exchange (ETDEWEB)

    Kazmierkowski, M.P. [Institute of Control and Industrial Electronics, Warsaw University of Technology, Warszawa (Poland)

    1997-12-31

    In this paper a review of control methods for high performance PWM inverter-fed induction motor drives is presented. Starting from the description of an induction motor by the help of the space vectors, three basic control strategic are discussed. As first, the most popular Field Oriented Control (FOC) is described. Secondly, the Direct Torque and Flux vector Control (DTFC) method, which - in contrast to FOC - depart from idea of coordinate transformation and analogy with DC motor, is briefly characterized. The last group is based on Feedback Linearization Control (FLC) and can be easy combined with sliding mode control. The simulation and experimental oscillograms that illustrate the performance of the discussed control strategies are shown. (orig.) 35 refs.

  4. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  5. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  6. Detection of Genetic Modification 'ac2' in Potato Foodstuffs

    Directory of Open Access Journals (Sweden)

    Petr Kralik

    2009-01-01

    Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

  7. An Improved Treatment of AC Space Charge Fields in Large Signal Simulation Codes

    National Research Council Canada - National Science Library

    Dialetis, D; Chernin, D; Antonsen, Jr., T. M; Levush, B

    2006-01-01

    An accurate representation of the AC space charge electric field is required in order to be able to predict the performance of linear beam tubes, including TWT's and klystrons, using a steady state...

  8. Long-Term Follow-Up of Cardiac Function and Quality of Life for Patients in NSABP Protocol B-31/NRG Oncology: A Randomized Trial Comparing the Safety and Efficacy of Doxorubicin and Cyclophosphamide (AC) Followed by Paclitaxel With AC Followed by Paclitaxel and Trastuzumab in Patients With Node-Positive Breast Cancer With Tumors Overexpressing Human Epidermal Growth Factor Receptor 2.

    Science.gov (United States)

    Ganz, Patricia A; Romond, Edward H; Cecchini, Reena S; Rastogi, Priya; Geyer, Charles E; Swain, Sandra M; Jeong, Jong-Hyeon; Fehrenbacher, Louis; Gross, Howard M; Brufsky, Adam M; Flynn, Patrick J; Wahl, Tanya A; Seay, Thomas E; Wade, James L; Biggs, David D; Atkins, James N; Polikoff, Jonathan; Zapas, John L; Mamounas, Eleftherios P; Wolmark, Norman

    2017-12-10

    Purpose Early cardiac toxicity is a risk associated with adjuvant chemotherapy plus trastuzumab. However, objective measures of cardiac function and health-related quality of life are lacking in long-term follow-up of patients who remain cancer free after completion of adjuvant treatment. Patients and Methods Patients in NSABP Protocol B-31 received anthracycline and taxane chemotherapy with or without trastuzumab for adjuvant treatment of node-positive, human epidermal growth factor receptor 2-positive early-stage breast cancer. A long-term follow-up assessment was undertaken for patients who were alive and disease free, which included measurement of left ventricular ejection fraction by multigated acquisition scan along with patient-reported outcomes using the Duke Activity Status Index (DASI), the Medical Outcomes Study questionnaire, and a review of current medications and comorbid conditions. Results At a median follow-up of 8.8 years among eligible participants, five (4.5%) of 110 in the control group and 10 (3.4%) of 297 in the trastuzumab group had a > 10% decline in left ventricular ejection fraction from baseline to a value < 50%. Lower DASI scores correlated with age and use of medications for hypertension, cardiac conditions, diabetes, and hyperlipidemia, but not with whether patients had received trastuzumab. Conclusion In patients without underlying cardiac disease at baseline, the addition of trastuzumab to adjuvant anthracycline and taxane-based chemotherapy does not result in long-term worsening of cardiac function, cardiac symptoms, or health-related quality of life. The DASI questionnaire may provide a simple and useful tool for monitoring patient-reported changes that reflect cardiac function.

  9. Nuclear structure of 231Ac

    International Nuclear Information System (INIS)

    Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

    2008-01-01

    The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

  10. The application in detection the position accuracy of the multi-leaf collimator of Varian linear accelerator with dynamic therapy log files

    International Nuclear Information System (INIS)

    Li Changhu; Xu Liming; Teng Jianjian; Ge Wei; Zhang Jun; Ma Guangdong

    2010-01-01

    Objective: To explorer the application in detection the position accuracy of the multileaf collimator of Varian accelerator with dynamic therapy log files. Methods: A pre-designed MLC format files named PMLC for two Varian accelerators, the dynamic treatment log files were recorded 10 times on a different date, and be converted into the MLC format files named DMLC, compared with the original plan PMLC, so we can analysis two files for each leaf position deviation. In addition, we analysis the repeatability of MLC leaves position accuracy between 10 dynalog files of two accelerators. Results: No statistically significant difference between the average position of the 10 times leaf position of the two accelerators,their were 0.29 -0.29 and 0.29 -0.30 (z = -0.77, P=0.442). About 40%, 30%, 20% and 10% of the leaf position deviation was at ≤0.2 mm, 0.3 mm, 0.5 mm and 0.4 mm, respectively. the maximum value was 0.5 mm. More than 86% of the leaf position are completely coincident between 10 dynamic treatment files of two accelerators. The rate of position deviation no more 0. 05 mm was 96. 6% and 97.3%, respectively. And the maximum value was 0.09 mm. Conclusions: Dynamic treatment log file is a splendid tool in testing the actual position of multi-leaf collimator. The multi-leaf collimator of two accelerators be detected are precise and stabilized. (authors)

  11. AC ignition of HID lamps

    NARCIS (Netherlands)

    Sobota, A.; Kanters, J.H.M.; Manders, F.; Veldhuizen, van E.M.; Haverlag, M.

    2010-01-01

    Our aim was to examine the starting behaviour of mid-pressure argon discharges in pin-pin (point-to-point) geometry, typically used in HID lamps. We focused our work on AC ignition of 300 and 700 mbar Ar discharges in Philips 70W standard burners. Frequency was varied between 200 kHz and 1 MHz. In

  12. Linear algebra

    CERN Document Server

    Shilov, Georgi E

    1977-01-01

    Covers determinants, linear spaces, systems of linear equations, linear functions of a vector argument, coordinate transformations, the canonical form of the matrix of a linear operator, bilinear and quadratic forms, Euclidean spaces, unitary spaces, quadratic forms in Euclidean and unitary spaces, finite-dimensional space. Problems with hints and answers.

  13. A Differential Monolithically Integrated Inductive Linear Displacement Measurement Microsystem

    Directory of Open Access Journals (Sweden)

    Matija Podhraški

    2016-03-01

    Full Text Available An inductive linear displacement measurement microsystem realized as a monolithic Application-Specific Integrated Circuit (ASIC is presented. The system comprises integrated microtransformers as sensing elements, and analog front-end electronics for signal processing and demodulation, both jointly fabricated in a conventional commercially available four-metal 350-nm CMOS process. The key novelty of the presented system is its full integration, straightforward fabrication, and ease of application, requiring no external light or magnetic field source. Such systems therefore have the possibility of substituting certain conventional position encoder types. The microtransformers are excited by an AC signal in MHz range. The displacement information is modulated into the AC signal by a metal grating scale placed over the microsystem, employing a differential measurement principle. Homodyne mixing is used for the demodulation of the scale displacement information, returned by the ASIC as a DC signal in two quadrature channels allowing the determination of linear position of the target scale. The microsystem design, simulations, and characterization are presented. Various system operating conditions such as frequency, phase, target scale material and distance have been experimentally evaluated. The best results have been achieved at 4 MHz, demonstrating a linear resolution of 20 µm with steel and copper scale, having respective sensitivities of 0.71 V/mm and 0.99 V/mm.

  14. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  15. Linear Approximations

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 5. Taylor's Polynomial and Infinitesimals. Ritavan. Classroom Volume 19 Issue 5 May 2014 pp 466-470. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/019/05/0466-0470. Keywords.

  16. Linear Approximations

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 5 ... email addresses used by the office of Indian Academy of Sciences, including those of the staff, the journals, various programmes, and Current Science, has changed from 'ias.ernet.in' (or 'academy.ias.ernet.in') to 'ias.ac.in'.

  17. Production of positive pions from polarized protons by linearly polarized photons in the energy region 300--420 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Get' man, V.A.; Gorbenko, V.G.; Grushin, V.F.; Derkach, A.Y.; Zhebrovskii, Y.V.; Karnaukhov, I.M.; Kolesnikov, L.Y.; Luchanin, A.A.; Rubashkin, A.L.; Sanin, V.M.; Sorokin, P.V.; Sporov, E.A.; Telegin, Y.N.; Shalatskii, S.V.

    1980-10-01

    A technique for measurement of the polarization observables ..sigma.., P, and T for the reaction ..gamma..p..-->..n..pi../sup +/ in a doubly polarized experiment (polarized proton target + linearly polarized photon beam) is described. Measurements of the angular distributions of these observables in the range of pion emission angles 30--150/sup 0/ are presented for four photon energies from 300 to 420 MeV. Inclusion of the new experimental data in an energy-independent multipole analysis of photoproduction from protons permits a more reliable selection of solutions to be made.

  18. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  19. Effect of removing the common mode errors on linear regression analysis of noise amplitudes in position time series of a regional GPS network & a case study of GPS stations in Southern California

    Science.gov (United States)

    Jiang, Weiping; Ma, Jun; Li, Zhao; Zhou, Xiaohui; Zhou, Boye

    2018-05-01

    The analysis of the correlations between the noise in different components of GPS stations has positive significance to those trying to obtain more accurate uncertainty of velocity with respect to station motion. Previous research into noise in GPS position time series focused mainly on single component evaluation, which affects the acquisition of precise station positions, the velocity field, and its uncertainty. In this study, before and after removing the common-mode error (CME), we performed one-dimensional linear regression analysis of the noise amplitude vectors in different components of 126 GPS stations with a combination of white noise, flicker noise, and random walking noise in Southern California. The results show that, on the one hand, there are above-moderate degrees of correlation between the white noise amplitude vectors in all components of the stations before and after removal of the CME, while the correlations between flicker noise amplitude vectors in horizontal and vertical components are enhanced from un-correlated to moderately correlated by removing the CME. On the other hand, the significance tests show that, all of the obtained linear regression equations, which represent a unique function of the noise amplitude in any two components, are of practical value after removing the CME. According to the noise amplitude estimates in two components and the linear regression equations, more accurate noise amplitudes can be acquired in the two components.

  20. A combined stretching-tilting mechanism produces negative, zero and positive linear thermal expansion in a semi-flexible Cd(II)-MOF.

    Science.gov (United States)

    Lama, Prem; Das, Raj Kumar; Smith, Vincent J; Barbour, Leonard J

    2014-06-21

    A novel semi-flexible Cd(II)-MOF has been synthesized and characterized by variable temperature powder and single-crystal X-ray diffraction. The material displays an unusual combination of thermal expansion (TE) i.e. negative, zero and positive, which is an extremely rare finding, especially for metal-organic frameworks as a result of a combined stretching-tilting mechanism.

  1. Effect of AC electric fields on the stabilization of premixed bunsen flames

    KAUST Repository

    Kim, Minkuk

    2011-01-01

    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

  2. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  3. Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte

    International Nuclear Information System (INIS)

    García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.

    2016-01-01

    The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.

  4. AC losses in high Tc superconductors

    International Nuclear Information System (INIS)

    Campbell, A.M.

    1998-01-01

    Full text: Although in principle the AC losses in high Tc superconductors can be calculated from the critical current density, a number of complications make this difficult. The Jc is very field dependent, there are intergranular and intragranular critical currents, the material is anisotropic and there is usually a large demagnetising factor. Care must be taken in interpreting electrical measurements since the voltage depends on the position of the contacts. In spite of these complications the simple theory of Norris has proved surprisingly successful and arguments will be presented as to why this is the case. Results on a range of tapes will be compared with theory and numerical methods for predicting losses discussed. Finally a theory for coupling losses will be given for a composite conductor with high resistance barriers round the filaments

  5. Fault tolerant linear actuator

    Science.gov (United States)

    Tesar, Delbert

    2004-09-14

    In varying embodiments, the fault tolerant linear actuator of the present invention is a new and improved linear actuator with fault tolerance and positional control that may incorporate velocity summing, force summing, or a combination of the two. In one embodiment, the invention offers a velocity summing arrangement with a differential gear between two prime movers driving a cage, which then drives a linear spindle screw transmission. Other embodiments feature two prime movers driving separate linear spindle screw transmissions, one internal and one external, in a totally concentric and compact integrated module.

  6. Linear equations and rap battles: how students in a wired classroom utilized the computer as a resource to coordinate personal and mathematical positional identities in hybrid spaces

    Science.gov (United States)

    Langer-Osuna, Jennifer

    2015-03-01

    This paper draws on the constructs of hybridity, figured worlds, and cultural capital to examine how a group of African-American students in a technology-driven, project-based algebra classroom utilized the computer as a resource to coordinate personal and mathematical positional identities during group work. Analyses of several vignettes of small group dynamics highlight how hybridity was established as the students engaged in multiple on-task and off-task computer-based activities, each of which drew on different lived experiences and forms of cultural capital. The paper ends with a discussion on how classrooms that make use of student-led collaborative work, and where students are afforded autonomy, have the potential to support the academic engagement of students from historically marginalized communities.

  7. Linear Accelerators

    International Nuclear Information System (INIS)

    Vretenar, M

    2014-01-01

    The main features of radio-frequency linear accelerators are introduced, reviewing the different types of accelerating structures and presenting the main characteristics aspects of linac beam dynamics

  8. Linearization Method and Linear Complexity

    Science.gov (United States)

    Tanaka, Hidema

    We focus on the relationship between the linearization method and linear complexity and show that the linearization method is another effective technique for calculating linear complexity. We analyze its effectiveness by comparing with the logic circuit method. We compare the relevant conditions and necessary computational cost with those of the Berlekamp-Massey algorithm and the Games-Chan algorithm. The significant property of a linearization method is that it needs no output sequence from a pseudo-random number generator (PRNG) because it calculates linear complexity using the algebraic expression of its algorithm. When a PRNG has n [bit] stages (registers or internal states), the necessary computational cost is smaller than O(2n). On the other hand, the Berlekamp-Massey algorithm needs O(N2) where N(≅2n) denotes period. Since existing methods calculate using the output sequence, an initial value of PRNG influences a resultant value of linear complexity. Therefore, a linear complexity is generally given as an estimate value. On the other hand, a linearization method calculates from an algorithm of PRNG, it can determine the lower bound of linear complexity.

  9. SNS AC Power Distribution and Reliability of AC Power Supply

    CERN Document Server

    Holik, Paul S

    2005-01-01

    The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*

  10. Improving the precision of linear optics measurements based on turn-by-turn beam position monitor data after a pulsed excitation in lepton storage rings

    Directory of Open Access Journals (Sweden)

    L. Malina

    2017-08-01

    Full Text Available Beam optics control is of critical importance for machine performance and protection. Nowadays, turn-by-turn (TbT beam position monitor (BPM data are increasingly exploited as they allow for fast and simultaneous measurement of various optics quantities. Nevertheless, so far the best documented uncertainty of measured β-functions is of about 10‰ rms. In this paper we compare the β-functions of the ESRF storage ring measured from two different TbT techniques—the N-BPM and the Amplitude methods—with the ones inferred from a measurement of the orbit response matrix (ORM. We show how to improve the precision of TbT techniques by refining the Fourier transform of TbT data with properly chosen excitation amplitude. The precision of the N-BPM method is further improved by refining the phase advance measurement. This represents a step forward compared to standard TbT measurements. First experimental results showing the precision of β-functions pushed down to 4‰ both in TbT and ORM techniques are reported and commented.

  11. Linear algebra

    CERN Document Server

    Said-Houari, Belkacem

    2017-01-01

    This self-contained, clearly written textbook on linear algebra is easily accessible for students. It begins with the simple linear equation and generalizes several notions from this equation for the system of linear equations and introduces the main ideas using matrices. It then offers a detailed chapter on determinants and introduces the main ideas with detailed proofs. The third chapter introduces the Euclidean spaces using very simple geometric ideas and discusses various major inequalities and identities. These ideas offer a solid basis for understanding general Hilbert spaces in functional analysis. The following two chapters address general vector spaces, including some rigorous proofs to all the main results, and linear transformation: areas that are ignored or are poorly explained in many textbooks. Chapter 6 introduces the idea of matrices using linear transformation, which is easier to understand than the usual theory of matrices approach. The final two chapters are more advanced, introducing t...

  12. AcEST: BP912900 [AcEST

    Lifescience Database Archive (English)

    Full Text Available /121 (24%), Positives = 49/121 (40%), Gaps = 2/121 (1%) Frame = +1 Query: 112 LLHVPSSTCTWSSLLAFGNVFSCMFSNFSH....5 Identities = 21/53 (39%), Positives = 28/53 (52%) Frame = +1 Query: 142 WSSLLAFGNVFSCMFSNFSHVFPEVLSYLVPLH...(39%), Positives = 28/53 (52%) Frame = +1 Query: 142 WSSLLAFGNVFSCMFSNFSHVFPEVLSYLVPLHASRLVSFLLSKWPILCCLYT 3

  13. Linear algebra

    CERN Document Server

    Stoll, R R

    1968-01-01

    Linear Algebra is intended to be used as a text for a one-semester course in linear algebra at the undergraduate level. The treatment of the subject will be both useful to students of mathematics and those interested primarily in applications of the theory. The major prerequisite for mastering the material is the readiness of the student to reason abstractly. Specifically, this calls for an understanding of the fact that axioms are assumptions and that theorems are logical consequences of one or more axioms. Familiarity with calculus and linear differential equations is required for understand

  14. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  15. The AC photovoltaic module is here!

    Science.gov (United States)

    Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

    1997-02-01

    This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

  16. Cosmic Shear With ACS Pure Parallels

    Science.gov (United States)

    Rhodes, Jason

    2002-07-01

    Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan textiti {F775W} we will measure for the first time: beginlistosetlength sep0cm setlengthemsep0cm setlengthopsep0cm em the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

  17. Ac system interruption analysis of an orthogonal-core type dc-ac converter. Koryu keito shadanji no chokko jishinkei dc-ac renkeiyo henkanki no dosa kaiseki

    Energy Technology Data Exchange (ETDEWEB)

    Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College

    1991-04-30

    This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.

  18. Study on ac losses of HTS coil carrying ac transport current

    International Nuclear Information System (INIS)

    Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

    2005-01-01

    Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

  19. Linear programming

    CERN Document Server

    Solow, Daniel

    2014-01-01

    This text covers the basic theory and computation for a first course in linear programming, including substantial material on mathematical proof techniques and sophisticated computation methods. Includes Appendix on using Excel. 1984 edition.

  20. Linear algebra

    CERN Document Server

    Liesen, Jörg

    2015-01-01

    This self-contained textbook takes a matrix-oriented approach to linear algebra and presents a complete theory, including all details and proofs, culminating in the Jordan canonical form and its proof. Throughout the development, the applicability of the results is highlighted. Additionally, the book presents special topics from applied linear algebra including matrix functions, the singular value decomposition, the Kronecker product and linear matrix equations. The matrix-oriented approach to linear algebra leads to a better intuition and a deeper understanding of the abstract concepts, and therefore simplifies their use in real world applications. Some of these applications are presented in detailed examples. In several ‘MATLAB-Minutes’ students can comprehend the concepts and results using computational experiments. Necessary basics for the use of MATLAB are presented in a short introduction. Students can also actively work with the material and practice their mathematical skills in more than 300 exerc...

  1. Linear algebra

    CERN Document Server

    Berberian, Sterling K

    2014-01-01

    Introductory treatment covers basic theory of vector spaces and linear maps - dimension, determinants, eigenvalues, and eigenvectors - plus more advanced topics such as the study of canonical forms for matrices. 1992 edition.

  2. Linear Models

    CERN Document Server

    Searle, Shayle R

    2012-01-01

    This 1971 classic on linear models is once again available--as a Wiley Classics Library Edition. It features material that can be understood by any statistician who understands matrix algebra and basic statistical methods.

  3. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.

    2017-07-21

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.

  4. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  5. LINEAR ACCELERATOR

    Science.gov (United States)

    Christofilos, N.C.; Polk, I.J.

    1959-02-17

    Improvements in linear particle accelerators are described. A drift tube system for a linear ion accelerator reduces gap capacity between adjacent drift tube ends. This is accomplished by reducing the ratio of the diameter of the drift tube to the diameter of the resonant cavity. Concentration of magnetic field intensity at the longitudinal midpoint of the external sunface of each drift tube is reduced by increasing the external drift tube diameter at the longitudinal center region.

  6. Help Desk Answers: Surgery vs conservative management for AC joint repair: How do the 2 compare?

    Science.gov (United States)

    Matchin, Bruce; Yee, Bruce; Mott, Timothy

    2016-04-01

    When not considering the grade of acromioclavicular (AC) joint dislocation, both conservative and surgical management lead to positive outcomes, although surgically managed patients require more time out of work.

  7. Free piston variable-stroke linear-alternator generator

    Science.gov (United States)

    Haaland, Carsten M.

    1998-01-01

    A free-piston variable stroke linear-alternator AC power generator for a combustion engine. An alternator mechanism and oscillator system generates AC current. The oscillation system includes two oscillation devices each having a combustion cylinder and a flying turnbuckle. The flying turnbuckle moves in accordance with the oscillation device. The alternator system is a linear alternator coupled between the two oscillation devices by a slotted connecting rod.

  8. Student Observations of Double Star Delta Orionis (STFA 14 AC)

    Science.gov (United States)

    Estrada, Reed; Aguilera, Sophia; Bowden, Sam; Gillette, Travis; Givens, Jalynn; Reder, Gabriel; Rhoades, Breauna; Sharpe, Scott; Shattles, Jenna; Cha, Brendon; Do, Vicky; Ewing, Malachi; Kiamco, Alex Junior; Nelms, Brenda; Peña, Emilie; Maricarmen, Richard; Thielen, Austin

    2018-01-01

    A group of eight eighth graders and eight high schoolers studied the double star STFA 14 AC. They used the procedure from Argyle's book to get the separation and position angle for the double star. The students used a Celestron C8 Schmidt-Cassegrain telescope with a Baader Planetarium microguide eyepiece with similar markings to a Celestron Eyepiece. The students determined the separation to be 56 arcseconds and the position angle to be 4.19°. They compared their results to the Washington Double Star Catalog and found that they had a 2.88 arcseconds difference in separation and a 2.19° in position angle.

  9. Linear regression

    CERN Document Server

    Olive, David J

    2017-01-01

    This text covers both multiple linear regression and some experimental design models. The text uses the response plot to visualize the model and to detect outliers, does not assume that the error distribution has a known parametric distribution, develops prediction intervals that work when the error distribution is unknown, suggests bootstrap hypothesis tests that may be useful for inference after variable selection, and develops prediction regions and large sample theory for the multivariate linear regression model that has m response variables. A relationship between multivariate prediction regions and confidence regions provides a simple way to bootstrap confidence regions. These confidence regions often provide a practical method for testing hypotheses. There is also a chapter on generalized linear models and generalized additive models. There are many R functions to produce response and residual plots, to simulate prediction intervals and hypothesis tests, to detect outliers, and to choose response trans...

  10. Linear Colliders

    International Nuclear Information System (INIS)

    Alcaraz, J.

    2001-01-01

    After several years of study e''+ e''- linear colliders in the TeV range have emerged as the major and optimal high-energy physics projects for the post-LHC era. These notes summarize the present status form the main accelerator and detector features to their physics potential. The LHC era. These notes summarize the present status, from the main accelerator and detector features to their physics potential. The LHC is expected to provide first discoveries in the new energy domain, whereas an e''+ e''- linear collider in the 500 GeV-1 TeV will be able to complement it to an unprecedented level of precision in any possible areas: Higgs, signals beyond the SM and electroweak measurements. It is evident that the Linear Collider program will constitute a major step in the understanding of the nature of the new physics beyond the Standard Model. (Author) 22 refs

  11. Linear algebra

    CERN Document Server

    Edwards, Harold M

    1995-01-01

    In his new undergraduate textbook, Harold M Edwards proposes a radically new and thoroughly algorithmic approach to linear algebra Originally inspired by the constructive philosophy of mathematics championed in the 19th century by Leopold Kronecker, the approach is well suited to students in the computer-dominated late 20th century Each proof is an algorithm described in English that can be translated into the computer language the class is using and put to work solving problems and generating new examples, making the study of linear algebra a truly interactive experience Designed for a one-semester course, this text adopts an algorithmic approach to linear algebra giving the student many examples to work through and copious exercises to test their skills and extend their knowledge of the subject Students at all levels will find much interactive instruction in this text while teachers will find stimulating examples and methods of approach to the subject

  12. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  13. AcEST: BP915243 [AcEST

    Lifescience Database Archive (English)

    Full Text Available NGTPSISSNVSSLSAQTPVTTMSMKAHALPSIRDTSGPQSTSANVHLSCHLPISANVSPS 278 + +PS SS+ SS S+ +P ++ + + PS ++S P S+S++ S ...= 26/83 (31%), Positives = 41/83 (49%), Gaps = 1/83 (1%) Frame = -2 Query: 451 TPSISSNVSSLSAQTPVTTMSMKAHALPSIRDTSGPQSTSA...tities = 19/66 (28%), Positives = 29/66 (43%) Frame = -2 Query: 451 TPSISSNVSSLSAQTPVTTMSMKAHALPSIRDTSGPQSTSA...46%) Frame = -2 Query: 451 TPSISSNVSSLSAQTPVTTMSMKAHALPSIRDTSGPQSTSANVHLSCHLPISANVSPSMS 272 +P ++S S SA TP A...y: 463 PINGTPSISSNVSSLSAQ-----TPVTTMSMKAHALPSIRDTSGPQS-TSANVHLSCHLP 302 P+ TP SS

  14. Definition of a reference metrology network for the positioning of a large linear accelerator; Definition d'un reseau de reference metrologique pour le positionnement d'un grand accelerateur lineaire

    Energy Technology Data Exchange (ETDEWEB)

    Becker, F

    2003-12-15

    This thesis is a study of the Compact Linear Collider (CLIC) alignment system, a project of linear accelerator of about 30 km long of the European Organization for Nuclear Research (CERN). The pre-alignment tolerance on the transverse positions of the components of the CLIC linacs is typically ten microns over distances of 200 m. This research is a consequence of 10 years work, where several sets of special sensors dedicated to metrology have been adapted for the CLIC project. Most of these sensors deliver measurements linked to geometric references sensitive to gravity fluctuation. An important part of this work is therefore dedicated to study the gravity disruptions as a high level of accuracy is required. The parameters to take into account in the use of the hydrostatic leveling have thus been highlighted. A proposal of configuration of the system alignment based on a selection of sensors has also been given in this research. Computer models of different possible configurations have been presented. As the existing computing software was inappropriate, a new object oriented software package has been developed, to ensure future upgrades. An optimized configuration of the network has been defined from a set of simulations. Finally, due to problems in the use of hydrostatic leveling systems, a solution based on the use of a long laser beam as an alternative solution is discussed. (author)

  15. AcEST: BP911971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available th = 373 Score = 35.4 bits (80), Expect = 1.4 Identities = 21/53 (39%), Positives = 28/53 (52%) Frame = -3 Query: 362 WSSLLAFGNVFSCMF... -3 Query: 362 WSSLLAFGNVFSCMFSNFSHVFPEVLSYLVPLHASRLVSFLLSKWPILCCLYT 204 +S LLAF NV SC+ S FS +L L P+H + + L

  16. AcEST: DK957103 [AcEST

    Lifescience Database Archive (English)

    Full Text Available + ++ TD ++VEKS+N Sbjct: 30 SLSFSTFSGLK--STPFTSSHRRILPS-TTVTKQQFSVRASAAVETLEKTDAAIVEKSVN 86 Query: 278 TIRFLAVDAVEKANSGHPGLPMGCAPM...GHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCM 457 TIRFLA+DAVEKANSGHPGLPMGCAPMGHILYDE+M+YNPKNPYWFNRD...RFVLSAGHGCM Sbjct: 87 TIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGC...77/82 (93%), Positives = 80/82 (97%), Gaps = 1/82 (1%) Frame = +2 Query: 245 TDVS-LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPM...GHILYDEIMRYNPKNPYWFNR 421 TD+ LVEKS+NTIRFLA+DAVEKANSGHPGLPMGCAPMGHILYDEIM

  17. AcEST: DK960741 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIVEKSVN 86 Query: 350 TIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCM 529 TIRFLA+DAVEKANSGHPGLPMGCAPM...GHILYDE+M+YNPKNPYWFNRDRFVLSAGHGCM Sbjct: 87 TIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGH...VEKSINTIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPYWFNRDRFVL 508 L+EKS+NTIRFLA+DAVEKANSGHPGLPMGCAPM...GH+LYDE+MRYNPKNPYWFNRDRFVL Sbjct: 15 LLEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPYWFN...16/126 (92%), Positives = 119/126 (94%), Gaps = 1/126 (0%) Frame = +2 Query: 317 TDVS-LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPM

  18. AcEST: DK963533 [AcEST

    Lifescience Database Archive (English)

    Full Text Available RASAAVETLEKTDAAIVEKSVN 86 Query: 348 TIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPY...WFNRDRFVLSAGHGCM 527 TIRFLA+DAVEKANSGHPGLPMGCAPMGHILYDE+M+YNPKNPYWFNRDRFVLSAGHGCM Sbjct: 87 TIRFLAIDAVEKANSGHPGLPMGCAPM... = 9e-54 Identities = 93/100 (93%), Positives = 99/100 (99%) Frame = +3 Query: 327 LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPM...GHILYDEIMRYNPKNPYWFNRDRFVL 506 L+EKS+NTIRFLA+DAVEKANSGHPGLPMGCAPMGH+LYDE+MRYNPKNPYWFNRDRFVL Sbjct: ...15 LLEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPYWFNRDRFVL 74 Query: 507 SAG

  19. AcEST: DK960997 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 30 SLSFSTFSGLK--STPFTSSHRRILPS-TTVTKQQFSVRASAAVETLEKTDAAIVEKSVN 86 Query: 341 TIRFLAVDAVEKANSGHPGLPMGCAPM...GHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCM 520 TIRFLA+DAVEKANSGHPGLPMGCAPMGHILYDE+M+YNPKNPYWF...NRDRFVLSAGHGCM Sbjct: 87 TIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCM 146 Query: 521 LQYALLH...108/115 (93%), Positives = 114/115 (99%) Frame = +2 Query: 320 LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEIMRY...NPKNPYWFNRDRFVL 499 L+EKS+NTIRFLA+DAVEKANSGHPGLPMGCAPMGH+LYDE+MRYNPKNPYWFNRDRFVL

  20. AcEST: DK961003 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AAIVEKSVN 86 Query: 350 TIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCM 529 TIRFLA+DAVEKANSGHPGLPMGCAPM...GHILYDE+M+YNPKNPYWFNRDRFVLSAGHGCM Sbjct: 87 TIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAG...LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEIMRYNPKNPYWFNRDRFVL 508 L+EKS+NTIRFLA+DAVEKANSGHPGLPMGCAPM...GH+LYDE+MRYNPKNPYWFNRDRFVL Sbjct: 15 LLEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYNPKNPYWF...116/126 (92%), Positives = 119/126 (94%), Gaps = 1/126 (0%) Frame = +2 Query: 317 TDVS-LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPM

  1. AcEST: DK961337 [AcEST

    Lifescience Database Archive (English)

    Full Text Available : 30 SLSFSTFSGLK--STPFTSSHRRILPS-TTVTKQQFSVRASAAVETLEKTDAAIVEKSVN 86 Query: 341 TIRFLAVDAVEKANSGHPGLPMGCAP...MGHILYDEIMRYNPKNPYWFNRDRFVLSAGHGCM 520 TIRFLA+DAVEKANSGHPGLPMGCAPMGHILYDE+M+YNPKNPY...WFNRDRFVLSAGHGCM Sbjct: 87 TIRFLAIDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCM 146 Query: 521 LQYAL...es = 109/116 (93%), Positives = 115/116 (99%) Frame = +2 Query: 320 LVEKSINTIRFLAVDAVEKANSGHPGLPMGCAPMGHILYD...EIMRYNPKNPYWFNRDRFVL 499 L+EKS+NTIRFLA+DAVEKANSGHPGLPMGCAPMGH+LYDE+MRYNPKNPYWFNRD

  2. Linear programming

    CERN Document Server

    Karloff, Howard

    1991-01-01

    To this reviewer’s knowledge, this is the first book accessible to the upper division undergraduate or beginning graduate student that surveys linear programming from the Simplex Method…via the Ellipsoid algorithm to Karmarkar’s algorithm. Moreover, its point of view is algorithmic and thus it provides both a history and a case history of work in complexity theory. The presentation is admirable; Karloff's style is informal (even humorous at times) without sacrificing anything necessary for understanding. Diagrams (including horizontal brackets that group terms) aid in providing clarity. The end-of-chapter notes are helpful...Recommended highly for acquisition, since it is not only a textbook, but can also be used for independent reading and study. —Choice Reviews The reader will be well served by reading the monograph from cover to cover. The author succeeds in providing a concise, readable, understandable introduction to modern linear programming. —Mathematics of Computing This is a textbook intend...

  3. AcEST: DK952771 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ves = 33/70 (47%), Gaps = 5/70 (7%) Frame = +1 Query: 442 APQLKPSDSQTVHLRPSAPPANEEQTATASAHSAP-----QLKPSAPS...0/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 433 LPQAPQLKPSDSQTVHLRPSAPPA-NEEQTATASAHSAPQLKPSAPSANGEQTATAS...6%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Frame = +1 Query: 433 LPQAPQLKPSDSQTVHLRPSAPPA-NEEQTATASAHSAPQLKPSAPS...= 28/56 (50%) Frame = +1 Query: 445 PQLKPSDSQTVHLRPSAPPANEEQTATASAHSAPQLKPSAPSANG...y: 436 PQAPQLKPSDS--QTV----HLRPSAPPANEEQTATASAHSAPQLKPSAPSANGEQT-AT 594 PQAPQ +P Q V ++PSAPP +Q A S P +P+ P

  4. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

  5. A Simple and General Approach to Determination of Self and Mutual Inductances for AC machines

    DEFF Research Database (Denmark)

    Lu, Kaiyuan; Rasmussen, Peter Omand; Ritchie, Ewen

    2011-01-01

    Modelling of AC electrical machines plays an important role in electrical engineering education related to electrical machine design and control. One of the fundamental requirements in AC machine modelling is to derive the self and mutual inductances, which could be position dependant. Theories...... developed so far for inductance determination are often associated with complicated machine magnetic field analysis, which exhibits a difficulty for most students. This paper describes a simple and general approach to the determination of self and mutual inductances of different types of AC machines. A new...... determination are given for a 3-phase, salient-pole synchronous machine, and an induction machine....

  6. AC distribution system for TFTR pulsed loads

    International Nuclear Information System (INIS)

    Carroll, R.F.; Ramakrishnan, S.; Lemmon, G.N.; Moo, W.I.

    1977-01-01

    This paper outlines the AC distribution system associated with the Tokamak Fusion Test Reactor and discusses the significant areas related to design, protection, and equipment selection, particularly where there is a departure from normal utility and industrial applications

  7. Nonlinear AC susceptibility, surface and bulk shielding

    Science.gov (United States)

    van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.

    1996-02-01

    We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.

  8. Logistics Reduction: Advanced Clothing System (ACS)

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

  9. Marketingová komunikace AC Sparta Praha

    OpenAIRE

    Fanta, Jan

    2016-01-01

    Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...

  10. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  11. AcEST: BP912712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  12. AcEST: DK948019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK948019 CL3Contig1 Show DK948019 Clone id TST38A01NGRL0002_D04 Library TST38 Length 716... Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_D04. 5' end sequence. Accession DK948019...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK94801...database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK948019|Adiantum capillus-veneris mRNA, c...th = 396 Score = 313 bits (801), Expect = 9e-84 Identities = 166/213 (77%), Posit

  13. Transport AC losses in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  14. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  15. Measurement of IR optics with linear coupling's action-angle parametrization

    Science.gov (United States)

    Luo, Y.; Bai, M.; Pilat, F.; Satogata, T.; Trbojevic, D.

    2005-08-01

    Linear coupling’s action-angle parametrization is convenient for interpretation of turn-by-turn beam position monitor (BPM) data. We demonstrate how to apply this parametrization to extract Twiss and coupling parameters in interaction regions (IRs), using BPMs on each side of a long IR drift region. Example data were acquired at the Relativistic Heavy Ion Collider, using an ac dipole to excite a single transverse eigenmode. We have measured the waist of the β function and its Twiss and coupling parameters.

  16. Measurement of IR optics with linear coupling’s action-angle parametrization

    Directory of Open Access Journals (Sweden)

    Y. Luo

    2005-08-01

    Full Text Available Linear coupling’s action-angle parametrization is convenient for interpretation of turn-by-turn beam position monitor (BPM data. We demonstrate how to apply this parametrization to extract Twiss and coupling parameters in interaction regions (IRs, using BPMs on each side of a long IR drift region. Example data were acquired at the Relativistic Heavy Ion Collider, using an ac dipole to excite a single transverse eigenmode. We have measured the waist of the β function and its Twiss and coupling parameters.

  17. Reduction of Linear Programming to Linear Approximation

    OpenAIRE

    Vaserstein, Leonid N.

    2006-01-01

    It is well known that every Chebyshev linear approximation problem can be reduced to a linear program. In this paper we show that conversely every linear program can be reduced to a Chebyshev linear approximation problem.

  18. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  19. Application of independent component analysis to ac dipole based optics measurement and correction at the Relativistic Heavy Ion Collider

    Directory of Open Access Journals (Sweden)

    X. Shen

    2013-11-01

    Full Text Available Correction of beta-beat is of great importance for performance improvement of high energy accelerators, like the Relativistic Hadron Ion Collider (RHIC. At RHIC, using the independent component analysis method, linear optical functions are extracted from the turn by turn beam position data of the ac dipole driven betatron oscillation. Despite the constraint of a limited number of available quadrupole correctors at RHIC, a global beta-beat correction scheme using a beta-beat response matrix method was developed and experimentally demonstrated. In both rings, a factor of 2 or better reduction of beta-beat was achieved within available beam time. At the same time, a new scheme of using horizontal closed orbit bump at sextupoles to correct beta-beat in the arcs was demonstrated in the Yellow ring of RHIC at beam energy of 255 GeV, and a peak beta-beat of approximately 7% was achieved.

  20. Linear induction motor

    International Nuclear Information System (INIS)

    Barkman, W.E.; Adams, W.Q.; Berrier, B.R.

    1978-01-01

    A linear induction motor has been operated on a test bed with a feedback pulse resolution of 5 nm (0.2 μin). Slewing tests with this slide drive have shown positioning errors less than or equal to 33 nm (1.3 μin) at feedrates between 0 and 25.4 mm/min (0-1 ipm). A 0.86-m (34-in)-stroke linear motor is being investigated, using the SPACO machine as a test bed. Initial results were encouraging, and work is continuing to optimize the servosystem compensation

  1. Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies

    Science.gov (United States)

    Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.

    2016-11-01

    We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.

  2. Advanced reliability improvement of AC-modules (ARIA)

    International Nuclear Information System (INIS)

    Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.

    2001-09-01

    The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string

  3. IR OPTICS MEASUREMENT WITH LINEAR COUPLING'S ACTION-ANGLE PARAMETERIZATION

    International Nuclear Information System (INIS)

    LUO, Y.; BAI, M.; PILAT, R.; SATOGATA, T.; TRBOJEVIC, D.

    2005-01-01

    A parameterization of linear coupling in action-angle coordinates is convenient for analytical calculations and interpretation of turn-by-turn (TBT) beam position monitor (BPM) data. We demonstrate how to use this parameterization to extract the twiss and coupling parameters in interaction regions (IRs), using BPMs on each side of the long IR drift region. The example of TBT BPM analysis was acquired at the Relativistic Heavy Ion Collider (RHIC), using an AC dipole to excite a single eigenmode. Besides the full treatment, a fast estimate of beta*, the beta function at the interaction point (IP), is provided, along with the phase advance between these BPMs. We also calculate and measure the waist of the beta function and the local optics

  4. DC response of dust to low frequency AC signals

    Science.gov (United States)

    McKinlay, Michael; Konopka, Uwe; Thomas, Edward

    2017-10-01

    Macroscopic changes in the shape and equilibrium position of clouds of charged microparticles suspended in a plasma have been observed in response to low frequency AC signals. In these experiments, dusty plasmas consisting of 2-micron diameter silica microspheres suspended between an anode and cathode in an argon, DC glow discharge plasma are produced in a grounded, 6-way cross vacuum chamber. An AC signal, produced by a function generator and amplified by a bipolar op-amp, is superimposed onto the potential from the cathode. The frequencies of the applied AC signals, ranging from tens to hundreds of kHz, are comparable to the ion-neutral collision frequency; well below the ion/electron plasma frequencies, but also considerably higher than the dust plasma frequency. This presentation will detail the experimental setup, present documentation and categorization of observations of the dust response, and present an initial model of the response. This work is supported by funding from the US Dept. of Energy, Grant Number DE-SC0016330, and by the National Science Foundation, Grant Number PHY-1613087.

  5. Acquisition of Cry1Ac protein by non-target arthropods in Bt soybean fields.

    Directory of Open Access Journals (Sweden)

    Huilin Yu

    Full Text Available Soybean tissue and arthropods were collected in Bt soybean fields in China at different times during the growing season to investigate the exposure of arthropods to the plant-produced Cry1Ac toxin and the transmission of the toxin within the food web. Samples from 52 arthropod species/taxa belonging to 42 families in 10 orders were analysed for their Cry1Ac content using enzyme-linked immunosorbent assay (ELISA. Among the 22 species/taxa for which three samples were analysed, toxin concentration was highest in the grasshopper Atractomorpha sinensis and represented about 50% of the concentration in soybean leaves. Other species/taxa did not contain detectable toxin or contained a concentration that was between 1 and 10% of that detected in leaves. These Cry1Ac-positive arthropods included a number of mesophyll-feeding Hemiptera, a cicadellid, a curculionid beetle and, among the predators, a thomisid spider and an unidentified predatory bug belonging to the Anthocoridae. Within an arthropod species/taxon, the Cry1Ac content sometimes varied between life stages (nymphs/larvae vs. adults and sampling dates (before, during, and after flowering. Our study is the first to provide information on Cry1Ac-expression levels in soybean plants and Cry1Ac concentrations in non-target arthropods in Chinese soybean fields. The data will be useful for assessing the risk of non-target arthropod exposure to Cry1Ac in soybean.

  6. Acquisition of Cry1Ac Protein by Non-Target Arthropods in Bt Soybean Fields

    Science.gov (United States)

    Yu, Huilin; Romeis, Jörg; Li, Yunhe; Li, Xiangju; Wu, Kongming

    2014-01-01

    Soybean tissue and arthropods were collected in Bt soybean fields in China at different times during the growing season to investigate the exposure of arthropods to the plant-produced Cry1Ac toxin and the transmission of the toxin within the food web. Samples from 52 arthropod species/taxa belonging to 42 families in 10 orders were analysed for their Cry1Ac content using enzyme-linked immunosorbent assay (ELISA). Among the 22 species/taxa for which three samples were analysed, toxin concentration was highest in the grasshopper Atractomorpha sinensis and represented about 50% of the concentration in soybean leaves. Other species/taxa did not contain detectable toxin or contained a concentration that was between 1 and 10% of that detected in leaves. These Cry1Ac-positive arthropods included a number of mesophyll-feeding Hemiptera, a cicadellid, a curculionid beetle and, among the predators, a thomisid spider and an unidentified predatory bug belonging to the Anthocoridae. Within an arthropod species/taxon, the Cry1Ac content sometimes varied between life stages (nymphs/larvae vs. adults) and sampling dates (before, during, and after flowering). Our study is the first to provide information on Cry1Ac-expression levels in soybean plants and Cry1Ac concentrations in non-target arthropods in Chinese soybean fields. The data will be useful for assessing the risk of non-target arthropod exposure to Cry1Ac in soybean. PMID:25110881

  7. Design and synthesis of 225Ac radioimmunopharmaceuticals

    International Nuclear Information System (INIS)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.

    2002-01-01

    The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans

  8. linear-quadratic-linear model

    Directory of Open Access Journals (Sweden)

    Tanwiwat Jaikuna

    2017-02-01

    Full Text Available Purpose: To develop an in-house software program that is able to calculate and generate the biological dose distribution and biological dose volume histogram by physical dose conversion using the linear-quadratic-linear (LQL model. Material and methods : The Isobio software was developed using MATLAB version 2014b to calculate and generate the biological dose distribution and biological dose volume histograms. The physical dose from each voxel in treatment planning was extracted through Computational Environment for Radiotherapy Research (CERR, and the accuracy was verified by the differentiation between the dose volume histogram from CERR and the treatment planning system. An equivalent dose in 2 Gy fraction (EQD2 was calculated using biological effective dose (BED based on the LQL model. The software calculation and the manual calculation were compared for EQD2 verification with pair t-test statistical analysis using IBM SPSS Statistics version 22 (64-bit. Results: Two and three-dimensional biological dose distribution and biological dose volume histogram were displayed correctly by the Isobio software. Different physical doses were found between CERR and treatment planning system (TPS in Oncentra, with 3.33% in high-risk clinical target volume (HR-CTV determined by D90%, 0.56% in the bladder, 1.74% in the rectum when determined by D2cc, and less than 1% in Pinnacle. The difference in the EQD2 between the software calculation and the manual calculation was not significantly different with 0.00% at p-values 0.820, 0.095, and 0.593 for external beam radiation therapy (EBRT and 0.240, 0.320, and 0.849 for brachytherapy (BT in HR-CTV, bladder, and rectum, respectively. Conclusions : The Isobio software is a feasible tool to generate the biological dose distribution and biological dose volume histogram for treatment plan evaluation in both EBRT and BT.

  9. Linear Motor With Air Slide

    Science.gov (United States)

    Johnson, Bruce G.; Gerver, Michael J.; Hawkey, Timothy J.; Fenn, Ralph C.

    1993-01-01

    Improved linear actuator comprises air slide and linear electric motor. Unit exhibits low friction, low backlash, and more nearly even acceleration. Used in machinery in which positions, velocities, and accelerations must be carefully controlled and/or vibrations must be suppressed.

  10. Spatial Processes in Linear Ordering

    Science.gov (United States)

    von Hecker, Ulrich; Klauer, Karl Christoph; Wolf, Lukas; Fazilat-Pour, Masoud

    2016-01-01

    Memory performance in linear order reasoning tasks (A > B, B > C, C > D, etc.) shows quicker, and more accurate responses to queries on wider (AD) than narrower (AB) pairs on a hypothetical linear mental model (A -- B -- C -- D). While indicative of an analogue representation, research so far did not provide positive evidence for spatial…

  11. Linear Einstein equations and Kerr-Schild maps

    International Nuclear Information System (INIS)

    Gergely, Laszlo A

    2002-01-01

    We prove that given a solution of the Einstein equations g ab for the matter field T ab , an autoparallel null vector field l a and a solution (l a l c , T ac ) of the linearized Einstein equation on the given background, the Kerr-Schild metric g ac + λl a l c (λ arbitrary constant) is an exact solution of the Einstein equation for the energy-momentum tensor T ac + λT ac + λ 2 l (a T c)b l b . The mixed form of the Einstein equation for Kerr-Schild metrics with autoparallel null congruence is also linear. Some more technical conditions hold when the null congruence is not autoparallel. These results generalize previous theorems for vacuum due to Xanthopoulos and for flat seed spacetime due to Guerses and Guersey

  12. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  13. Reciprocating linear motor

    Science.gov (United States)

    Goldowsky, Michael P. (Inventor)

    1987-01-01

    A reciprocating linear motor is formed with a pair of ring-shaped permanent magnets having opposite radial polarizations, held axially apart by a nonmagnetic yoke, which serves as an axially displaceable armature assembly. A pair of annularly wound coils having axial lengths which differ from the axial lengths of the permanent magnets are serially coupled together in mutual opposition and positioned with an outer cylindrical core in axial symmetry about the armature assembly. One embodiment includes a second pair of annularly wound coils serially coupled together in mutual opposition and an inner cylindrical core positioned in axial symmetry inside the armature radially opposite to the first pair of coils. Application of a potential difference across a serial connection of the two pairs of coils creates a current flow perpendicular to the magnetic field created by the armature magnets, thereby causing limited linear displacement of the magnets relative to the coils.

  14. ac loss and dc critical current densities of Nb3Sn tapes by the solid state diffusion process

    International Nuclear Information System (INIS)

    Suenaga, M.; Klamut, C.; Bussiere, J.F.

    1976-01-01

    The effects of metallurgical processing on 60 Hz ac losses and dc critical currents in Nb 3 Sn tapes fabricated by the solid state diffusion technique were investigated. An addition of Al to the Cu--Sn alloy for the matrix resulted in large reduction in the ac losses of Nb 3 Sn tapes, but the highest linear critical current densities were observed in Nb 3 Sn tapes produced with a Nb-1 wt percent Zr core in a Cu-13 wt percent Sn matrix. Values of the losses and the critical currents in these tapes can meet the present requirements for the ac superconducting power cables

  15. Linear pneumatic actuator

    Directory of Open Access Journals (Sweden)

    Avram Mihai

    2017-01-01

    Full Text Available The paper presents a linear pneumatic actuator with short working stroke. It consists of a pneumatic motor (a simple stroke cylinder or a membrane chamber, two 2/2 pneumatic distributors “all or nothing” electrically commanded for controlling the intake/outtake flow to/from the active chamber of the motor, a position transducer and a microcontroller. There is also presented the theoretical analysis (mathematical modelling and numerical simulation accomplished.

  16. Linear pneumatic actuator

    OpenAIRE

    Avram Mihai; Niţu Constantin; Bucşan Constantin; Grămescu Bogdan

    2017-01-01

    The paper presents a linear pneumatic actuator with short working stroke. It consists of a pneumatic motor (a simple stroke cylinder or a membrane chamber), two 2/2 pneumatic distributors “all or nothing” electrically commanded for controlling the intake/outtake flow to/from the active chamber of the motor, a position transducer and a microcontroller. There is also presented the theoretical analysis (mathematical modelling and numerical simulation) accomplished.

  17. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  18. Superconducting three element synchronous ac machine

    International Nuclear Information System (INIS)

    Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

    1975-01-01

    There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

  19. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  20. Impedance Localization Measurements using AC Dipoles in the LHC

    CERN Document Server

    Biancacci, Nicolo; Papotti, Giulia; Persson, Tobias; Salvant, Benoit; Tomás, Rogelio

    2016-01-01

    The knowledge of the LHC impedance is of primary importance to predict the machine performance and allow for the HL-LHC upgrade. The developed impedance model can be benchmarked with beam measurements in order to assess its validity and limit. This is routinely done, for example, moving the LHC collimator jaws and measuring the induced tune shift. In order to localize possible unknown impedance sources, the variation of phase advance with intensity between beam position monitors can be measured. In this work we will present the impedance localization measurements performed at injection in the LHC using AC dipoles as exciter as well as the underlying theory.

  1. Study on AC loss measurements of HTS power cable for standardizing

    Science.gov (United States)

    Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi

    2017-09-01

    High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..

  2. Photovoltaic system with improved AC connections and method of making same

    Energy Technology Data Exchange (ETDEWEB)

    Cioffi, Philip Michael; Todorovic, Maja Harfman; Herzog, Michael Scott; Korman, Charles Steven; Doherty, Donald M.; Johnson, Neil Anthony

    2018-02-13

    An alternating current (AC) harness for a photovoltaic (PV) system includes a wire assembly having a first end and a second end, the wire assembly having a plurality of lead wires, and at least one AC connection module positioned at a location along a length of the wire assembly between the first end and the second end. Further, the at least one AC connection module includes a first connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a first PV module of the PV system. The at least one AC connection module also includes a second connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a second PV module of the PV system.

  3. Linear step drive

    International Nuclear Information System (INIS)

    Haniger, L.; Elger, R.; Kocandrle, L.; Zdebor, J.

    1986-01-01

    A linear step drive is described developed in Czechoslovak-Soviet cooperation and intended for driving WWER-1000 control rods. The functional principle is explained of the motor and the mechanical and electrical parts of the drive, power control, and the indicator of position are described. The motor has latches situated in the reactor at a distance of 3 m from magnetic armatures, it has a low structural height above the reactor cover, which suggests its suitability for seismic localities. Its magnetic circuits use counterpoles; the mechanical shocks at the completion of each step are damped using special design features. The position indicator is of a special design and evaluates motor position within ±1% of total travel. A drive diagram and the flow chart of both the control electronics and the position indicator are presented. (author) 4 figs

  4. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...

  5. Preliminary study on AC superconducting machines

    International Nuclear Information System (INIS)

    Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

    1988-01-01

    This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

  6. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  7. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  8. Statistical time lags in ac discharges

    International Nuclear Information System (INIS)

    Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F

    2011-01-01

    The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

  9. Statistical time lags in ac discharges

    Energy Technology Data Exchange (ETDEWEB)

    Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)

    2011-04-06

    The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

  10. Study of the electric Held in HTS tape caused by perpendicular AC magnetic field

    International Nuclear Information System (INIS)

    Roiberg, V; Kopansky, F.

    2004-01-01

    Full Text: In a previous work we studied the influence of AC magnetic fields on voltage-currents (V-I) characteristics of high temperature superconducting (HTS) multi filament BSCC0-2223 tapes. It was found that AC magnetic fields perpendicular to the ab plane (the wide surface of the tape) cause a linear decrease of the critical current (IC) with amplitude of the AC magnetic field. The degradation of IC in .AC field was explained by the geometrical model according to which the transport current floe: is confined to the central zone of the tape where .AC field does not penetrate. For deeper understanding of the observed phenomena we carried out a study of the time dependence of the electric field during the cycle of AC field. At the same time we expanded the frequency range to low frequencies down to 1 Hz. The main results of the work are as following. 1. The time modulation of the electric field E in the HTS tape carrying transport DC current has the double frequency relating to AC magnetic field. 2. In field amplitudes less than 70 G the electric field modulation decreases with increasing frequency in opposite to its well-pronounced increase in higher AC field amplitudes. Alcove 70 G, the electric field increases with increasing the frequency of the external magnetic field. The wave forms of the electric field are different in both amplitudes ranges. 3. E-I curves of the tape in low amplitudes are frequency independent and coincide with E-l curves in AC field with intensity equal to the AC field amplitude. 4. In high AC field amplitudes, a strong dependence of the E-I curves on frequency is observed in the frequency range of 1-40 Hz and no dependence is observed in higher frequencies. Our results suggest that a combination of the geometrical model with flux creep concepts is necessary for a better understanding of the electric field behavior in our measurement conditions

  11. Research on the Plasma Anemometer Based on AC Glow Discharge

    Directory of Open Access Journals (Sweden)

    Bing Yu

    2017-01-01

    Full Text Available A new plasma anemometer based on AC glow discharge is designed in this article. Firstly, theoretical analysis of plasma anemometer working principle is introduced to prove the feasibility of the experimental measurement method. Then the experiments are carried out to study the effects of different parameters on the static discharge characteristics of the plasma anemometer system, by which the system optimization methods are obtained. Finally, several groups of appropriate parameters are selected to build the plasma anemometer system based on resistance capacitance coupling negative feedback AC glow discharge, and different airflow speeds are applied to obtain the achievable velocity measurement range. The results show that there is a linear relationship between airflow velocity and discharge current in an allowable error range, which can be applied for airflow velocity measurement. Negative feedback coupling module, which is composed of the coupling resistance and the coupling capacitance, has good effects on improving the system stability. The measurement range of the airflow velocity is significantly increased when the electrode gap is 3 mm, coupling resistance is 470 Ω, and coupling capacitance is 220 pF.

  12. Multi-phase AC/AC step-down converter for distribution systems

    Science.gov (United States)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  13. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, M.P.

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers

  14. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  15. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Gould, O.L.

    1996-01-01

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  16. THE ACS NEARBY GALAXY SURVEY TREASURY

    International Nuclear Information System (INIS)

    Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  17. Predicting AC loss in practical superconductors

    International Nuclear Information System (INIS)

    Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P

    2006-01-01

    Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time

  18. Meso Mechanical Analysis of AC Mixture Response

    NARCIS (Netherlands)

    Woldekidan, M.F.; Huurman, M.; Vaccari, E.; Poot, M.

    2012-01-01

    Ongoing research into performance modeling of Asphalt Concrete (AC) mixtures using meso mechanics approaches is being undertaken at Delft University of Technology (TUD). The approach has already been successfully employed for evaluating the long term performance of porous asphalt concrete. The work

  19. Production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Meriarty, H; Metcalfe, P; Knittel, T; Allen, B J

    2007-09-01

    The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. The production of Ac-225 has been achieved using bremsstrahlung photons from an 18 MV medical linear accelerator (linac) to bombard a Ra-226 target. A linac dose of 2800 Gy produced about 64 microCi of Ra-225, which decays to Ac-225. This result, while consistent with the theoretical calculations, is far too low to be of practical use. A more powerful linac is required that runs at a higher current, longer pulse length and higher frequency for practical production. This process could also lead to the reduction of the nuclear waste product Ra-226.

  20. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-04-01

    80 Hz and became saturated at over 80 Hz, which has been explained based on the interaction between the buoyancy and ionic wind. Electrical measurement showed the power consumed by the AC was smaller than 0.01% of the heat release rate from the flame. To improve the understanding on the electric current resulting from applying electric field on flames, a simplified one-dimensional model was developed in that the reaction zone was modeled as a thin ionized layer. Model governing equations were derived from species equations by implementing mobility differences depending on the type of charged particles, especially between ions and electrons. The result showed that the sub-saturated current along with field intensity was significantly influenced by the polarity of DC due to the combined effect of non-equal mobility of charged particles as well as the position of the ionized layer in a gap relative to two electrodes. Experiments with quasi-one-dimensional flames under DC were conducted to substantiate the model and measured currents agreed qualitatively well with the model predictions.

  1. AC measurements on uranium doped high temperature superconductors

    International Nuclear Information System (INIS)

    Eisterer, M.

    1999-11-01

    The subject of this thesis is the influence of fission tracks on the superconducting properties of melt textured Y-123. The critical current densities, the irreversibility lines and the transition temperature were determined by means of ac measurements. The corresponding ac techniques are explored in detail. Deviations of the ac signal from the expectations according to the Bean model were explained by the dependence of the shielding currents on the electric field. This explanation is supported by the influence of the ac amplitude and frequency on the critical current density but also by a comparison of the obtained data with other experimental techniques. Y-123 has to be doped with uranium in order to induce fission tracks. Uranium forms normal conducting clusters, which are nearly spherical, with a diameter of about 300 nm. Fission of uranium-235 by thermal neutrons creates two high energy ions with a total energy of about 160 MeV. Each of these fission products induces a linear defect with a diameter of about 10 nm. The length of one fission track is 2-4 μm. At 77 K the critical current density is enhanced by the pinning action of the uranium clusters, compared to undoped samples. With decreasing temperature this influence becomes negligible. The critical current densities are strongly enhanced due to the irradiation. At low magnetic fields we find extremely high values for melt textured materials, e.g. 2.5x10 9 Am -2 at 77 K and 0.25 T or 6x10 10 Am -2 at 5 K. Since the critical current was found to be inverse proportional to the square root of the applied magnetic field it decreases rapidly as the field increases. This behavior is predicted by simple theoretical considerations, but is only valid at low temperatures as well as in low magnetic fields at high temperatures. At high fields the critical current drops more rapidly. The irreversibility lines are only slightly changed by this irradiation technique. Only a small shift to higher fields and temperatures

  2. A linear magnetic motor and generator

    Science.gov (United States)

    Studer, P. A.

    1980-01-01

    In linear magnetic motor and generator suitable for remote and hostile environments, magnetic forces drive reciprocating shaft along its axis. Actuator shaft is located in center of cylindrical body and may be supported by either contacting or noncontacting bearings. When device operates as bidirectional motor, drive coil selectively adds and subtracts magnetic flux to and from flux paths, producing forces that drive actuator along axis. When actuator is driven by external reciprocating engine, device becomes ac generator.

  3. Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

    Science.gov (United States)

    Han, Xiaomin; Li, Guojing; Zhang, Shuqun

    2017-01-01

    Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

  4. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  5. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  6. ac driving amplitude dependent systematic error in scanning Kelvin probe microscope measurements: Detection and correction

    International Nuclear Information System (INIS)

    Wu Yan; Shannon, Mark A.

    2006-01-01

    The dependence of the contact potential difference (CPD) reading on the ac driving amplitude in scanning Kelvin probe microscope (SKPM) hinders researchers from quantifying true material properties. We show theoretically and demonstrate experimentally that an ac driving amplitude dependence in the SKPM measurement can come from a systematic error, and it is common for all tip sample systems as long as there is a nonzero tracking error in the feedback control loop of the instrument. We further propose a methodology to detect and to correct the ac driving amplitude dependent systematic error in SKPM measurements. The true contact potential difference can be found by applying a linear regression to the measured CPD versus one over ac driving amplitude data. Two scenarios are studied: (a) when the surface being scanned by SKPM is not semiconducting and there is an ac driving amplitude dependent systematic error; (b) when a semiconductor surface is probed and asymmetric band bending occurs when the systematic error is present. Experiments are conducted using a commercial SKPM and CPD measurement results of two systems: platinum-iridium/gap/gold and platinum-iridium/gap/thermal oxide/silicon are discussed

  7. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  8. Linear Algebra and Smarandache Linear Algebra

    OpenAIRE

    Vasantha, Kandasamy

    2003-01-01

    The present book, on Smarandache linear algebra, not only studies the Smarandache analogues of linear algebra and its applications, it also aims to bridge the need for new research topics pertaining to linear algebra, purely in the algebraic sense. We have introduced Smarandache semilinear algebra, Smarandache bilinear algebra and Smarandache anti-linear algebra and their fuzzy equivalents. Moreover, in this book, we have brought out the study of linear algebra and vector spaces over finite p...

  9. Faradaic AC Electrokinetic Flow and Particle Traps

    Science.gov (United States)

    Ben, Yuxing; Chang, Hsueh-Chia

    2004-11-01

    Faradaic reaction at higher voltages can produce co-ion polarization at AC electrodes instead of counter-ion polarization due to capacitive charging from the bulk. The Faradaic co-ion polarization also does not screen the external field and hence can produce large net electro-kinetic flows at frequencies lower than the inverse RC time of the double layer. Due to the opposite polarization of capacitve and Faradaic charging, we can reverse the direction of AC flows on electrodes by changing the voltage and frequency. Particles and bacteria are trapped and then dispersed at stagnation lines, at locations predicted by our theory, by using these two flows sequentially. This technique offers a good way to concentrate and detect bacteria.

  10. AC application of second generation HTS wire

    Science.gov (United States)

    Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.

    2008-02-01

    For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.

  11. Aging, Counterfeiting Configuration Control (AC3)

    Science.gov (United States)

    2010-01-31

    Systems Intergrated Into AC3 CABS - Common As-Built System PRISM - Process Re-inventing Integration Systems for Manufacturing PDM - Product Data...looks forward to deploying the completed tool at Raytheon in a true production environment, for as much as we like the challenge associated with...performance of DoD systems. DoD systems are particularly susceptible to intrusion of counterfeit parts, especially during surge and extended production

  12. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  13. Modeling photovoltaic systems for AC appliances

    Directory of Open Access Journals (Sweden)

    Andreea Maria Neaca

    2009-10-01

    Full Text Available In this paper is described the development of a model which can simulate the performance of a photovoltaic (PV system under specific meteorological conditions and transforming the DC current into AC current. In this model, the accent stands on the design of a series charge regulator. It is treated also the benefit of creating a circuit, with different methods, that can test the maximum power point trackers (MPPT for different photovoltaic applications.

  14. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    Over the last decade, distributed energy resources (DER) technology has undergone a fast development. Increased penetration of DER units and wide spread use of renewable energy sources challenge the entire architecture of traditional power system. Microgrid, characterizing higher flexibility......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  15. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  16. CERN balances linear collider studies

    CERN Multimedia

    ILC Newsline

    2011-01-01

    The forces behind the two most mature proposals for a next-generation collider, the International Linear Collider (ILC) and the Compact Linear Collider (CLIC) study, have been steadily coming together, with scientists from both communities sharing ideas and information across the technology divide. In a support of cooperation between the two, CERN in Switzerland, where most CLIC research takes place, recently converted the project-specific position of CLIC Study Leader to the concept-based Linear Collider Study Leader.   The scientist who now holds this position, Steinar Stapnes, is charged with making the linear collider a viable option for CERN’s future, one that could include either CLIC or the ILC. The transition to more involve the ILC must be gradual, he said, and the redefinition of his post is a good start. Though not very much involved with superconducting radiofrequency (SRF) technology, where ILC researchers have made significant advances, CERN participates in many aspect...

  17. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho

    2017-01-01

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field

  18. The Hubble Legacy Archive ACS grism data

    Science.gov (United States)

    Kümmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.

    2011-06-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 μm, with a dispersion of 40 Å/pixel and a resolution of ~80 Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47 919 datasets (65% of the total number of extracted spectra) for 32 149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2 - 4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects

  19. Alpha decay 225 Ac → 221Fr

    International Nuclear Information System (INIS)

    Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.

    2004-01-01

    Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the

  20. Acoustic emission linear pulse holography

    International Nuclear Information System (INIS)

    Collins, H.D.; Busse, L.J.; Lemon, D.K.

    1983-01-01

    This paper describes the emission linear pulse holography which produces a chronological linear holographic image of a flaw by utilizing the acoustic energy emitted during crack growth. A thirty two point sampling array is used to construct phase-only linear holograms of simulated acoustic emission sources on large metal plates. The concept behind the AE linear pulse holography is illustrated, and a block diagram of a data acquisition system to implement the concept is given. Array element spacing, synthetic frequency criteria, and lateral depth resolution are specified. A reference timing transducer positioned between the array and the inspection zone and which inititates the time-of-flight measurements is described. The results graphically illustrate the technique using a one-dimensional FFT computer algorithm (ie. linear backward wave) for an AE image reconstruction

  1. Updating the HST/ACS G800L Grism Calibration

    Science.gov (United States)

    Hathi, Nimish P.; Pirzkal, Norbert; Grogin, Norman A.; Chiaberge, Marco; ACS Team

    2018-06-01

    We present results from our ongoing work on obtaining newly derived trace and wavelength calibrations of the HST/ACS G800L grism and comparing them to previous set of calibrations. Past calibration efforts were based on 2003 observations. New observations of an emission line Wolf-Rayet star (WR96) were recently taken in HST Cycle 25 (PID: 15401). These observations are used to analyze and measure various grism properties, including wavelength calibration, spectral trace/tilt, length/size of grism orders, and spacing between various grism orders. To account for the field dependence, we observe WR96 at 3 different observing positions over the HST/ACS field of view. The three locations are the center of chip 1, the center of chip 2, and the center of the WFC1A-2K subarray (center of WFC Amp A on chip 1). This new data will help us to evaluate any differences in the G800L grism properties compared to previous calibration data, and to apply improved data analysis techniques to update these old measurements.

  2. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  3. Design and implementation of VUV-CD and LD measurements using an ac modulated polarizing undulator

    International Nuclear Information System (INIS)

    Yagi-Watanabe, K.; Yamada, T.; Tanaka, M.; Kaneko, F.; Kitada, T.; Ohta, Y.; Nakagawa, K.

    2005-01-01

    VUV circular dichroism (CD) and linear dichroism (LD) have been successfully measured at wavelengths beyond the conventional limit by using an ac modulated polarizing undulator. We have developed CD and LD measuring technique by polarization modulation at the source, without using transmission type polarizing modulator, to extend to the coverage to wavelengths shorter than 140-bar nm. AIST developed in 1986 ac polarizing undulator by using a electron storage ring 'TERAS' based on an original concept. The undulator which can produce any desired polarization of vertical- and horizontal-linear polarization (VLP and HLP) and right- and left-handed circular polarization (RCP and LCP) is specially well suited to both measurements of CD and LD. With this undulator, the polarization alternate in the order of VLP-RCP-HLP-RCP-VLP-LCP-HLP-LCP-VLP-, i.e. when circular polarization is modulated in f Hz, linear polarization alters in 2f Hz. This allows us simultaneous measurements of CD and LD. Since the TERAS can produce ac-modulated polarized radiation of wavelength as short as 40-bar nm, it is expected to have CD and LD measurement extended to 40-bar nm

  4. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  5. Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

    Science.gov (United States)

    Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

    2012-01-01

    The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

  6. Effective Peroxidase-Like Activity of Co-Aminoclay [CoAC] and Its Application for Glucose Detection

    Directory of Open Access Journals (Sweden)

    Han Pill Song

    2018-02-01

    Full Text Available In this study, we describe a novel peroxidase-like activity of Co-aminoclay [CoAC] present at pH ~5.0 and its application to fluorescent biosensor for the determination of H2O2 and glucose. It is synthesized with aminoclays (ACs entrapping cationic metals such as Fe, Cu, Al, Co., Ce, Ni, Mn, and Zn to find enzyme mimicking ACs by sol–gel ambient conditions. Through the screening of catalytic activities by the typical colorimetric reaction employing 2,2′-azino-bis(3-ethylbenzo-thiazoline-6-sulfonic aciddiammonium salt (ABTS as a substrate with or without H2O2, Fe, Cu, and CoACs are found to exhibit peroxidase-like activity, as well as oxidase-like activity was observed from Ce and MnACs. Among them, CoAC shows exceptionally high peroxidase-like activity, presumably due to its ability to induce electron transfer between substrates and H2O2. CoAC is then used to catalyze the oxidation of Amplex® UltraRed (AUR into a fluorescent end product, which enables a sensitive fluorescent detection of H2O2. Moreover, a highly sensitive and selective glucose biosensing strategy is developed, based on enzyme cascade reaction between glucose oxidase (GOx and CoAC. Using this strategy, a highly linear fluorescence enhancement is verified when the concentration of glucose is increased in a wide range from 10 μM to 1 mM with a lower detection limit of 5 μM. The practical diagnostic capability of the assay system is also verified by its use to detect glucose in human blood serum. Based on these results, it is anticipated that CoAC can serve as potent peroxidase mimetics for the detection of clinically important target molecules.

  7. Design and implementation of co-operative control strategy for hybrid AC/DC microgrids

    Science.gov (United States)

    Mahmud, Rasel

    This thesis is mainly divided in two major sections: 1) Modeling and control of AC microgrid, DC microgrid, Hybrid AC/DC microgrid using distributed co-operative control, and 2) Development of a four bus laboratory prototype of an AC microgrid system. At first, a distributed cooperative control (DCC) for a DC microgrid considering the state-of-charge (SoC) of the batteries in a typical plug-in-electric-vehicle (PEV) is developed. In DC microgrids, this methodology is developed to assist the load sharing amongst the distributed generation units (DGs), according to their ratings with improved voltage regulation. Subsequently, a DCC based control algorithm for AC microgrid is also investigated to improve the performance of AC microgrid in terms of power sharing among the DGs, voltage regulation and frequency deviation. The results validate the advantages of the proposed methodology as compared to traditional droop control of AC microgrid. The DCC-based control methodology for AC microgrid and DC microgrid are further expanded to develop a DCC-based power management algorithm for hybrid AC/DC microgrid. The developed algorithm for hybrid microgrid controls the power flow through the interfacing converter (IC) between the AC and DC microgrids. This will facilitate the power sharing between the DGs according to their power ratings. Moreover, it enables the fixed scheduled power delivery at different operating conditions, while maintaining good voltage regulation and improved frequency profile. The second section provides a detailed explanation and step-by-step design and development of an AC/DC microgrid testbed. Controllers for the three-phase inverters are designed and tested on different generation units along with their corresponding inductor-capacitor-inductor (LCL) filters to eliminate the switching frequency harmonics. Electric power distribution line models are developed to form the microgrid network topology. Voltage and current sensors are placed in the proper

  8. Moderately nonlinear diffuse-charge dynamics under an ac voltage.

    Science.gov (United States)

    Stout, Robert F; Khair, Aditya S

    2015-09-01

    The response of a symmetric binary electrolyte between two parallel, blocking electrodes to a moderate amplitude ac voltage is quantified. The diffuse charge dynamics are modeled via the Poisson-Nernst-Planck equations for a dilute solution of point-like ions. The solution to these equations is expressed as a Fourier series with a voltage perturbation expansion for arbitrary Debye layer thickness and ac frequency. Here, the perturbation expansion in voltage proceeds in powers of V_{o}/(k_{B}T/e), where V_{o} is the amplitude of the driving voltage and k_{B}T/e is the thermal voltage with k_{B} as Boltzmann's constant, T as the temperature, and e as the fundamental charge. We show that the response of the electrolyte remains essentially linear in voltage amplitude at frequencies greater than the RC frequency of Debye layer charging, D/λ_{D}L, where D is the ion diffusivity, λ_{D} is the Debye layer thickness, and L is half the cell width. In contrast, nonlinear response is predicted at frequencies below the RC frequency. We find that the ion densities exhibit symmetric deviations from the (uniform) equilibrium density at even orders of the voltage amplitude. This leads to the voltage dependence of the current in the external circuit arising from the odd orders of voltage. For instance, the first nonlinear contribution to the current is O(V_{o}^{3}) which contains the expected third harmonic but also a component oscillating at the applied frequency. We use this to compute a generalized impedance for moderate voltages, the first nonlinear contribution to which is quadratic in V_{o}. This contribution predicts a decrease in the imaginary part of the impedance at low frequency, which is due to the increase in Debye layer capacitance with increasing V_{o}. In contrast, the real part of the impedance increases at low frequency, due to adsorption of neutral salt from the bulk to the Debye layer.

  9. Moderately nonlinear diffuse-charge dynamics under an ac voltage

    Science.gov (United States)

    Stout, Robert F.; Khair, Aditya S.

    2015-09-01

    The response of a symmetric binary electrolyte between two parallel, blocking electrodes to a moderate amplitude ac voltage is quantified. The diffuse charge dynamics are modeled via the Poisson-Nernst-Planck equations for a dilute solution of point-like ions. The solution to these equations is expressed as a Fourier series with a voltage perturbation expansion for arbitrary Debye layer thickness and ac frequency. Here, the perturbation expansion in voltage proceeds in powers of Vo/(kBT /e ) , where Vo is the amplitude of the driving voltage and kBT /e is the thermal voltage with kB as Boltzmann's constant, T as the temperature, and e as the fundamental charge. We show that the response of the electrolyte remains essentially linear in voltage amplitude at frequencies greater than the RC frequency of Debye layer charging, D /λDL , where D is the ion diffusivity, λD is the Debye layer thickness, and L is half the cell width. In contrast, nonlinear response is predicted at frequencies below the RC frequency. We find that the ion densities exhibit symmetric deviations from the (uniform) equilibrium density at even orders of the voltage amplitude. This leads to the voltage dependence of the current in the external circuit arising from the odd orders of voltage. For instance, the first nonlinear contribution to the current is O (Vo3) which contains the expected third harmonic but also a component oscillating at the applied frequency. We use this to compute a generalized impedance for moderate voltages, the first nonlinear contribution to which is quadratic in Vo. This contribution predicts a decrease in the imaginary part of the impedance at low frequency, which is due to the increase in Debye layer capacitance with increasing Vo. In contrast, the real part of the impedance increases at low frequency, due to adsorption of neutral salt from the bulk to the Debye layer.

  10. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  11. AC susceptibility enhancement studies in magnetic systems

    International Nuclear Information System (INIS)

    Mukherjee, S.; Ranganathan, R.; Chakravarti, A.; Sil, S.

    2001-01-01

    Enhancement of AC susceptibility has been observed for typical ferromagnets (Gd), reentrant spin glasses like (Fe 1.5 Mn 1.5 Si) and canted spin systems (Ce(Fe 0.96 Al 0.04 ) 2 ). The data have been interpreted with the help of a simulation model based on dry friction-like pinning of domain walls for systems having ferromagnetic domain structures. A strong pinning mechanism appears in the reentrant spin glass like and canted spin systems at low temperatures in addition to the intrinsic one in the ferromagnetic phase. The temperature variation of the pinning potential has been given qualitatively for the reentrant spin glass like systems

  12. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez

    2015-01-01

    and DC microgrids, and then investigates the existing and promising solutions for the corresponding challenges. To the authors’ knowledge, three parts of smart grids are required to be developed to facilitate implementation of protection scheme in microgrids. The main requirements and open issues......In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  13. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  14. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  15. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

  16. Theoretical Simulation on the Assembly of Carbon Nanotubes Between Electrodes by AC Dielectrophoresis

    Directory of Open Access Journals (Sweden)

    Yang Liu

    2008-01-01

    Full Text Available Abstract The assembly of single-walled carbon nanotubes (SWCNTs using the AC dielectrophoresis technique is studied theoretically. It is found that the comb electrode bears better position control of SWCNTs compared to the parallel electrode. In the assembly, when some SWCNTs bridge the electrode first, they can greatly alter the local electrical field so as to “screen off” later coming SWCNTs, which contributes to the formation of dispersed SWCNT array. The screening distance scales with the gap width of electrodes and the length of SWCNTs, which provides a way to estimate the assembled density of SWCNTs. The influence of thermal noise on SWCNTs alignment is also analyzed in the simulation. It is shown that the status of the array distribution for SWCNTs is decided by the competition between the thermal noise and the AC electric-field strength. This influence of the thermal noise can be suppressed by using higher AC voltage to assemble the SWCNTs.

  17. Soliton motion in a parametrically ac-driven damped Toda lattice

    International Nuclear Information System (INIS)

    Rasmussen, K.O.; Malomed, B.A.; Bishop, A.R.; Groenbech-Jensen, N.

    1998-01-01

    We demonstrate that a staggered parametric ac driving term can support stable progressive motion of a soliton in a Toda lattice with friction, while an unstaggered driving force cannot. A physical context of the model is that of a chain of anharmonically coupled particles adsorbed on a solid surface of a finite size. The ac driving force is generated by a standing acoustic wave excited on the surface. Simulations demonstrate that the state left behind the moving soliton, with the particles shifted from their equilibrium positions, gradually relaxes back to the equilibrium state that existed before the passage of the soliton. The perturbation theory predicts that the ac-driven soliton exists if the amplitude of the drive exceeds a certain threshold. The analytical prediction for the threshold is in reasonable agreement with that found numerically. Collisions between two counterpropagating solitons is also simulated, demonstrating that the collisions are, effectively, fully elastic. copyright 1998 The American Physical Society

  18. Marketing information system online design for craftsmen small medium enterprises (case study: craftsmen ac)

    Science.gov (United States)

    Fitriana, Rina; Kurniawan, Wawan; Barlianto, Anung; Adriansyah Putra, Rizki

    2016-02-01

    AC is small and medium enterprises which is engaged in the field of crafts. This SME (Small Medium Enterprise) didn't have an integrated information system for managing sales. This research aims to design a marketing Information system online as applications that built as web base. The integrated system is made to manage sales and expand its market share. This study uses a structured analysis and design in its approach to build systems and also implemented a marketing framework of STP (Segmentation, Targeting, Positioning) and 4P (Price, Product, Place, Promotion) to obtain market analysis. The main market target customer craftsmen AC is women aged 13 years to 35 years. The products produced by AC are shoes, brooch, that are typical of the archipelago. The prices is range from Rp. 2000 until Rp. 400.000. Marketing information system online can be used as a sales transaction document, promoting the goods, and for customer booking products.

  19. Power Controllability of Three-phase Converter with Unbalanced AC Source

    DEFF Research Database (Denmark)

    Ma, Ke; Liserre, Marco; Blaabjerg, Frede

    2013-01-01

    Three-phase DC-AC power converters suffer from power oscillation and overcurrentt problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zero-sequence components are proposed to enhance the power control ability under this adverse conditions. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC sources....

  20. Power Controllability of Three-phase Converter with Unbalanced AC Source

    DEFF Research Database (Denmark)

    Ma, Ke; Chen, Wenjie; Liserre, Marco

    2015-01-01

    Three-phase DC-AC power converters suffer from power oscillation and overcurrent problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zerosequence components are proposed to enhance the power control ability under this adverse condition. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC voltage....

  1. Absolute Position Sensing Based on a Robust Differential Capacitive Sensor with a Grounded Shield Window

    Directory of Open Access Journals (Sweden)

    Yang Bai

    2016-05-01

    Full Text Available A simple differential capacitive sensor is provided in this paper to measure the absolute positions of length measuring systems. By utilizing a shield window inside the differential capacitor, the measurement range and linearity range of the sensor can reach several millimeters. What is more interesting is that this differential capacitive sensor is only sensitive to one translational degree of freedom (DOF movement, and immune to the vibration along the other two translational DOFs. In the experiment, we used a novel circuit based on an AC capacitance bridge to directly measure the differential capacitance value. The experimental result shows that this differential capacitive sensor has a sensitivity of 2 × 10−4 pF/μm with 0.08 μm resolution. The measurement range of this differential capacitive sensor is 6 mm, and the linearity error are less than 0.01% over the whole absolute position measurement range.

  2. Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

    Directory of Open Access Journals (Sweden)

    Amir V. Tavakoli

    2017-09-01

    Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

  3. Linearly constrained minimax optimization

    DEFF Research Database (Denmark)

    Madsen, Kaj; Schjær-Jacobsen, Hans

    1978-01-01

    We present an algorithm for nonlinear minimax optimization subject to linear equality and inequality constraints which requires first order partial derivatives. The algorithm is based on successive linear approximations to the functions defining the problem. The resulting linear subproblems...

  4. Bifurcation theory of ac electric arcing

    International Nuclear Information System (INIS)

    Christen, Thomas; Peinke, Emanuel

    2012-01-01

    The performance of alternating current (ac) electric arcing devices is related to arc extinction or its re-ignition at zero crossings of the current (so-called ‘current zero’, CZ). Theoretical investigations thus usually focus on the transient behaviour of arcs near CZ, e.g. by solving the modelling differential equations in the vicinity of CZ. This paper proposes as an alternative approach to investigate global mathematical properties of the underlying periodically driven dynamic system describing the electric circuit containing the arcing device. For instance, the uniqueness of the trivial solution associated with the insulating state indicates the extinction of any arc. The existence of non-trivial attractors (typically a time-periodic state) points to a re-ignition of certain arcs. The performance regions of arcing devices, such as circuit breakers and arc torches, can thus be identified with the regions of absence and existence, respectively, of non-trivial attractors. Most important for applications, the boundary of a performance region in the model parameter space is then associated with the bifurcation of the non-trivial attractors. The concept is illustrated for simple black-box arc models, such as the Mayr and the Cassie model, by calculating for various cases the performance boundaries associated with the bifurcation of ac arcs. (paper)

  5. A nonlinear model for AC induced corrosion

    Directory of Open Access Journals (Sweden)

    N. Ida

    2012-09-01

    Full Text Available The modeling of corrosion poses particular difficulties. The understanding of corrosion as an electrochemical process has led to simple capacitive-resistive models that take into account the resistance of the electrolytic cell and the capacitive effect of the surface potential at the interface between conductors and the electrolyte. In some models nonlinear conduction effects have been added to account for more complex observed behavior. While these models are sufficient to describe the behavior in systems with cathodic protection, the behavior in the presence of induced AC currents from power lines and from RF sources cannot be accounted for and are insufficient to describe the effects observed in the field. Field observations have shown that a rectifying effect exists that affects the cathodic protection potential and this effect is responsible for corrosion in the presence of AC currents. The rectifying effects of the metal-corrosion interface are totally missing from current models. This work proposes a nonlinear model based on finite element analysis that takes into account the nonlinear behavior of the metal-oxide interface and promises to improve modeling by including the rectification effects at the interface.

  6. Measuring Gravitational Flexion in ACS Clusters

    Science.gov (United States)

    Goldberg, David

    2005-07-01

    We propose measurement of the gravitational "Flexion" signal in ACS cluster images. The flexion, or "arciness" of a lensed background galaxy arises from variations in the lensing field. As a result, it is extremely sensitive to small scale perturbations in the field, and thus, to substructure in clusters. Moreover, because flexion represents gravitationally induced asymmetries in the lensed image, it is completely separable from traditional measurements of shear, which focus on the induced ellipticity of the image, and thus, the two signals may be extracted simultaneously. Since typical galaxies are roughly symmetric upon 180 degree rotation, even a small induced flexion can potentially produce a noticeable effect {Goldberg & Bacon, 2005}. We propose the measurement of substructure within approximately 4 clusters with high-quality ACS data, and will further apply a test of a new tomographic technique whereby comparisons of lensed arcs at different redshifts may be used to estimate the background cosmology, and thus place constraints on the equation of state of dark energy.

  7. Linear systems a measurement based approach

    CERN Document Server

    Bhattacharyya, S P; Mohsenizadeh, D N

    2014-01-01

    This brief presents recent results obtained on the analysis, synthesis and design of systems described by linear equations. It is well known that linear equations arise in most branches of science and engineering as well as social, biological and economic systems. The novelty of this approach is that no models of the system are assumed to be available, nor are they required. Instead, a few measurements made on the system can be processed strategically to directly extract design values that meet specifications without constructing a model of the system, implicitly or explicitly. These new concepts are illustrated by applying them to linear DC and AC circuits, mechanical, civil and hydraulic systems, signal flow block diagrams and control systems. These applications are preliminary and suggest many open problems. The results presented in this brief are the latest effort in this direction and the authors hope these will lead to attractive alternatives to model-based design of engineering and other systems.

  8. Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

    International Nuclear Information System (INIS)

    Fang Minggang; Nie, Yingchao; Theilmann, David A.

    2009-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

  9. Impedance Spectroscopy and AC Conductivity Studies of Bulk 3-Amino-7-(dimethylamino)-2-methyl-hydrochloride

    Science.gov (United States)

    El-Shabaan, M. M.

    2018-02-01

    Impedance spectroscopy and alternating-current (AC) conductivity (σ AC) studies of bulk 3-amino-7-(dimethylamino)-2-methyl-hydrochloride (neutral red, NR) have been carried out over the temperature (T) range from 303 K to 383 K and frequency (f) range from 0.5 kHz to 5 MHz. Dielectric data were analyzed using the complex impedance (Z *) and complex electric modulus (M *) for bulk NR at various temperatures. The impedance loss peaks were found to shift towards high frequencies, indicating an increase in the relaxation time (τ 0) and loss in the material, with increasing temperature. For each temperature, a single depressed semicircle was observed at high frequencies, originating from the bulk transport, and a spike in the low-frequency region, resulting from the electrode effect. Fitting of these curves yielded an equivalent circuit containing a parallel combination of a resistance R and constant-phase element (CPE) Q. The carrier transport in bulk NR is governed by the correlated barrier hopping (CBH) mechanism, some parameters of which, such as the maximum barrier height (W M), charge density (N), and hopping distance (r), were determined as functions of both temperature and frequency. The frequency dependence of σ AC at different temperatures indicated that the conduction in bulk NR is a thermally activated process. The σ AC value at different frequencies increased linearly with temperature.

  10. Molecular and functional characterization of CpACS27A gene reveals its involvement in monoecy instability and other associated traits in squash (Cucurbita pepo L.).

    Science.gov (United States)

    Martínez, Cecilia; Manzano, Susana; Megías, Zoraida; Barrera, Alejandro; Boualem, Adnane; Garrido, Dolores; Bendahmane, Abdelhafid; Jamilena, Manuel

    2014-06-01

    A number of Cucurbita pepo genotypes showing instable monoecy or partial andromonoecy, i.e. an incomplete conversion of female into bisexual flowers, have been detected. Given that in melon and cucumber andromonoecy is the result of reduction of ethylene production in female floral buds, caused by mutations in the ethylene biosynthesis genes CmACS7 and CsACS2; we have cloned and characterized two related C. pepo genes, CpACS27A and CpACS27B. The molecular structure of CpACS27A and its specific expression in the carpels of female flowers during earlier stages of flower development suggests that this gene is the Cucurbita ortholog of CmACS7 and CsACS2. CpACS27B is likely to be a paralogous pseudogene since it has not been found to be expressed in any of the analyzed tissues. CpACS27A was sequenced in Bolognese (Bog) and Vegetable Spaghetti (Veg), two monoecious inbred lines whose F2 was segregating for partial andromonoecy. The Bog allele of CpACS27A carried a missense mutation that resulted in a substitution of the conserved serine residue in position 176 by an alanine. Segregation analysis indicated that this mutant variant is necessary but not sufficient to confer the andromonoecious phenotype in squash. In concordance with its involvement in stamen arrest, a reduction in CpACS27A expression has been found in bisexual flower buds at earlier stages of development. This reduction in CpACS27A expression was concomitant with a downregulation of other ethylene biosynthesis and signaling genes during earlier and later stages of ovary development. The role of CpACS27A is discussed regarding the regulation of ethylene biosynthesis and signaling genes in the control of andromonoecy-associated traits, such as the delayed maturation of corolla and stigma as well as the parthenocarpic development of the fruit.

  11. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  12. Comparative methods to assess harmonic response of nonlinear piezoelectric energy harvesters interfaced with AC and DC circuits

    Science.gov (United States)

    Lan, Chunbo; Tang, Lihua; Harne, Ryan L.

    2018-05-01

    Nonlinear piezoelectric energy harvester (PEH) has been widely investigated during the past few years. Among the majority of these researches, a pure resistive load is used to evaluate power output. To power conventional electronics in practical application, the alternating current (AC) generated by nonlinear PEH needs to be transformed into a direct current (DC) and rectifying circuits are required to interface the device and electronic load. This paper aims at exploring the critical influences of AC and DC interface circuits on nonlinear PEH. As a representative nonlinear PEH, we fabricate and evaluate a monostable PEH in terms of generated power and useful operating bandwidth when it is connected to AC and DC interface circuits. Firstly, the harmonic balance analysis and equivalent circuit representation method are utilized to tackle the modeling of nonlinear energy harvesters connected to AC and DC interface circuits. The performances of the monostable PEH connected to these interface circuits are then analyzed and compared, focusing on the influences of the varying load, excitation and electromechanical coupling strength on the nonlinear dynamics, bandwidth and harvested power. Subsequently, the behaviors of the monostable PEH with AC and DC interface circuits are verified by experiment. Results indicate that both AC and DC interface circuits have a peculiar influence on the power peak shifting and operational bandwidth of the monostable PEH, which is quite different from that on the linear PEH.

  13. Foundations of linear and generalized linear models

    CERN Document Server

    Agresti, Alan

    2015-01-01

    A valuable overview of the most important ideas and results in statistical analysis Written by a highly-experienced author, Foundations of Linear and Generalized Linear Models is a clear and comprehensive guide to the key concepts and results of linear statistical models. The book presents a broad, in-depth overview of the most commonly used statistical models by discussing the theory underlying the models, R software applications, and examples with crafted models to elucidate key ideas and promote practical model building. The book begins by illustrating the fundamentals of linear models,

  14. Electrodynamic linear motor

    Energy Technology Data Exchange (ETDEWEB)

    Munehiro, H

    1980-05-29

    When driving the carriage of a printer through a rotating motor, there are problems regarding the limited accuracy of the carriage position due to rotation or contraction and ageing of the cable. In order to solve the problem, a direct drive system was proposed, in which the printer carriage is driven by a linear motor. If one wants to keep the motor circuit of such a motor compact, then the magnetic flux density in the air gap must be reduced or the motor travel must be reduced. It is the purpose of this invention to create an electrodynamic linear motor, which on the one hand is compact and light and on the other hand has a relatively high constant force over a large travel. The invention is characterised by the fact that magnetic fields of alternating polarity are generated at equal intervals in the magnetic field, and that the coil arrangement has 2 adjacent coils, whose size corresponds to half the length of each magnetic pole. A logic circuit is provided to select one of the two coils and to determine the direction of the current depending on the signals of a magnetic field sensor on the coil arrangement.

  15. Fluid Flow and Mixing Induced by AC Continuous Electrowetting of Liquid Metal Droplet

    Directory of Open Access Journals (Sweden)

    Qingming Hu

    2017-04-01

    Full Text Available In this work, we proposed a novel design of a microfluidic mixer utilizing the amplified Marangoni chaotic advection induced by alternating current (AC continuous electrowetting of a metal droplet situated in electrolyte solution, due to the linear and quadratic voltage-dependence of flow velocity at small or large voltages, respectively. Unlike previous researchers exploiting the unidirectional surface stress with direct current (DC bias at droplet/medium interface for pumping of electrolytes where the resulting flow rate is linearly proportional to the field intensity, dominance of another kind of dipolar flow pattern caused by local Marangoni stress at the drop surface in a sufficiently intense AC electric field is demonstrated by both theoretical analysis and experimental observation, which exhibits a quadratic growth trend as a function of the applied voltage. The dipolar shear stress merely appears at larger voltages and greatly enhances the mixing performance by inducing chaotic advection between the neighboring laminar flow. The mixer design developed herein, on the basis of amplified Marangoni chaotic advection around a liquid metal droplet at larger AC voltages, has great potential for chemical reaction and microelectromechanical systems (MEMS actuator applications because of generating high-throughput and excellent mixing performance at the same time.

  16. Transcranial alternating current stimulation (tACS

    Directory of Open Access Journals (Sweden)

    Andrea eAntal

    2013-06-01

    Full Text Available Transcranial alternating current stimulation (tACS seems likely to open a new era of the field of noninvasive electrical stimulation of the human brain by directly interfering with cortical rhythms. It is expected to synchronize (by one single resonance frequency or desynchronize (e.g. by the application of several frequencies cortical oscillations. If applied long enough it may cause neuroplastic effects. In the theta range it may improve cognition when applied in phase. Alpha rhythms could improve motor performance, whereas beta intrusion may deteriorate them. TACS with both alpha and beta frequencies has a high likelihood to induce retinal phosphenes. Gamma intrusion can possibly interfere with attention. Stimulation in the ripple range induces intensity dependent inhibition or excitation in the motor cortex most likely by entrainment of neuronal networks, whereas stimulation in the low kHz range induces excitation by neuronal membrane interference. TACS in the 200 kHz range may have a potential in oncology.

  17. Ac loss measurement of SSC dipole magnets

    International Nuclear Information System (INIS)

    Delchamps, S.; Hanft, R.; Jaffery, T.; Kinney, W.; Koska, W.; Lamm, M.J.; Mazur, P.O.; Orris, D.; Ozelis, J.P.; Strait, J.; Wake, M.

    1992-09-01

    AC losses in full length and 1.5 m model SSC collider dipoles were successfully measured by the direct observation of energy flow into and out of magnets during a ramp cycle. The measurement was performed by using two double-integrating type digital volt meters (DVM's) for current and voltage measurement. Measurements were performed for six is m long ASST magnets and five 1.5 m long model magnets, inducting one 40 mm diameter magnet. There were large variations in the eddy current losses. Since these magnets use conductors with slight deviations in their internal structures and processing of the copper surface depending on the manufacturer, it is likely that there are differences in the contact resistance between strands. Correlation between the ramp rate dependence of the,quench current and the eddy current loss was evident

  18. This research is to study the factors which influence the business success of small business ‘processed rotan’. The data employed in the study are primary data within the period of July to August 2013, 30 research observations through census method. Method of analysis used in the study is multiple linear regressions. The results of analysis showed that the factors of labor, innovation and promotion have positive and significant influence on the business success of small business ‘processed rotan’ simultaneously. The analysis also showed that partially labor has positive and significant influence on the business success, yet innovation and promotion have insignificant and positive influence on the business success.

    OpenAIRE

    Nasution, Inggrita Gusti Sari; Muchtar, Yasmin Chairunnisa

    2013-01-01

    This research is to study the factors which influence the business success of small business ‘processed rotan’. The data employed in the study are primary data within the period of July to August 2013, 30 research observations through census method. Method of analysis used in the study is multiple linear regressions. The results of analysis showed that the factors of labor, innovation and promotion have positive and significant influence on the business success of small busine...

  19. Cosmic Shear With ACS Pure Parallels. Targeted Portion.

    Science.gov (United States)

    Rhodes, Jason

    2002-07-01

    Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan i {F775W} we will measure for the first time: the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

  20. Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

    Directory of Open Access Journals (Sweden)

    Evi Ploumpidou

    2017-12-01

    Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

  1. Magnetic irreversibility in granular superconductors: ac susceptibility study

    International Nuclear Information System (INIS)

    Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.

    1991-01-01

    Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)

  2. Model Predictive Control of Power Converters for Robust and Fast Operation of AC Microgrids

    DEFF Research Database (Denmark)

    Dragicevic, Tomislav

    2018-01-01

    the load power at the same time. Those functionalities are conventionally achieved by hierarchical linear control loops. However, they have limited transient response and high sensitivity to parameter variations. This paper aims to mitigate these problems by firstly introducing an improvement of the FCS......This paper proposes the application of a finite control set model predictive control (FCS-MPC) strategy in standalone ac microgrids (MGs). AC MGs are usually built from two or more voltage source converters (VSCs) which can regulate the voltage at the point of common coupling, while sharing......-MPC strategy for a single VSC based on tracking of derivative of the voltage reference trajectory. Using only a single step prediction horizon, the proposed strategy exhibits low computational expense but provides steady state performance comparable to PWM, while its transient response and robustness...

  3. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  4. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  5. Detecting positive quadrant dependence and positive function dependence

    NARCIS (Netherlands)

    Janic-Wróblewska, A.; Kallenberg, W.C.M.; Ledwina, T.

    2004-01-01

    There is a lot of interest in positive dependence going beyond linear correlation. In this paper three new rank tests for testing independence against positive dependence are introduced. The first one is directed on positive quadrant dependence, the second and third one concentrate on positive

  6. Detecting positive quadrant dependence and positive function dependence

    NARCIS (Netherlands)

    Janic-Wróblewska, A.; Kallenberg, W.C.M.; Ledwina, T.

    2003-01-01

    There is a lot of interest in positive dependence going beyond linear correlation. In this paper three new rank tests for testing independence against positive dependence are introduced. The first one is directed on positive quadrant dependence, the second and third one concentrate on positive

  7. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...

  8. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  9. Measurement of Anisotropic Particle Interactions with Nonuniform ac Electric Fields.

    Science.gov (United States)

    Rupp, Bradley; Torres-Díaz, Isaac; Hua, Xiaoqing; Bevan, Michael A

    2018-02-20

    Optical microscopy measurements are reported for single anisotropic polymer particles interacting with nonuniform ac electric fields. The present study is limited to conditions where gravity confines particles with their long axis parallel to the substrate such that particles can be treated using quasi-2D analysis. Field parameters are investigated that result in particles residing at either electric field maxima or minima and with long axes oriented either parallel or perpendicular to the electric field direction. By nonintrusively observing thermally sampled positions and orientations at different field frequencies and amplitudes, a Boltzmann inversion of the time-averaged probability of states yields kT-scale energy landscapes (including dipole-field, particle-substrate, and gravitational potentials). The measured energy landscapes show agreement with theoretical potentials using particle conductivity as the sole adjustable material property. Understanding anisotropic particle-field energy landscapes vs field parameters enables quantitative control of local forces and torques on single anisotropic particles to manipulate their position and orientation within nonuniform fields.

  10. Negative hydrogen ion beam extraction from an AC heated cathode driven Bernas-type ion source

    Energy Technology Data Exchange (ETDEWEB)

    Okano, Y.; Miyamoto, N.; Kasuya, T.; Wada, M.

    2015-04-08

    A plasma grid structure was installed to a Bernas-type ion source used for ion implantation equipment. A negative hydrogen (H{sup −}) ion beam was extracted by an AC driven ion source by adjusting the bias to the plasma grid. The extracted electron current was reduced by positively biasing the plasma grid, while an optimum plasma grid bias voltage for negative ion beam extraction was found to be positive 3 V with respect to the arc chamber. Source operations with AC cathode heating show extraction characteristics almost identical to that with DC cathode heating, except a minute increase in H{sup −} current at higher frequency of cathode heating current.

  11. A linear programming manual

    Science.gov (United States)

    Tuey, R. C.

    1972-01-01

    Computer solutions of linear programming problems are outlined. Information covers vector spaces, convex sets, and matrix algebra elements for solving simultaneous linear equations. Dual problems, reduced cost analysis, ranges, and error analysis are illustrated.

  12. Ac and dc motor flooding times

    International Nuclear Information System (INIS)

    Crowley, D.A.; Hinton, J.H.

    1988-01-01

    Reactor safety studies, such as the emergency cooling system (ECS) limits analyses and the probabilistic risk assessment, require that the flood-out times be calculated for the ac and dc motors at the -40 foot level. New calculations are needed because dams of an improved design have been installed between the pump room and motor room, and because updated leak rate calculations have shown that the maximum possible leak rate is larger than that which had been previously calculated. The methodology for calculating the motor flood-out times has also been improved. A computer program has been written to calculate flood-out times for various leak rates and sump pump operabilities. For ECS limits analyses, the worst case dc motor flood-out times are 161 and 297 seconds in LKC and P-areas, respectively. These times are for a 135,468 gpm leak that first flows to the motor room and all of the sump pumps are off

  13. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  14. Linear shaped charge

    Energy Technology Data Exchange (ETDEWEB)

    Peterson, David; Stofleth, Jerome H.; Saul, Venner W.

    2017-07-11

    Linear shaped charges are described herein. In a general embodiment, the linear shaped charge has an explosive with an elongated arrowhead-shaped profile. The linear shaped charge also has and an elongated v-shaped liner that is inset into a recess of the explosive. Another linear shaped charge includes an explosive that is shaped as a star-shaped prism. Liners are inset into crevices of the explosive, where the explosive acts as a tamper.

  15. Classifying Linear Canonical Relations

    OpenAIRE

    Lorand, Jonathan

    2015-01-01

    In this Master's thesis, we consider the problem of classifying, up to conjugation by linear symplectomorphisms, linear canonical relations (lagrangian correspondences) from a finite-dimensional symplectic vector space to itself. We give an elementary introduction to the theory of linear canonical relations and present partial results toward the classification problem. This exposition should be accessible to undergraduate students with a basic familiarity with linear algebra.

  16. Introduction of hvdc transmission into a predominantly ac network

    Energy Technology Data Exchange (ETDEWEB)

    Casson, W; Last, F H; Huddart, K W

    1966-02-01

    Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.

  17. Low ac loss geometries in YBCO coated conductors

    International Nuclear Information System (INIS)

    Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

  18. Low ac loss geometries in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

    2007-10-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

  19. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  20. Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

    Indian Academy of Sciences (India)

    SHARIF F ZAMAN

    the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.

  1. ELECTRONIC SYSTEM FOR EXPERIMENTATION IN AC ELECTROGRAVIMETRY I: TECHNIQUE FUNDAMENTALS

    Directory of Open Access Journals (Sweden)

    Róbinson Torres

    Full Text Available Basic fundamentals of AC electrogravimetry are introduced. Their main requirements and characteristics are detailed to establish the design of an electronic system that allows the appropriate extraction of data needed to determine the electrogravimetric transfer function (EGTF and electrochemical impedance (EI, in an experimental set-up for the AC electrogravimetry technique.

  2. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  3. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...

  4. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

  5. Effect of temperature on the AC impedance of protein

    Indian Academy of Sciences (India)

    The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...

  6. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...

  7. A Numerical Simulation Of The Pulse Sequence Reconstruction in AC Biased TESs With a β Source

    International Nuclear Information System (INIS)

    Ferrari, Lorenza; Vaccarone, Renzo

    2009-01-01

    We study the response of micro-calorimeters based on Ir/Au TESs biased by an AC voltage in the MHz range to the power input generated by beta emission in a Re source thermally connected to the calorimeter itself. The micro-calorimeter is assumed to work at -80 mK, and the energy pulses corresponding to the beta emission have an energy distributed between zero and 2.58 KeV. In this numerical simulation the TES is inserted in a RLC resonating circuit, with a low quality factor. The thermal conductivities between the source and the calorimeter and that from the calorimeter to the heat sink are non-linear. The superconducting to normal transition of the TES is described by a realistic non-linear model. The AC current at the carrier frequency, modulated by the changing resistance of the TES, is demodulated and the output is filtered. The resulting signal is analyzed to deduce the attainable time resolution and the linearity of the response.

  8. Quasienergy spectrum and tunneling current in ac-driven triple quantum dot shuttles

    Energy Technology Data Exchange (ETDEWEB)

    Villavicencio, J [Facultad de Ciencias, Universidad Autonoma de Baja California, Ensenada (Mexico); Maldonado, I [Centro de Investigacion Cientifica y de Educacion Superior de Ensenada (Mexico); Cota, E [Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autonoma de Mexico, Ensenada (Mexico); Platero, G, E-mail: villavics@uabc.edu.mx [Instituto de Ciencia de Materiales de Madrid (CSIC), Cantoblanco, 28049 Madrid (Spain)

    2011-02-15

    The dynamics of electrons in ac-driven double quantum dots have been extensively analyzed by means of Floquet theory. In these systems, coherent destruction of tunneling has been shown to occur for certain ac field parameters. In this work we analyze, by means of Floquet theory, the electron dynamics of a triple quantum dot in series attached to electric contacts, where the central dot position oscillates. In particular, we analyze the quasienergy spectrum of this ac-driven nanoelectromechanical system as a function of the intensity and frequency of the ac field and of external dc voltages. For strong driving fields, we derive, by means of perturbation theory, analytical expressions for the quasienergies of the driven oscillator system. From this analysis, we discuss the conditions for coherent destruction of tunneling (CDT) to occur as a function of detuning and field parameters. For zero detuning, and from the invariance of the Floquet Hamiltonian under a generalized parity transformation, we find analytical expressions describing the symmetry properties of the Fourier components of the Floquet states under such a transformation. By using these expressions, we show that in the vicinity of the CDT condition, the quasienergy spectrum exhibits exact crossings which can be characterized by the parity properties of the corresponding eigenvectors.

  9. Linear-Algebra Programs

    Science.gov (United States)

    Lawson, C. L.; Krogh, F. T.; Gold, S. S.; Kincaid, D. R.; Sullivan, J.; Williams, E.; Hanson, R. J.; Haskell, K.; Dongarra, J.; Moler, C. B.

    1982-01-01

    The Basic Linear Algebra Subprograms (BLAS) library is a collection of 38 FORTRAN-callable routines for performing basic operations of numerical linear algebra. BLAS library is portable and efficient source of basic operations for designers of programs involving linear algebriac computations. BLAS library is supplied in portable FORTRAN and Assembler code versions for IBM 370, UNIVAC 1100 and CDC 6000 series computers.

  10. Levitação acústica

    OpenAIRE

    Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

    2015-01-01

    A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

  11. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  12. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    . This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...

  13. Successful enrichment of the ubiquitous freshwater acI Actinobacteria.

    Science.gov (United States)

    Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk

    2014-02-01

    Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

  14. Uniform Orientation of Biotinylated Nanobody as an Affinity Binder for Detection of Bacillus thuringiensis (Bt) Cry1Ac Toxin

    Science.gov (United States)

    Li, Min; Zhu, Min; Zhang, Cunzheng; Liu, Xianjin; Wan, Yakun

    2014-01-01

    Nanobodies are the smallest natural fragments with useful properties such as high affinity, distinct paratope and high stability, which make them an ideal tool for detecting target antigens. In this study, we generated and characterized nanobodies against the Cry1Ac toxin and applied them in a biotin-streptavidin based double antibodies (nanobodies) sandwich-ELISA (DAS-ELISA) assay. After immunizing a camel with soluble Cry1Ac toxin, a phage displayed library was constructed to generate Nbs against the Cry1Ac toxin. Through successive rounds of affinity bio-panning, four nanobodies with greatest diversity in CDR3 sequences were obtained. After affinity determination and conjugating to HRP, two nanobodies with high affinity which can recognize different epitopes of the same antigen (Cry1Ac) were selected as capture antibody (Nb61) and detection antibody (Nb44). The capture antibody (Nb61) was biotinylated in vivo for directional immobilization on wells coated with streptavidin matrix. Both results of specificity analysis and thermal stability determination add support for reliability of the following DAS-ELISA with a minimum detection limit of 0.005 μg·mL−1 and a working range 0.010–1.0 μg·mL−1. The linear curve displayed an acceptable correlation coefficient of 0.9976. These results indicated promising applications of nanobodies for detection of Cry1Ac toxin with biotin-streptavidin based DAS-ELISA system. PMID:25474492

  15. Uniform Orientation of Biotinylated Nanobody as an Affinity Binder for Detection of Bacillus thuringiensis (Bt Cry1Ac Toxin

    Directory of Open Access Journals (Sweden)

    Min Li

    2014-12-01

    Full Text Available Nanobodies are the smallest natural fragments with useful properties such as high affinity, distinct paratope and high stability, which make them an ideal tool for detecting target antigens. In this study, we generated and characterized nanobodies against the Cry1Ac toxin and applied them in a biotin-streptavidin based double antibodies (nanobodies sandwich-ELISA (DAS-ELISA assay. After immunizing a camel with soluble Cry1Ac toxin, a phage displayed library was constructed to generate Nbs against the Cry1Ac toxin. Through successive rounds of affinity bio-panning, four nanobodies with greatest diversity in CDR3 sequences were obtained. After affinity determination and conjugating to HRP, two nanobodies with high affinity which can recognize different epitopes of the same antigen (Cry1Ac were selected as capture antibody (Nb61 and detection antibody (Nb44. The capture antibody (Nb61 was biotinylated in vivo for directional immobilization on wells coated with streptavidin matrix. Both results of specificity analysis and thermal stability determination add support for reliability of the following DAS-ELISA with a minimum detection limit of 0.005 μg·mL−1 and a working range 0.010–1.0 μg·mL−1. The linear curve displayed an acceptable correlation coefficient of 0.9976. These results indicated promising applications of nanobodies for detection of Cry1Ac toxin with biotin-streptavidin based DAS-ELISA system.

  16. Network-constrained AC unit commitment under uncertainty: A Benders' decomposition approach

    DEFF Research Database (Denmark)

    Nasri, Amin; Kazempour, Seyyedjalal; Conejo, Antonio J.

    2015-01-01

    . The proposed model is formulated as a two-stage stochastic programming problem, whose first-stage refers to the day-ahead market, and whose second-stage represents real-time operation. The proposed Benders’ approach allows decomposing the original problem, which is mixed-integer nonlinear and generally...... intractable, into a mixed-integer linear master problem and a set of nonlinear, but continuous subproblems, one per scenario. In addition, to temporally decompose the proposed ac unit commitment problem, a heuristic technique is used to relax the inter-temporal ramping constraints of the generating units...

  17. Optimizing efficiency on conventional transformer based low power AC/DC standby power supplies

    DEFF Research Database (Denmark)

    Nielsen, Nils

    2004-01-01

    This article describes the research results for simple and cheap methods to reduce the idle- and load-losses in very low power conventional transformer based power supplies intended for standby usage. In this case "very low power" means 50 Hz/230 V-AC to 5 V-DC@1 W. The efficiency is measured...... on two common power supply topologies designed for this power level. The two described topologies uses either a series (or linear) or a buck regulation approach. Common to the test power supplies is they either are using a standard cheap off-the-shelf transformer, or one, which are loss optimized by very...

  18. AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

    International Nuclear Information System (INIS)

    McCarthy, Christina B.; Theilmann, David A.

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

  19. Linear and nonlinear optical properties of a hydrogenic donor in lens-shaped quantum dots

    International Nuclear Information System (INIS)

    Vahdani, M.R.K.; Rezaei, G.

    2009-01-01

    Optical transitions in a Lens-Shaped Quantum Dot (LSD) are investigated in the presence of a hydrogenic impurity. The electronic wave functions are obtained analytically and the energy eigenvalues are calculated numerically. The density matrix formulation with the intersubband relaxation are used to evaluate the (linear and third order nonlinear) absorption coefficient (AC) and the change in the refractive indices (RI) analytically. The effect of the size of the LSD and optical intensity on the AC and RI are investigated. It is found that AC and RI are strongly affected by the optical intensity and the size of the LSD.

  20. Linear and nonlinear optical properties of a hydrogenic donor in lens-shaped quantum dots

    Energy Technology Data Exchange (ETDEWEB)

    Vahdani, M.R.K. [Department of Physics, College of Sciences, Shiraz University, Shiraz 71454 (Iran, Islamic Republic of); Rezaei, G., E-mail: grezaei@mail.yu.ac.i [Department of Physics, College of Sciences, Yasouj University, Yasouj 75914 (Iran, Islamic Republic of)

    2009-08-17

    Optical transitions in a Lens-Shaped Quantum Dot (LSD) are investigated in the presence of a hydrogenic impurity. The electronic wave functions are obtained analytically and the energy eigenvalues are calculated numerically. The density matrix formulation with the intersubband relaxation are used to evaluate the (linear and third order nonlinear) absorption coefficient (AC) and the change in the refractive indices (RI) analytically. The effect of the size of the LSD and optical intensity on the AC and RI are investigated. It is found that AC and RI are strongly affected by the optical intensity and the size of the LSD.

  1. Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

    Science.gov (United States)

    Luczak, Susan E; Rosen, I Gary

    2014-08-01

    Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

  2. ACS/WFC Sky Flats from Frontier Fields Imaging

    Science.gov (United States)

    Mack, J.; Lucas, R. A.; Grogin, N. A.; Bohlin, R. C.; Koekemoer, A. M.

    2018-04-01

    Parallel imaging data from the HST Frontier Fields campaign (Lotz et al. 2017) have been used to compute sky flats for the ACS/WFC detector in order to verify the accuracy of the current set of flat field reference files. By masking sources and then co-adding many deep frames, the F606W and F814W filters have enough combined background signal that from Poisson statistics are efficiency tracks the thickness of the two WFC chips. Observations of blue and red calibration standards measured at various positions on the detector (Bohlin et al. 2017) confirm the fidelity of the F814W flat, with aperture photometry consistent to 1% across the FOV, regardless of spectral type. At bluer wavelengths, the total sky background is substantially lower, and the F435W sky flat shows a combination of both flat errors and detector artifacts. Aperture photometry of the red standard star shows a maximum deviation of 1.4% across the array in this filter. Larger residuals up to 2.5% are found for the blue standard, suggesting that the spatial sensitivity in F435W depends on spectral type.

  3. Non linear system become linear system

    Directory of Open Access Journals (Sweden)

    Petre Bucur

    2007-01-01

    Full Text Available The present paper refers to the theory and the practice of the systems regarding non-linear systems and their applications. We aimed the integration of these systems to elaborate their response as well as to highlight some outstanding features.

  4. Linear motor coil assembly and linear motor

    NARCIS (Netherlands)

    2009-01-01

    An ironless linear motor (5) comprising a magnet track (53) and a coil assembly (50) operating in cooperation with said magnet track (53) and having a plurality of concentrated multi-turn coils (31 a-f, 41 a-d, 51 a-k), wherein the end windings (31E) of the coils (31 a-f, 41 a-e) are substantially

  5. Cell cycle- and chaperone-mediated regulation of H3K56ac incorporation in yeast.

    Science.gov (United States)

    Kaplan, Tommy; Liu, Chih Long; Erkmann, Judith A; Holik, John; Grunstein, Michael; Kaufman, Paul D; Friedman, Nir; Rando, Oliver J

    2008-11-01

    Acetylation of histone H3 lysine 56 is a covalent modification best known as a mark of newly replicated chromatin, but it has also been linked to replication-independent histone replacement. Here, we measured H3K56ac levels at single-nucleosome resolution in asynchronously growing yeast cultures, as well as in yeast proceeding synchronously through the cell cycle. We developed a quantitative model of H3K56ac kinetics, which shows that H3K56ac is largely explained by the genomic replication timing and the turnover rate of each nucleosome, suggesting that cell cycle profiles of H3K56ac should reveal most first-time nucleosome incorporation events. However, since the deacetylases Hst3/4 prevent use of H3K56ac as a marker for histone deposition during M phase, we also directly measured M phase histone replacement rates. We report a global decrease in turnover rates during M phase and a further specific decrease in turnover at several early origins of replication, which switch from rapidly replaced in G1 phase to stably bound during M phase. Finally, by measuring H3 replacement in yeast deleted for the H3K56 acetyltransferase Rtt109 and its two co-chaperones Asf1 and Vps75, we find evidence that Rtt109 and Asf1 preferentially enhance histone replacement at rapidly replaced nucleosomes, whereas Vps75 appears to inhibit histone turnover at those loci. These results provide a broad perspective on histone replacement/incorporation throughout the cell cycle and suggest that H3K56 acetylation provides a positive-feedback loop by which replacement of a nucleosome enhances subsequent replacement at the same location.

  6. Cell cycle- and chaperone-mediated regulation of H3K56ac incorporation in yeast.

    Directory of Open Access Journals (Sweden)

    Tommy Kaplan

    2008-11-01

    Full Text Available Acetylation of histone H3 lysine 56 is a covalent modification best known as a mark of newly replicated chromatin, but it has also been linked to replication-independent histone replacement. Here, we measured H3K56ac levels at single-nucleosome resolution in asynchronously growing yeast cultures, as well as in yeast proceeding synchronously through the cell cycle. We developed a quantitative model of H3K56ac kinetics, which shows that H3K56ac is largely explained by the genomic replication timing and the turnover rate of each nucleosome, suggesting that cell cycle profiles of H3K56ac should reveal most first-time nucleosome incorporation events. However, since the deacetylases Hst3/4 prevent use of H3K56ac as a marker for histone deposition during M phase, we also directly measured M phase histone replacement rates. We report a global decrease in turnover rates during M phase and a further specific decrease in turnover at several early origins of replication, which switch from rapidly replaced in G1 phase to stably bound during M phase. Finally, by measuring H3 replacement in yeast deleted for the H3K56 acetyltransferase Rtt109 and its two co-chaperones Asf1 and Vps75, we find evidence that Rtt109 and Asf1 preferentially enhance histone replacement at rapidly replaced nucleosomes, whereas Vps75 appears to inhibit histone turnover at those loci. These results provide a broad perspective on histone replacement/incorporation throughout the cell cycle and suggest that H3K56 acetylation provides a positive-feedback loop by which replacement of a nucleosome enhances subsequent replacement at the same location.

  7. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer

    Directory of Open Access Journals (Sweden)

    Phuc Thinh Doan

    2013-06-01

    Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43

  8. AC losses for the various voltage-leads in a semi-triple layer BSCCO conductor

    International Nuclear Information System (INIS)

    Li, Z.; Ryu, K.; Hwang, S.D.; Cha, G.; Song, H.J.

    2011-01-01

    Two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer. Voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The loss from the total-lead significantly differs from the sum of the wire losses. In order to investigate the AC loss of the multilayer conductor in a high temperature superconductor cable, a voltage-lead was generally attached to the outermost layer of the conductor. But the conductor's AC loss has not been completely cleared due to the various contact positions and arrangements of the voltage-lead. In this paper, we prepared a semi-triple layer conductor consisting of an inner layer and an outer layer with double layer structure. To measure the AC loss of the conductor, two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer and arranged along their surfaces, as well as another voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The results show that the AC losses for each layer measured from the inner-lead and the outer-lead, respectively, are identical to the sum of the wire losses. The AC losses in the semi-triple layer conductor measured from the total-lead and the outer-lead are identical for the uniform layer current density, and similar to the sum of the wire losses in both layers. However, the losses measured for the non-uniform layer current density from three voltage-leads are unequal to each other, and the loss from the total-lead significantly differs from the sum of the wire losses.

  9. Experimental study on the effects of AC electric fields on flame spreading over polyethylene-insulated electric-wire

    KAUST Repository

    Jin, Young Kyu

    2010-11-01

    In this present study, we experimentally investigated the effects of electric fields on the characteristics of flames spreading over electric-wires with AC fields. The dependence of the rate at which a flame spreads over polyethylene-insulated wires on the frequency and amplitude of the applied AC electric field was examined. The spreading of the flame can be categorized into linear spreading and non-linearly accelerated spreading of flame. This categorization is based on the axial distribution of the field strength of the applied electric field. The rate at which the flame spreads is highly dependent on the inclined direction of the wire fire. It could be possible to explain the spreading of the flame on the basis of thermal balance. © 2010 The Korean Society of Mechanical Engineers.

  10. Attitude and position tracking

    CSIR Research Space (South Africa)

    Candy, LP

    2011-01-01

    Full Text Available Several applications require the tracking of attitude and position of a body based on velocity data. It is tempting to use direction cosine matrices (DCM), for example, to track attitude based on angular velocity data, and to integrate the linear...

  11. Brain Oscillatory and Hemodynamic Activity in a Bimanual Coordination Task Following Transcranial Alternating Current Stimulation (tACS): A Combined EEG-fNIRS Study.

    Science.gov (United States)

    Berger, Alisa; Pixa, Nils H; Steinberg, Fabian; Doppelmayr, Michael

    2018-01-01

    Motor control is associated with synchronized oscillatory activity at alpha (8-12 Hz) and beta (12-30 Hz) frequencies in a cerebello-thalamo-cortical network. Previous studies demonstrated that transcranial alternating current stimulation (tACS) is capable of entraining ongoing oscillatory activity while also modulating motor control. However, the modulatory effects of tACS on both motor control and its underlying electro- and neurophysiological mechanisms remain ambiguous. Thus, the purpose of this study was to contribute to gathering neurophysiological knowledge regarding tACS effects by investigating the after-effects of 10 Hz tACS and 20 Hz tACS at parietal brain areas on bimanual coordination and its concurrent oscillatory and hemodynamic activity. Twenty-four right-handed healthy volunteers (12 females) aged between 18 and 30 ( M = 22.35 ± 3.62) participated in the study and performed a coordination task requiring bimanual movements. Concurrent to bimanual motor training, participants received either 10 Hz tACS, 20 Hz tACS or a sham stimulation over the parietal cortex (at P3/P4 electrode positions) for 20 min via small gel electrodes (3,14 cm 2 Ag/AgCl, amperage = 1 mA). Before and three time-points after tACS (immediately, 30 min and 1 day), bimanual coordination performance was assessed. Oscillatory activities were measured by electroencephalography (EEG) and hemodynamic changes were examined using functional near-infrared spectroscopy (fNIRS). Improvements of bimanual coordination performance were not differently between groups, thus, no tACS-specific effect on bimanual coordination performance emerged. However, physiological measures during the task revealed significant increases in parietal alpha activity immediately following 10 Hz tACS and 20 Hz tACS which were accompanied by significant decreases of Hboxy concentration in the right hemispheric motor cortex compared to the sham group. Based on the physiological responses, we conclude that tACS

  12. Brain Oscillatory and Hemodynamic Activity in a Bimanual Coordination Task Following Transcranial Alternating Current Stimulation (tACS: A Combined EEG-fNIRS Study

    Directory of Open Access Journals (Sweden)

    Alisa Berger

    2018-04-01

    Full Text Available Motor control is associated with synchronized oscillatory activity at alpha (8–12 Hz and beta (12–30 Hz frequencies in a cerebello-thalamo-cortical network. Previous studies demonstrated that transcranial alternating current stimulation (tACS is capable of entraining ongoing oscillatory activity while also modulating motor control. However, the modulatory effects of tACS on both motor control and its underlying electro- and neurophysiological mechanisms remain ambiguous. Thus, the purpose of this study was to contribute to gathering neurophysiological knowledge regarding tACS effects by investigating the after-effects of 10 Hz tACS and 20 Hz tACS at parietal brain areas on bimanual coordination and its concurrent oscillatory and hemodynamic activity. Twenty-four right-handed healthy volunteers (12 females aged between 18 and 30 (M = 22.35 ± 3.62 participated in the study and performed a coordination task requiring bimanual movements. Concurrent to bimanual motor training, participants received either 10 Hz tACS, 20 Hz tACS or a sham stimulation over the parietal cortex (at P3/P4 electrode positions for 20 min via small gel electrodes (3,14 cm2 Ag/AgCl, amperage = 1 mA. Before and three time-points after tACS (immediately, 30 min and 1 day, bimanual coordination performance was assessed. Oscillatory activities were measured by electroencephalography (EEG and hemodynamic changes were examined using functional near-infrared spectroscopy (fNIRS. Improvements of bimanual coordination performance were not differently between groups, thus, no tACS-specific effect on bimanual coordination performance emerged. However, physiological measures during the task revealed significant increases in parietal alpha activity immediately following 10 Hz tACS and 20 Hz tACS which were accompanied by significant decreases of Hboxy concentration in the right hemispheric motor cortex compared to the sham group. Based on the physiological responses, we conclude that

  13. dc Arc Fault Effect on Hybrid ac/dc Microgrid

    Science.gov (United States)

    Fatima, Zahra

    The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

  14. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  15. COMPARISON OF LINEAR CONTROLLERS FOR A

    DEFF Research Database (Denmark)

    Andersen, Torben Ole; Hansen, Michael Rygaard; Pedersen, Henrik C.

    2005-01-01

    on comparing different linear controllers, based on both simulation and experimental results, to determine what is obtainable when applying standard linear controllers to a hydraulic SISO servo system. The paper furthermore addresses how the performance may be improved by using internal pressure control......In many hydraulic control applications, classic linear controllers are still employed, although there exist a number of number of nonlinear control methods, which may be better suited for handling the intrensic non-linearities often found in hydraulic systems. The focus of this paper is therefore...... and model based information to include feedforward information. The control strategies considered are all based on measurement of piston position and pressure only....

  16. Linear collider: a preview

    Energy Technology Data Exchange (ETDEWEB)

    Wiedemann, H.

    1981-11-01

    Since no linear colliders have been built yet it is difficult to know at what energy the linear cost scaling of linear colliders drops below the quadratic scaling of storage rings. There is, however, no doubt that a linear collider facility for a center of mass energy above say 500 GeV is significantly cheaper than an equivalent storage ring. In order to make the linear collider principle feasible at very high energies a number of problems have to be solved. There are two kinds of problems: one which is related to the feasibility of the principle and the other kind of problems is associated with minimizing the cost of constructing and operating such a facility. This lecture series describes the problems and possible solutions. Since the real test of a principle requires the construction of a prototype I will in the last chapter describe the SLC project at the Stanford Linear Accelerator Center.

  17. Basic linear algebra

    CERN Document Server

    Blyth, T S

    2002-01-01

    Basic Linear Algebra is a text for first year students leading from concrete examples to abstract theorems, via tutorial-type exercises. More exercises (of the kind a student may expect in examination papers) are grouped at the end of each section. The book covers the most important basics of any first course on linear algebra, explaining the algebra of matrices with applications to analytic geometry, systems of linear equations, difference equations and complex numbers. Linear equations are treated via Hermite normal forms which provides a successful and concrete explanation of the notion of linear independence. Another important highlight is the connection between linear mappings and matrices leading to the change of basis theorem which opens the door to the notion of similarity. This new and revised edition features additional exercises and coverage of Cramer's rule (omitted from the first edition). However, it is the new, extra chapter on computer assistance that will be of particular interest to readers:...

  18. Linear collider: a preview

    International Nuclear Information System (INIS)

    Wiedemann, H.

    1981-11-01

    Since no linear colliders have been built yet it is difficult to know at what energy the linear cost scaling of linear colliders drops below the quadratic scaling of storage rings. There is, however, no doubt that a linear collider facility for a center of mass energy above say 500 GeV is significantly cheaper than an equivalent storage ring. In order to make the linear collider principle feasible at very high energies a number of problems have to be solved. There are two kinds of problems: one which is related to the feasibility of the principle and the other kind of problems is associated with minimizing the cost of constructing and operating such a facility. This lecture series describes the problems and possible solutions. Since the real test of a principle requires the construction of a prototype I will in the last chapter describe the SLC project at the Stanford Linear Accelerator Center

  19. DC and AC biasing of a transition edge sensor microcalorimeter

    International Nuclear Information System (INIS)

    Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.

    2002-01-01

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  20. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2015-01-01

    Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...

  1. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2014-01-01

    Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...

  2. Analysis of Input and Output Ripples of PWM AC Choppers

    Directory of Open Access Journals (Sweden)

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  3. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  4. Distributed cooperative control of AC microgrids

    Science.gov (United States)

    Bidram, Ali

    In this dissertation, the comprehensive secondary control of electric power microgrids is of concern. Microgrid technical challenges are mainly realized through the hierarchical control structure, including primary, secondary, and tertiary control levels. Primary control level is locally implemented at each distributed generator (DG), while the secondary and tertiary control levels are conventionally implemented through a centralized control structure. The centralized structure requires a central controller which increases the reliability concerns by posing the single point of failure. In this dissertation, the distributed control structure using the distributed cooperative control of multi-agent systems is exploited to increase the secondary control reliability. The secondary control objectives are microgrid voltage and frequency, and distributed generators (DGs) active and reactive powers. Fully distributed control protocols are implemented through distributed communication networks. In the distributed control structure, each DG only requires its own information and the information of its neighbors on the communication network. The distributed structure obviates the requirements for a central controller and complex communication network which, in turn, improves the system reliability. Since the DG dynamics are nonlinear and non-identical, input-output feedback linearization is used to transform the nonlinear dynamics of DGs to linear dynamics. Proposed control frameworks cover the control of microgrids containing inverter-based DGs. Typical microgrid test systems are used to verify the effectiveness of the proposed control protocols.

  5. Matrices and linear transformations

    CERN Document Server

    Cullen, Charles G

    1990-01-01

    ""Comprehensive . . . an excellent introduction to the subject."" - Electronic Engineer's Design Magazine.This introductory textbook, aimed at sophomore- and junior-level undergraduates in mathematics, engineering, and the physical sciences, offers a smooth, in-depth treatment of linear algebra and matrix theory. The major objects of study are matrices over an arbitrary field. Contents include Matrices and Linear Systems; Vector Spaces; Determinants; Linear Transformations; Similarity: Part I and Part II; Polynomials and Polynomial Matrices; Matrix Analysis; and Numerical Methods. The first

  6. Efficient Non Linear Loudspeakers

    DEFF Research Database (Denmark)

    Petersen, Bo R.; Agerkvist, Finn T.

    2006-01-01

    Loudspeakers have traditionally been designed to be as linear as possible. However, as techniques for compensating non linearities are emerging, it becomes possible to use other design criteria. This paper present and examines a new idea for improving the efficiency of loudspeakers at high levels...... by changing the voice coil layout. This deliberate non-linear design has the benefit that a smaller amplifier can be used, which has the benefit of reducing system cost as well as reducing power consumption....

  7. NO removal characteristics of a corona radical shower system under DC and AC/DC superimposed operations

    NARCIS (Netherlands)

    Yan, K.; Yamamoto, T.; Kanazawa, S.; Ohkubo, T.; Nomoto, Y.; Chang, Jen-Shih

    2001-01-01

    In this paper, the effects of the applied voltage modes on the positive corona discharge morphology and NO removal characteristics from air streams are experimentally investigated. By using a DC superimposed high frequency AC power supply (10-60 kHz), a uniform streamer corona can be generated,

  8. Building a Database for the Historical Analysis of the General Chemistry Curriculum Using ACS General Chemistry Exams as Artifacts

    Science.gov (United States)

    Luxford, Cynthia J.; Linenberger, Kimberly J.; Raker, Jeffrey R.; Baluyut, John Y.; Reed, Jessica J.; De Silva, Chamila; Holme, Thomas A.

    2015-01-01

    As a discipline, chemistry enjoys a unique position. While many academic areas prepared "cooperative examinations" in the 1930s, only chemistry maintained the activity within what has become the ACS Examinations Institute. As a result, the long-term existence of community-built, norm-referenced, standardized exams provides a historical…

  9. Linear models with R

    CERN Document Server

    Faraway, Julian J

    2014-01-01

    A Hands-On Way to Learning Data AnalysisPart of the core of statistics, linear models are used to make predictions and explain the relationship between the response and the predictors. Understanding linear models is crucial to a broader competence in the practice of statistics. Linear Models with R, Second Edition explains how to use linear models in physical science, engineering, social science, and business applications. The book incorporates several improvements that reflect how the world of R has greatly expanded since the publication of the first edition.New to the Second EditionReorganiz

  10. Linear integrated circuits

    CERN Document Server

    Carr, Joseph

    1996-01-01

    The linear IC market is large and growing, as is the demand for well trained technicians and engineers who understand how these devices work and how to apply them. Linear Integrated Circuits provides in-depth coverage of the devices and their operation, but not at the expense of practical applications in which linear devices figure prominently. This book is written for a wide readership from FE and first degree students, to hobbyists and professionals.Chapter 1 offers a general introduction that will provide students with the foundations of linear IC technology. From chapter 2 onwa

  11. Superconducting linear accelerator cryostat

    International Nuclear Information System (INIS)

    Ben-Zvi, I.; Elkonin, B.V.; Sokolowski, J.S.

    1984-01-01

    A large vertical cryostat for a superconducting linear accelerator using quarter wave resonators has been developed. The essential technical details, operational experience and performance are described. (author)

  12. A Linear Electromagnetic Piston Pump

    Science.gov (United States)

    Hogan, Paul H.

    Advancements in mobile hydraulics for human-scale applications have increased demand for a compact hydraulic power supply. Conventional designs couple a rotating electric motor to a hydraulic pump, which increases the package volume and requires several energy conversions. This thesis investigates the use of a free piston as the moving element in a linear motor to eliminate multiple energy conversions and decrease the overall package volume. A coupled model used a quasi-static magnetic equivalent circuit to calculate the motor inductance and the electromagnetic force acting on the piston. The force was an input to a time domain model to evaluate the mechanical and pressure dynamics. The magnetic circuit model was validated with finite element analysis and an experimental prototype linear motor. The coupled model was optimized using a multi-objective genetic algorithm to explore the parameter space and maximize power density and efficiency. An experimental prototype linear pump coupled pistons to an off-the-shelf linear motor to validate the mechanical and pressure dynamics models. The magnetic circuit force calculation agreed within 3% of finite element analysis, and within 8% of experimental data from the unoptimized prototype linear motor. The optimized motor geometry also had good agreement with FEA; at zero piston displacement, the magnetic circuit calculates optimized motor force within 10% of FEA in less than 1/1000 the computational time. This makes it well suited to genetic optimization algorithms. The mechanical model agrees very well with the experimental piston pump position data when tuned for additional unmodeled mechanical friction. Optimized results suggest that an improvement of 400% of the state of the art power density is attainable with as high as 85% net efficiency. This demonstrates that a linear electromagnetic piston pump has potential to serve as a more compact and efficient supply of fluid power for the human scale.

  13. Sensorless AC electric motor control robust advanced design techniques and applications

    CERN Document Server

    Glumineau, Alain

    2015-01-01

    This monograph shows the reader how to avoid the burdens of sensor cost, reduced internal physical space, and system complexity in the control of AC motors. Many applications fields—electric vehicles, wind- and wave-energy converters and robotics, among them—will benefit. Sensorless AC Electric Motor Control describes the elimination of physical sensors and their replacement with observers, i.e., software sensors. Robustness is introduced to overcome problems associated with the unavoidable imperfection of knowledge of machine parameters—resistance, inertia, and so on—encountered in real systems. The details of a large number of speed- and/or position-sensorless ideas for different types of permanent-magnet synchronous motors and induction motors are presented along with several novel observer designs for electrical machines. Control strategies are developed using high-order, sliding-mode and quasi-continuous-sliding-mode techniques and two types of observer–controller schemes based on backstepping ...

  14. Linearity enigmas in ecology

    Energy Technology Data Exchange (ETDEWEB)

    Patten, B.C.

    1983-04-01

    Two issues concerning linearity or nonlinearity of natural systems are considered. Each is related to one of the two alternative defining properties of linear systems, superposition and decomposition. Superposition exists when a linear combination of inputs to a system results in the same linear combination of outputs that individually correspond to the original inputs. To demonstrate this property it is necessary that all initial states and inputs of the system which impinge on the output in question be included in the linear combination manipulation. As this is difficult or impossible to do with real systems of any complexity, nature appears nonlinear even though it may be linear. A linear system that displays nonlinear behavior for this reason is termed pseudononlinear. The decomposition property exists when the dynamic response of a system can be partitioned into an input-free portion due to state plus a state-free portion due to input. This is a characteristic of all linear systems, but not of nonlinear systems. Without the decomposition property, it is not possible to distinguish which portions of a system's behavior are due to innate characteristics (self) vs. outside conditions (environment), which is an important class of questions in biology and ecology. Some philosophical aspects of these findings are then considered. It is suggested that those ecologists who hold to the view that organisms and their environments are separate entities are in effect embracing a linear view of nature, even though their belief systems and mathematical models tend to be nonlinear. On the other hand, those who consider that organism-environment complex forms a single inseparable unit are implictly involved in non-linear thought, which may be in conflict with the linear modes and models that some of them use. The need to rectify these ambivalences on the part of both groups is indicated.

  15. A linear maglev guide for machine tools

    Energy Technology Data Exchange (ETDEWEB)

    Tieste, K D [Inst. of Mechanics, Univ. of Hannover (Germany); Popp, K [Inst. of Mechanics, Univ. of Hannover (Germany)

    1996-12-31

    Machine tools require linear guides with high slide velocity and very high position accuracy. The three tasks of a linear guide - supporting, guiding and driving - shall be realised by means of active magnetic bearings (AMB). The resulting linear magnetically levitated (maglev) guide has to accomplish the following characteristics: High stiffness, good damping and low noise as well as low heat production. First research on a one degree-of-freedom (DOF) support magnet unit aimed at the development of components and efficient control strategies for the linear maglev guide. The actual research is directed to realise a five DOF linear maglev guide for machine tools without drive to answer the question whether the maglev principle can be used for a linear axis in a machine tool. (orig.)

  16. Ultrasonic Linear Motor with Two Independent Vibrations

    Science.gov (United States)

    Muneishi, Takeshi; Tomikawa, Yoshiro

    2004-09-01

    We propose a new structure of an ultrasonic linear motor in order to solve the problems of high-power ultrasonic linear motors that drive the XY-stage for electron beam equipment and to expand the application fields of the motor. We pay special attention to the following three points: (1) the vibration in two directions of the ultrasonic linear motor should not influence mutually each other, (2) the vibration in two directions should be divided into the stage traveling direction and the pressing direction of the ultrasonic linear motor, and (3) the rigidity of the stage traveling direction of the ultrasonic linear motor should be increased. As a result, the supporting method of ultrasonic linear motors is simplified. The efficiency of the motor is improved and temperature rise is reduced. The stage position drift is also improved.

  17. Positive real balancing for nonlinear systems

    NARCIS (Netherlands)

    Ionescu, Tudor C.; Scherpen, Jacquelien M.A.; Ciuprina, G; Ioan, D

    2007-01-01

    We extend the positive real balancing procedure for passive linear systems to the nonlinear systems case. We show that, just like in the linear case, model reduction based on this technique preserves passivity.

  18. PREVENTION AND CONTROL OF TUBERCULOSIS *A.C. Okoh ...

    African Journals Online (AJOL)

    drclement

    *A.C. Okoh. Department of Community Health, University of Teaching Hospital Benin City,. Nigeria ... tuberculosis to be a global emergency. There is an ... laboratory capacity as few laboratories are ... control: Survelliance, planning, financing.

  19. Nontrivial ac spin response in the effective Luttinger model

    International Nuclear Information System (INIS)

    Hu Liangbin; Zhong Jiansong; Hu Kaige

    2006-01-01

    Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before

  20. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-01-01

    Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received

  1. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  2. AC/CRC adjacent lane surfacing : construction report.

    Science.gov (United States)

    1991-06-01

    Asphaltic Concrete (AC) and Portland Cement Concrete (PCC) are common roadway materials used in Oregon. In a recent construction project -- Poverty Flats/Mecham Section -- the Oregon State Highway Division (OSHD) designed, as part of the project, a "...

  3. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...

  4. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  5. c-axis ac susceptibility in high-Tc superconductors

    International Nuclear Information System (INIS)

    Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.

    1996-01-01

    We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

  6. Fast electric dipole transitions in Ra-Ac nuclei

    International Nuclear Information System (INIS)

    Ahmad, I.

    1985-01-01

    Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs

  7. National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit

    Science.gov (United States)

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...

  8. A THREE-PHASE BOOST DC-AC CONVERTER

    African Journals Online (AJOL)

    dc-ac converter (inverter) based on the dc-dc boost converters. ... Sliding mode controllers are designed to perform a robust control for the ... Computer simulations and spectral analysis demon- ... the conventional three-phase buck inverter,.

  9. AC/ARNG Integrated Division Concept Study, Appendices, Volume 3

    National Research Council Canada - National Science Library

    Twohig, John

    1997-01-01

    ...) division headquarters. The US Army Training and Doctrine Command (TRADOC) was tasked to conduct a viability assessment of the AC/ARNG Integrated Division concept and focus on merits and implementation issues...

  10. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto

    2014-01-01

    Analytical methods of cable performance in EHV AC electrical power are discussed in this comprehensive reference. Descriptions of energization, power quality, cable safety constraints and more, guide readers in cable planning and power network operations.

  11. Extension to AC Loss Minimisation in High Temperature Superconductors

    National Research Council Canada - National Science Library

    Campbell, Archie

    2004-01-01

    ...: (a) Measure the AC losses of appropriate Yttrium Barium Copper Oxide (YBCO) samples with strong potential for minimizing losses at high frequencies and magnetic fields with the existing equipment. (b...

  12. Effect of Dimension and Shape of Magnet on the Performance AC Generator with Translation Motion

    Science.gov (United States)

    Indriani, A.; Dimas, S.; Hendra

    2018-02-01

    The development of power plants using the renewable energy sources is very rapid. Renewable energy sources used solar energy, wind energy, ocean wave energy and other energy. All of these renewable energy sources require a processing device or a change of motion system to become electrical energy. One processing device is a generator which have work principle of converting motion (mechanical) energy into electrical energy with rotary shaft, blade and other motion components. Generator consists of several types of rotation motion and linear motion (translational). The generator have components such as rotor, stator and anchor. In the rotor and stator having magnet and winding coil as an electric generating part of the electric motion force. Working principle of AC generator with linear motion (translation) also apply the principle of Faraday that is using magnetic induction which change iron magnet to produce magnetic flux. Magnetic flux is captured by the stator to be converted into electrical energy. Linear motion generators consist of linear induction machine, wound synchronous machine field, and permanent magnet synchronous [1]. Performance of synchronous generator of translation motion is influenced by magnet type, magnetic shape, coil winding, magnetic and coil spacing and others. In this paper focus on the neodymium magnet with varying shapes, number of coil windings and gap of magnetic distances. This generator work by using pneumatic mechanism (PLTGL) for power plants system. Result testing of performance AC generator translation motion obtained that maximum voltage, current and power are 63 Volt for diameter winding coil 0.15 mm, number of winding coil 13000 and distance of magnet 20 mm. For effect shape of magnet, maximum voltage happen on rectangle magnet 30x20x5 mm with 4.64 Volt. Voltage and power on effect of diameter winding coil is 14.63 V and 17.82 W at the diameter winding coil 0.7 and number of winding coil is 1260 with the distance of magnet 25

  13. A Robust Suboptimal Current Control of an Interlink Converter for a Hybrid AC/DC Microgrid

    Directory of Open Access Journals (Sweden)

    Ismi Rosyiana Fitri

    2018-05-01

    Full Text Available A hybrid AC/DC microgrid is established with the aim of exploiting numerous types of renewable energy to meet the needs of different loads. The microgrid is decomposed by AC DC sub-grids which are connected by an interlink converter (IC. To maintain the security and reliability of the microgrid, an automatic controller for the interlink converter is needed. In this paper, we propose a Linear Matrix Inequalities (LMI-based current control method for the interlink converter. As the main features here, the interlink converter permits bidirectional power exchange between both sub-grids when a power–demand imbalance occurs in one sub-grid regardless of the converter system parameters. Simulations with various filter parameters are performed using the Matlab/Simulink software to validate the effectiveness of the proposed controller. In comparison with the existing Linear Quadratic Regulator (LQR-based current control, the proposed method is more robust against unknown system parameters and high load perturbation.

  14. Linear colliders - prospects 1985

    International Nuclear Information System (INIS)

    Rees, J.

    1985-06-01

    We discuss the scaling laws of linear colliders and their consequences for accelerator design. We then report on the SLAC Linear Collider project and comment on experience gained on that project and its application to future colliders. 9 refs., 2 figs

  15. The SLAC linear collider

    International Nuclear Information System (INIS)

    Richter, B.

    1985-01-01

    A report is given on the goals and progress of the SLAC Linear Collider. The author discusses the status of the machine and the detectors and give an overview of the physics which can be done at this new facility. He also gives some ideas on how (and why) large linear colliders of the future should be built

  16. Linear Programming (LP)

    International Nuclear Information System (INIS)

    Rogner, H.H.

    1989-01-01

    The submitted sections on linear programming are extracted from 'Theorie und Technik der Planung' (1978) by W. Blaas and P. Henseler and reformulated for presentation at the Workshop. They consider a brief introduction to the theory of linear programming and to some essential aspects of the SIMPLEX solution algorithm for the purposes of economic planning processes. 1 fig

  17. Racetrack linear accelerators

    International Nuclear Information System (INIS)

    Rowe, C.H.; Wilton, M.S. de.

    1979-01-01

    An improved recirculating electron beam linear accelerator of the racetrack type is described. The system comprises a beam path of four straight legs with four Pretzel bending magnets at the end of each leg to direct the beam into the next leg of the beam path. At least one of the beam path legs includes a linear accelerator. (UK)

  18. Controlled formation of metallic nanowires via Au nanoparticle ac trapping

    International Nuclear Information System (INIS)

    Bernard, L; Calame, M; Molen, S J van der; Liao, J; Schoenenberger, C

    2007-01-01

    Applying ac voltages, we trapped gold nanoparticles between micro-fabricated electrodes under well-defined conditions. We demonstrate that the nanoparticles can be controllably fused together to form homogeneous gold nanowires with pre-defined diameters and conductance values. Whereas electromigration is known to form a gap when a dc voltage is applied, this ac technique achieves the opposite, thereby completing the toolkit for the fabrication of nanoscale junctions

  19. Controlled formation of metallic nanowires via Au nanoparticle ac trapping

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, L; Calame, M; Molen, S J van der; Liao, J; Schoenenberger, C [Institute of Physics, University of Basel, CH-4056 Basel (Switzerland)

    2007-06-13

    Applying ac voltages, we trapped gold nanoparticles between micro-fabricated electrodes under well-defined conditions. We demonstrate that the nanoparticles can be controllably fused together to form homogeneous gold nanowires with pre-defined diameters and conductance values. Whereas electromigration is known to form a gap when a dc voltage is applied, this ac technique achieves the opposite, thereby completing the toolkit for the fabrication of nanoscale junctions.

  20. AC-Induced Bias Potential Effect on Corrosion of Steels

    Science.gov (United States)

    2009-02-05

    induction, variable conduction Experimental Setup Super- martensitic stainless steel composition Analysis: C Mn Si Cr Ni Mo Cu N Typical 13 Cr ɘ.01 0.6... stainless steel used in pipelines. •Low carbon (ɘ.01): allows the formation of a “soft” martensite that is more resistant than standard martensitic ...Proposed AC Corrosion Models  AC Simulated Corrosion testing  Stainless steel pipe and coating  Cathodic protection  Experimental Setup  Preliminary

  1. Antifriction coatings based on a-C for biomedicine applications

    International Nuclear Information System (INIS)

    Yurjev, Y N; Kiseleva, D V; Zaitcev, D A; Sidelev, D V; Korneva, O S

    2016-01-01

    This article reports on the investigation of mechanical properties of carbon films deposited by dual magnetron sputtering system with closed and mirror magnetic field. There is shown that a-C films with predominantly sp 2 -phase have relatively high hardness (up to 20 GPa) and low friction index (∼0.01). The influence of magnetic field on friction index is determined. The analysis of experimental data shows the obtained a-C samples can be used for biomedicine applications. (paper)

  2. AC Calorimetric Design for Dynamic of Biological Materials

    OpenAIRE

    Shigeo Imaizumi

    2006-01-01

    We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...

  3. Optimal football strategies: AC Milan versus FC Barcelona

    OpenAIRE

    Papahristodoulou, Christos

    2012-01-01

    In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

  4. Semidefinite linear complementarity problems

    International Nuclear Information System (INIS)

    Eckhardt, U.

    1978-04-01

    Semidefinite linear complementarity problems arise by discretization of variational inequalities describing e.g. elastic contact problems, free boundary value problems etc. In the present paper linear complementarity problems are introduced and the theory as well as the numerical treatment of them are described. In the special case of semidefinite linear complementarity problems a numerical method is presented which combines the advantages of elimination and iteration methods without suffering from their drawbacks. This new method has very attractive properties since it has a high degree of invariance with respect to the representation of the set of all feasible solutions of a linear complementarity problem by linear inequalities. By means of some practical applications the properties of the new method are demonstrated. (orig.) [de

  5. Linear algebra done right

    CERN Document Server

    Axler, Sheldon

    2015-01-01

    This best-selling textbook for a second course in linear algebra is aimed at undergrad math majors and graduate students. The novel approach taken here banishes determinants to the end of the book. The text focuses on the central goal of linear algebra: understanding the structure of linear operators on finite-dimensional vector spaces. The author has taken unusual care to motivate concepts and to simplify proofs. A variety of interesting exercises in each chapter helps students understand and manipulate the objects of linear algebra. The third edition contains major improvements and revisions throughout the book. More than 300 new exercises have been added since the previous edition. Many new examples have been added to illustrate the key ideas of linear algebra. New topics covered in the book include product spaces, quotient spaces, and dual spaces. Beautiful new formatting creates pages with an unusually pleasant appearance in both print and electronic versions. No prerequisites are assumed other than the ...

  6. AC quantum voltmeter for the industry; AC-Quantenvoltmeter fuer die Industrie

    Energy Technology Data Exchange (ETDEWEB)

    Behr, Ralf [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe 2.63 ' ' Josephson-Effekt, Spannung' ' ; Smandek, Bernhard [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe Q.33 ' ' Technologietransfer' '

    2016-09-15

    In a first part difficulties and challenges of the novel operation principle, the ''differential scanning system'' are discussed and explained, how with highest metrological precision the proof of principle succeeded. By common research with other national metrology institutes the concept was consolidated and improved. In a second part it was exemplarically illuminated, how by an efficient dovetailing of European and national promotion programs with different application neighbourhood consolidated knowledge of basic metrological research could be transferred to economy and especially small and medium companies. With an AC quantum voltmeter up to 10 V and 1 kHz already a unique commercial device is available. How the development foreseeable goes on illuminates the final part of the article.

  7. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    independent producers/consumers to connect to multiple distribution grids in order to optimise the electricity price, as this will vary during the day from one power distribution company to another one. It will be needed to have a load that can smoothly adjust the power consumed from each power grid in order......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...

  8. A multi-channel AC power supply controller

    International Nuclear Information System (INIS)

    Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

    2003-01-01

    A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

  9. Position Information

    Data.gov (United States)

    Social Security Administration — The Position Information Data Asset provides the ability to search for active SSA position descriptions using various search criteria. An individual may search by PD...

  10. Handbook on linear motor application

    International Nuclear Information System (INIS)

    1988-10-01

    This book guides the application for Linear motor. It lists classification and speciality of Linear Motor, terms of linear-induction motor, principle of the Motor, types on one-side linear-induction motor, bilateral linear-induction motor, linear-DC Motor on basic of the motor, linear-DC Motor for moving-coil type, linear-DC motor for permanent-magnet moving type, linear-DC motor for electricity non-utility type, linear-pulse motor for variable motor, linear-pulse motor for permanent magneto type, linear-vibration actuator, linear-vibration actuator for moving-coil type, linear synchronous motor, linear electromagnetic motor, linear electromagnetic solenoid, technical organization and magnetic levitation and linear motor and sensor.

  11. Ranking transmission projects in large scale systems using an AC power flow model; Priorizacao de obras em sistemas de grande porte usando um modelo AC da rede

    Energy Technology Data Exchange (ETDEWEB)

    Melo, A C.G. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil); Fontoura Filho, R N [ELETROBRAS, Rio de Janeiro, RJ (Brazil); Peres, L A.P. Pecorelli [FURNAS, Rio de Janeiro, RJ (Brazil); Morozowski Filho, M [Santa Catarina Univ., Florianopolis, SC (Brazil)

    1994-12-31

    Initially, this paper summarizes the approach developed by the Brazilian Planning Criteria Working Group (GTCP/ELETROBRAS) for identifying which subset of transmission investments should be postponed to meet a pre-stablished budget constraint with the least possible impact on system performance. Next, this paper presents the main features of the computational model PRIO, which allows the application of the ranking process to large scale power systems (2,000 buses and 3,000 circuits), with as many as 100 projects to be ranked. In this model, the adequacy analysis of each system state is carried out through an AC power flow coupled to a successive linear programming based remedial actions model. Case studies with the IEEE-RTS system and a configuration of the Brazilian Southeastern are presented and discussed. (author) 7 refs., 6 figs., 5 tabs.

  12. Positive Psychology

    Science.gov (United States)

    Peterson, Christopher

    2009-01-01

    Positive psychology is a deliberate correction to the focus of psychology on problems. Positive psychology does not deny the difficulties that people may experience but does suggest that sole attention to disorder leads to an incomplete view of the human condition. Positive psychologists concern themselves with four major topics: (1) positive…

  13. Squares of Random Linear Codes

    DEFF Research Database (Denmark)

    Cascudo Pueyo, Ignacio; Cramer, Ronald; Mirandola, Diego

    2015-01-01

    a positive answer, for codes of dimension $k$ and length roughly $\\frac{1}{2}k^2$ or smaller. Moreover, the convergence speed is exponential if the difference $k(k+1)/2-n$ is at least linear in $k$. The proof uses random coding and combinatorial arguments, together with algebraic tools involving the precise......Given a linear code $C$, one can define the $d$-th power of $C$ as the span of all componentwise products of $d$ elements of $C$. A power of $C$ may quickly fill the whole space. Our purpose is to answer the following question: does the square of a code ``typically'' fill the whole space? We give...

  14. Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

    Science.gov (United States)

    Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

    One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

  15. Plasmas in saline solutions sustained using rectified ac voltages: polarity and frequency effects on the discharge behaviour

    International Nuclear Information System (INIS)

    Chang Hungwen; Hsu Chengche

    2012-01-01

    In this work, three major problems, namely severe electrode damage, poor plasma stability and excess power consumption, arising in ac-driven plasmas in saline solutions are solved using a rectified power source. Diagnostic studies on the effects of power source polarity and frequency on the plasma behaviour are performed. Examination of I-V characteristics and temporally resolved light emission shows that the polarity significantly influences the current amplitude when the plasma exists, while the frequency alters the bubble dynamics, which in turn affects the plasma ignition voltage. When the plasma is driven by a rectified ac power source, the electrode erosion is reduced substantially. With a low frequency, moderate applied voltage and positively rectified ac power source (e.g. 100 Hz and 350 V), a stable plasma is ignited in nearly every power cycle. (paper)

  16. Ubiquitous positioning

    CERN Document Server

    Mannings, Robin

    2008-01-01

    This groundbreaking resource offers a practical, in-depth understanding of Ubiquitous Positioning - positioning systems that identify the location and position of people, vehicles and objects in time and space in the digitized networked economy. The future and growth of ubiquitous positioning will be fueled by the convergence of many other areas of technology, from mobile telematics, Internet technology, and location systems, to sensing systems, geographic information systems, and the semantic web. This first-of-its-kind volume explores ubiquitous positioning from a convergence perspective, of

  17. Linear ubiquitination in immunity.

    Science.gov (United States)

    Shimizu, Yutaka; Taraborrelli, Lucia; Walczak, Henning

    2015-07-01

    Linear ubiquitination is a post-translational protein modification recently discovered to be crucial for innate and adaptive immune signaling. The function of linear ubiquitin chains is regulated at multiple levels: generation, recognition, and removal. These chains are generated by the linear ubiquitin chain assembly complex (LUBAC), the only known ubiquitin E3 capable of forming the linear ubiquitin linkage de novo. LUBAC is not only relevant for activation of nuclear factor-κB (NF-κB) and mitogen-activated protein kinases (MAPKs) in various signaling pathways, but importantly, it also regulates cell death downstream of immune receptors capable of inducing this response. Recognition of the linear ubiquitin linkage is specifically mediated by certain ubiquitin receptors, which is crucial for translation into the intended signaling outputs. LUBAC deficiency results in attenuated gene activation and increased cell death, causing pathologic conditions in both, mice, and humans. Removal of ubiquitin chains is mediated by deubiquitinases (DUBs). Two of them, OTULIN and CYLD, are constitutively associated with LUBAC. Here, we review the current knowledge on linear ubiquitination in immune signaling pathways and the biochemical mechanisms as to how linear polyubiquitin exerts its functions distinctly from those of other ubiquitin linkage types. © 2015 The Authors. Immunological Reviews Published by John Wiley & Sons Ltd.

  18. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  19. Positioning consumption

    DEFF Research Database (Denmark)

    Halkier, Bente; Keller, Margit

    2014-01-01

    positionings emerges based on empirical examples of research in parent–children consumption. Positionings are flexible discursive fixations of the relationship between the performances of the practitioner, other practitioners, media discourse and consumption activities. The basic positioning types...... are the practice maintenance and the practice change position, with different sorts of adapting in between. Media discourse can become a resource for a resistant position against social control or for an appropriating position in favour of space for action. Regardless of the current relation to a particular media......This article analyses the ways in which media discourses become a part of contested consumption activities. We apply a positioning perspective with practice theory to focus on how practitioners relate to media discourse as a symbolic resource in their everyday practices. A typology of performance...

  20. Linearizing W-algebras

    International Nuclear Information System (INIS)

    Krivonos, S.O.; Sorin, A.S.

    1994-06-01

    We show that the Zamolodchikov's and Polyakov-Bershadsky nonlinear algebras W 3 and W (2) 3 can be embedded as subalgebras into some linear algebras with finite set of currents. Using these linear algebras we find new field realizations of W (2) 3 and W 3 which could be a starting point for constructing new versions of W-string theories. We also reveal a number of hidden relationships between W 3 and W (2) 3 . We conjecture that similar linear algebras can exist for other W-algebra as well. (author). 10 refs

  1. Matrices and linear algebra

    CERN Document Server

    Schneider, Hans

    1989-01-01

    Linear algebra is one of the central disciplines in mathematics. A student of pure mathematics must know linear algebra if he is to continue with modern algebra or functional analysis. Much of the mathematics now taught to engineers and physicists requires it.This well-known and highly regarded text makes the subject accessible to undergraduates with little mathematical experience. Written mainly for students in physics, engineering, economics, and other fields outside mathematics, the book gives the theory of matrices and applications to systems of linear equations, as well as many related t

  2. Linearity in Process Languages

    DEFF Research Database (Denmark)

    Nygaard, Mikkel; Winskel, Glynn

    2002-01-01

    The meaning and mathematical consequences of linearity (managing without a presumed ability to copy) are studied for a path-based model of processes which is also a model of affine-linear logic. This connection yields an affine-linear language for processes, automatically respecting open......-map bisimulation, in which a range of process operations can be expressed. An operational semantics is provided for the tensor fragment of the language. Different ways to make assemblies of processes lead to different choices of exponential, some of which respect bisimulation....

  3. Elements of linear space

    CERN Document Server

    Amir-Moez, A R; Sneddon, I N

    1962-01-01

    Elements of Linear Space is a detailed treatment of the elements of linear spaces, including real spaces with no more than three dimensions and complex n-dimensional spaces. The geometry of conic sections and quadric surfaces is considered, along with algebraic structures, especially vector spaces and transformations. Problems drawn from various branches of geometry are given.Comprised of 12 chapters, this volume begins with an introduction to real Euclidean space, followed by a discussion on linear transformations and matrices. The addition and multiplication of transformations and matrices a

  4. Applied linear regression

    CERN Document Server

    Weisberg, Sanford

    2013-01-01

    Praise for the Third Edition ""...this is an excellent book which could easily be used as a course text...""-International Statistical Institute The Fourth Edition of Applied Linear Regression provides a thorough update of the basic theory and methodology of linear regression modeling. Demonstrating the practical applications of linear regression analysis techniques, the Fourth Edition uses interesting, real-world exercises and examples. Stressing central concepts such as model building, understanding parameters, assessing fit and reliability, and drawing conclusions, the new edition illus

  5. tACS phase locking of frontal midline theta oscillations disrupts working memory performance

    Directory of Open Access Journals (Sweden)

    Bankim Subhash Chander

    2016-05-01

    Full Text Available Frontal midline theta (FMT oscillations (4-8Hz are strongly related to cognitive and executive control during mental tasks such as memory processing, arithmetic problem solving or sustained attention. While maintenance of temporal order information during a working memory (WM task was recently linked to FMT phase, a positive correlation between FMT power, WM demand and WM performance was shown. However, the relationship between these measures is not well understood, and it is unknown whether purposeful FMT phase manipulation during a WM task impacts FMT power and WM performance. Here we present evidence that FMT phase manipulation mediated by transcranial alternating current stimulation (tACS can block WM demand-related FMT power increase and disrupt normal WM performance. Methods: 20 healthy volunteers were assigned to one of two groups (group A, group B and performed a 2-back task across a baseline block (block 1 and an intervention block (block 2 while 275-sensor magnetoencephalography (MEG was recorded. After no stimulation was applied during block 1, participants in group A received tACS oscillating at their individual FMT frequency over the prefrontal cortex (PFC while group B received sham stimulation during block 2. After assessing and mapping phase locking values (PLV between the tACS signal and brain oscillatory activity across the whole brain, FMT power and WM performance were assessed and compared between blocks and groups. Results: During block 2 of group A but not B, FMT oscillations showed increased PLV across task-related cortical areas underneath the frontal tACS electrode. While WM task-related FMT power increase (FMTpower and WM performance were comparable across groups in block 1, tACS resulted in lower FMTpower and WM performance compared to sham stimulation in block 2. Conclusion: tACS-related manipulation of FMT phase can disrupt WM performance and influence WM task-related FMT power increase. This finding may have

  6. AC power flow importance measures considering multi-element failures

    International Nuclear Information System (INIS)

    Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

    2017-01-01

    Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

  7. Ten Minutes of α-tACS and Ambient Illumination Independently Modulate EEG α-Power

    Directory of Open Access Journals (Sweden)

    Heiko I. Stecher

    2017-05-01

    Full Text Available Transcranial alternating current stimulation (tACS sees increased use in neurosciences as a tool for the exploration of brain oscillations. It has been shown that tACS stimulation in specific frequency bands can result in aftereffects of modulated oscillatory brain activity that persist after the stimulation has ended. The general relationship between persistency of the effect and duration of stimulation is sparsely investigated but previous research has shown that the occurrence of tACS aftereffects depends on the brain state before and during stimulation. Early alpha neurofeedback research suggests that particularly in the alpha band the responsiveness to a manipulation depends on the ambient illumination during measurement. Therefore, in the present study we assessed the brain’s susceptibility to tACS at the individual alpha frequency during darkness compared to ambient illumination. We measured alpha power after 10 min of stimulation in 30 participants while they continuously performed a visual vigilance task. Our results show that immediately after stimulation, the alpha power in the illumination condition for both the stimulated and sham group has increased by only about 7%, compared to about 20% in both groups in the ‘dark’ condition. For the group that did not receive stimulation, the power in darkness remained stable after stimulation, whereas the power in light increased by an additional 10% during the next 30 min. For the group that did receive stimulation, alpha power during these 30 min increased by another 11% in light and 22% in darkness. Since alpha power already increased by about 10% without stimulation, the effect of illumination does not seem to have interacted with the effect of stimulation. Instead, both effects seem to have added up linearly. Although our findings do not show that illumination-induced differences in oscillatory activity influence the susceptibility toward tACS, they stress the importance of

  8. A theoretical model for the production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Fan Liu, Sau; Allen, B J

    2006-09-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. We are investigating the reduction of radium by transmutation on a small scale by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) to produce Ra-225, which subsequently decays to Ac-225, which can be used as a generator to produce Bi-213 for use in 'targeted alpha therapy' for cancer. This paper examines the possibility of producing Ac-225 with a linac using an accurate theoretical model in which the bremsstrahlung photon spectrum at 18 MV linac electron energy is convoluted with the corresponding photonuclear cross sections of Ra-226. The total integrated yield can then be obtained and is compared with a computer simulation. This study shows that at 18 MV, the photonuclear reaction on Ra-226 can produce low activities of Ac-225 with a linac. However, a high power linac with high current, pulse length and frequency is needed to produce practical amounts of Ac-225 and a useful reduction of Ra-226.

  9. Fast feedback for linear colliders

    International Nuclear Information System (INIS)

    Hendrickson, L.; Adolphsen, C.; Allison, S.; Gromme, T.; Grossberg, P.; Himel, T.; Krauter, K.; MacKenzie, R.; Minty, M.; Sass, R.

    1995-01-01

    A fast feedback system provides beam stabilization for the SLC. As the SLC is in some sense a prototype for future linear colliders, this system may be a prototype for future feedbacks. The SLC provides a good base of experience for feedback requirements and capabilities as well as a testing ground for performance characteristics. The feedback system controls a wide variety of machine parameters throughout the SLC and associated experiments, including regulation of beam position, angle, energy, intensity and timing parameters. The design and applications of the system are described, in addition to results of recent performance studies

  10. Linear system theory

    Science.gov (United States)

    Callier, Frank M.; Desoer, Charles A.

    1991-01-01

    The aim of this book is to provide a systematic and rigorous access to the main topics of linear state-space system theory in both the continuous-time case and the discrete-time case; and the I/O description of linear systems. The main thrusts of the work are the analysis of system descriptions and derivations of their properties, LQ-optimal control, state feedback and state estimation, and MIMO unity-feedback systems.

  11. Effect of alkali content on AC conductivity of borate glasses containing two transition metals

    International Nuclear Information System (INIS)

    Kashif, I.; Rahman, Samy A.; Soliman, A.A.; Ibrahim, E.M.; Abdel-Khalek, E.K.; Mostafa, A.G.; Sanad, A.M.

    2009-01-01

    Sodium borate glasses containing iron and molybdenum ions with the total concentration of transition ions constant and gradual substitution of sodium oxide (network modifier) by borate oxide (network former) was prepared. Densities, molar volume, DC and AC conductivities are measured. The trends of these properties are attributed to changes in the glass network structure. Their DC and AC conductivity increased with increasing NaO concentration. The increase of AC conductivity of sodium borate glasses is attributed to the chemical composition and the hopping mechanism of conduction. Measurements of the dielectric constant (ε) and dielectric loss (tan δ) as a function of frequency (50 Hz-100 kHz) and temperature (RT-600 K) indicate that the increase in dielectric constant and loss (ε and tan δ) values with increasing sodium ion content could be attributed to the assumption that Fe and Mo ions tend to assume network-forming position in the glass compositions studied. The variation of the value of frequency exponent s for all glass samples as the function of temperature at a definite frequency indicates that the value of s decreases with increasing the temperature which agrees with the correlated barrier-hopping (CBH) model.

  12. Aragonite coating solutions (ACS) based on artificial seawater

    Science.gov (United States)

    Tas, A. Cuneyt

    2015-03-01

    Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  13. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  14. Induced AC voltages on pipelines may present a serious hazard

    International Nuclear Information System (INIS)

    Kirkpatrick, E.L.

    1997-01-01

    The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP

  15. Development of low AC loss windings for superconducting traction transformer

    International Nuclear Information System (INIS)

    Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K

    2010-01-01

    We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.

  16. ACS and STEMI treatment: gender-related issues.

    Science.gov (United States)

    Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude

    2012-08-01

    Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.

  17. Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

    Energy Technology Data Exchange (ETDEWEB)

    Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

    2008-07-01

    Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

  18. Initial experience with AcQsim CT simulator

    International Nuclear Information System (INIS)

    Michalski, Jeff M.; Gerber, Russell; Bosch, Walter R.; Harms, William; Matthews, John W.; Purdy, James A.; Perez, Carlos A.

    1995-01-01

    Purpose: We recently replaced our university developed CT simulator prototype with a commercial grade spiral CT simulator (Picker AcQsim) that is networked with three independent virtual simulation workstations and our 3D radiation therapy planning (3D-RTP) system multiple workstations. This presentation will report our initial experience with this CT simulation device and define criteria for optimum clinical use as well as describe some potential drawbacks of the current system. Methods and Materials: Over a 10 month period, 210 patients underwent CT simulation using the AcQsim. An additional 127 patients had a volumetric CT scan done on the device with their CT data and target and normal tissue contours ultimately transferred to our 3D-RTP system. We currently perform the initial patient localization and immobilization in the CT simulation suite by using CT topograms and a fiducial laser marking system. Immobilization devices, required for all patients undergoing CT simulation, are constructed and registered to a device that defines the treatment table coordinates. Orthogonal anterior and lateral CT topograms document patient alignment and the position of a reference coordinate center. The volumetric CT scan with appropriate CT contrast materials administered is obtained while the patient is in the immobilization device. On average, more than 100 CT slices are obtained per study. Contours defining tumor, target, and normal tissues are drawn on a slice by slice basis. Isocenter definition can be automatically defined within the target volume and marked on the patient and immobilization device before leaving the initial CT simulation session. Virtual simulation is then performed on the patient data set with the assistance of predefined target volumes and normal tissue contours displayed on rapidly computed digital reconstructed radiographs (DRRs) in a manner similar to a conventional fluoroscopic radiotherapy simulator. Lastly, a verification simulation is

  19. AC machine control : robust and sensorless control by parameter independency

    Energy Technology Data Exchange (ETDEWEB)

    Samuelsen, Dag Andreas Hals

    2009-06-15

    In this thesis it is first presented how robust control can be used to give AC motor drive systems competitive dynamic performance under parameter variations. These variations are common to all AC machines, and are a result of temperature change in the machine, and imperfect machine models. This robust control is, however, dependent on sensor operation in the sense that the rotor position is needed in the control loop. Elimination of this control loop has been for many years, and still is, a main research area of AC machines control systems. An integrated PWM modulator and sampler unit has been developed and tested. The sampler unit is able to give current and voltage measurements with a reduced noise component. It is further used to give the true derivative of currents and voltages in the machine and the power converter, as an average over a PWM period, and as separate values for all states of the power converter. In this way, it can give measurements of the currents as well as the derivative of the currents, at the start and at the end of a single power inverter state. This gave a large degree of freedom in parameter and state identification during uninterrupted operation of the induction machine. The special measurement scheme of the system achieved three main goals: By avoiding the time frame where the transistors commutate and the noise in the measurement of the current is large, filtering of the current measurement is no longer needed. The true derivative of the current in the machine is can be measured with far less noise components. This was extended to give any separate derivative in all three switching states of the power converter. Using the computational resources of the FPGA, more advanced information was supplied to the control system, in order to facilitate sensor less operation, with low computational demands on the DSP. As shown in the papers, this extra information was first used to estimate some of the states of the machine, in some or all of the

  20. Description of analytical method and clinical utility of measuring serum 7-alpha-hydroxy-4-cholesten-3-one (7aC4) by mass spectrometry.

    Science.gov (United States)

    Donato, Leslie J; Lueke, Alan; Kenyon, Stacy M; Meeusen, Jeffrey W; Camilleri, Michael

    2018-02-01

    Imbalance of bile acids (BA) homeostasis in the gastrointestinal tract can lead to chronic diarrhea or constipation when BA in the colon are in excess or low, respectively. Since both disturbances of bowel function can result from other etiologies, identifying BA imbalance is important to tailor treatment strategies. Serum concentrations of 7-alpha-hydroxy-4-cholesten-3-one (7aC4), a precursor in bile acid synthesis, reflect BA homeostasis. Here we describe a method to accurately measure serum 7aC4 and evaluate the clinical utility in patients with diarrhea or constipation phenotypes. Serum 7aC4 is measured after acetonitrile protein precipitation using C18 liquid chromatography, tandem mass spectrometry, and deuterium-labeled 7aC4 internal standard. Assay performance including linearity, precision, and accuracy was assessed using waste serum samples. The reference interval was established in healthy individuals without BA-altering conditions or medications. Clinical performance was assessed in patients with irritable bowel syndrome. The method precisely and accurately measured 7aC4 in human serum from 1.4-338ng/mL with no ion suppression or interference from related 7-keto-cholesterol. Central 95th percentile reference interval was 2.5-63.2ng/mL. Lower serum 7aC4 was found in patients with constipation with sensitivity/specificity of 79%/55% compared to healthy controls. Higher 7aC4 was found in patients with bile acid diarrhea (BAD) compared to those without BAD with sensitivity/specificity of 82%/53%. We have developed a sensitive and precise assay for measuring the concentration of 7aC4 in serum. The assay can be used to screen for diarrhea caused by bile acid malabsorption. Copyright © 2017 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  1. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions

    Science.gov (United States)

    Lockerbie, N. A.; Tokmakov, K. V.

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m-1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain ratio

  2. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

    Science.gov (United States)

    Lockerbie, N A; Tokmakov, K V

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

  3. Further linear algebra

    CERN Document Server

    Blyth, T S

    2002-01-01

    Most of the introductory courses on linear algebra develop the basic theory of finite­ dimensional vector spaces, and in so doing relate the notion of a linear mapping to that of a matrix. Generally speaking, such courses culminate in the diagonalisation of certain matrices and the application of this process to various situations. Such is the case, for example, in our previous SUMS volume Basic Linear Algebra. The present text is a continuation of that volume, and has the objective of introducing the reader to more advanced properties of vector spaces and linear mappings, and consequently of matrices. For readers who are not familiar with the contents of Basic Linear Algebra we provide an introductory chapter that consists of a compact summary of the prerequisites for the present volume. In order to consolidate the student's understanding we have included a large num­ ber of illustrative and worked examples, as well as many exercises that are strategi­ cally placed throughout the text. Solutions to the ex...

  4. Structural, ac conductivity and dielectric properties of 3-formyl chromone

    Science.gov (United States)

    Ali, H. A. M.

    2017-07-01

    The structure for the powder of 3-formyl chromone was examined by X-ray diffraction technique in the 2θ° range ( 4° - 60° . The configuration of Al/3-formyl chromone/Al samples was designed. The electrical and dielectric properties were studied as a function of frequency (42- 5 × 106 Hz) and temperature (298-408K). The ac conductivity data of bulk of 3-formyl chromone varies as a power law with the frequency at different temperatures. The predominant mechanism for ac conduction was deduced. The ac conductivity shows a thermally activated process at different frequencies. The dielectric constant and dielectric loss were determined using the capacitance and dissipation factor measurements at different temperatures. The dielectric loss shows a peak of relaxation time that shifted to higher frequency with an increase in the temperature. The activation energy of the relaxation process was estimated.

  5. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  6. AC Conductivity Studies of Lithium Based Phospho Vanadate Glasses

    International Nuclear Information System (INIS)

    Nagendra, K.; Babu, G. Satish; Gowda, Veeranna; Reddy, C. Narayana

    2011-01-01

    Glasses in the system xLi 2 SO 4 -20Li 2 O-(80-x) [80P 2 O 5 -20V 2 O 5 ](5≥x≥20 mol%) has been prepared by melt quenching method. Dc and ac conductivity has been studied over a wide range of frequency (10 Hz to 10 MHz) and temperature (298 K-523 K). The dc conductivity found to increase with increase of Li 2 SO 4 concentration. The ac conductivities have been fitted to the Almond-West type single power law equation σ(ω) = σ(0)+Aω s where 's' is the power law exponent. The ac conductivity found to increase with increase of Li 2 SO 4 concentration. An attempt is made to elucidate the enhancement of lithium ion conduction in phosphor-vanadate glasses by considering the expansion of network structure.

  7. Objectives and status of development of AC600

    International Nuclear Information System (INIS)

    Zhao Chengkun

    1997-01-01

    AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600

  8. Reliability of emergency ac power systems at nuclear power plants

    International Nuclear Information System (INIS)

    Battle, R.E.; Campbell, D.J.

    1983-07-01

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project

  9. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  10. 21 CFR 880.6320 - AC-powered medical examination light.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

  11. AC power losses in Bi-2223/Ag HTS tapes

    International Nuclear Information System (INIS)

    Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.

    1998-01-01

    Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

  12. Hybrid AC-High Voltage DC Grid Stability and Controls

    Science.gov (United States)

    Yu, Jicheng

    The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

  13. Researcher positioning

    DEFF Research Database (Denmark)

    Mørck, Line Lerche; Khawaja, Iram

    2009-01-01

    abstract  This article focuses on the complex and multi-layered process of researcher positioning, specifically in relation to the politically sensitive study of marginalised and ‘othered' groups such as Muslims living in Denmark. We discuss the impact of different ethnic, religious and racial...... political and personal involvement by the researcher, which challenges traditional perspectives on research and researcher positioning. A key point in this regard is the importance of constant awareness of and reflection on the multiple ways in which one's positioning as a researcher influences the research...

  14. Linear mass reflectron

    International Nuclear Information System (INIS)

    Mamyrin, B.A.; Shmikk, D.V.

    1979-01-01

    A description and operating principle of a linear mass reflectron with V-form trajectory of ion motion -a new non-magnetic time-of-flight mass spectrometer with high resolution are presented. The ion-optical system of the device consists of an ion source with ionization by electron shock, of accelerating gaps, reflector gaps, a drift space and ion detector. Ions move in the linear mass refraction along the trajectories parallel to the axis of the analyzer chamber. The results of investigations into the experimental device are given. With an ion drift length of 0.6 m the device resolution is 1200 with respect to the peak width at half-height. Small-sized mass spectrometric transducers with high resolution and sensitivity may be designed on the base of the linear mass reflectron principle

  15. Applied linear algebra

    CERN Document Server

    Olver, Peter J

    2018-01-01

    This textbook develops the essential tools of linear algebra, with the goal of imparting technique alongside contextual understanding. Applications go hand-in-hand with theory, each reinforcing and explaining the other. This approach encourages students to develop not only the technical proficiency needed to go on to further study, but an appreciation for when, why, and how the tools of linear algebra can be used across modern applied mathematics. Providing an extensive treatment of essential topics such as Gaussian elimination, inner products and norms, and eigenvalues and singular values, this text can be used for an in-depth first course, or an application-driven second course in linear algebra. In this second edition, applications have been updated and expanded to include numerical methods, dynamical systems, data analysis, and signal processing, while the pedagogical flow of the core material has been improved. Throughout, the text emphasizes the conceptual connections between each application and the un...

  16. Theory of linear operations

    CERN Document Server

    Banach, S

    1987-01-01

    This classic work by the late Stefan Banach has been translated into English so as to reach a yet wider audience. It contains the basics of the algebra of operators, concentrating on the study of linear operators, which corresponds to that of the linear forms a1x1 + a2x2 + ... + anxn of algebra.The book gathers results concerning linear operators defined in general spaces of a certain kind, principally in Banach spaces, examples of which are: the space of continuous functions, that of the pth-power-summable functions, Hilbert space, etc. The general theorems are interpreted in various mathematical areas, such as group theory, differential equations, integral equations, equations with infinitely many unknowns, functions of a real variable, summation methods and orthogonal series.A new fifty-page section (``Some Aspects of the Present Theory of Banach Spaces'''') complements this important monograph.

  17. Dimension of linear models

    DEFF Research Database (Denmark)

    Høskuldsson, Agnar

    1996-01-01

    Determination of the proper dimension of a given linear model is one of the most important tasks in the applied modeling work. We consider here eight criteria that can be used to determine the dimension of the model, or equivalently, the number of components to use in the model. Four of these cri......Determination of the proper dimension of a given linear model is one of the most important tasks in the applied modeling work. We consider here eight criteria that can be used to determine the dimension of the model, or equivalently, the number of components to use in the model. Four...... the basic problems in determining the dimension of linear models. Then each of the eight measures are treated. The results are illustrated by examples....

  18. Linear programming using Matlab

    CERN Document Server

    Ploskas, Nikolaos

    2017-01-01

    This book offers a theoretical and computational presentation of a variety of linear programming algorithms and methods with an emphasis on the revised simplex method and its components. A theoretical background and mathematical formulation is included for each algorithm as well as comprehensive numerical examples and corresponding MATLAB® code. The MATLAB® implementations presented in this book  are sophisticated and allow users to find solutions to large-scale benchmark linear programs. Each algorithm is followed by a computational study on benchmark problems that analyze the computational behavior of the presented algorithms. As a solid companion to existing algorithmic-specific literature, this book will be useful to researchers, scientists, mathematical programmers, and students with a basic knowledge of linear algebra and calculus.  The clear presentation enables the reader to understand and utilize all components of simplex-type methods, such as presolve techniques, scaling techniques, pivoting ru...

  19. Linear Colliders TESLA

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    The aim of the TESLA (TeV Superconducting Linear Accelerator) collaboration (at present 19 institutions from seven countries) is to establish the technology for a high energy electron-positron linear collider using superconducting radiofrequency cavities to accelerate its beams. Another basic goal is to demonstrate that such a collider can meet its performance goals in a cost effective manner. For this the TESLA collaboration is preparing a 500 MeV superconducting linear test accelerator at the DESY Laboratory in Hamburg. This TTF (TESLA Test Facility) consists of four cryomodules, each approximately 12 m long and containing eight 9-cell solid niobium cavities operating at a frequency of 1.3 GHz

  20. Application of ac impedance in fuel cell research and development

    Energy Technology Data Exchange (ETDEWEB)

    Selman, J R; Lin, Y P [Illinois Inst. of Tech., Chicago, IL (United States). Dept. of Chemical Engineering

    1993-10-01

    In applying ac impedance to fuel cells and their porous (gas diffusion) electrodes the emphasis lies on different fuel cell components, and their properties, according to the fuel cell type. The focus has been directed at the electrode/electrolyte interface in MCFC and PAFC, whereas in SOFC and PEMFC the ionic/electronic conductivity of the electrolyte or the characteristics of its composite with the electrocatalyst is of primary interest. The limitations of ac impedance in fuel cell application are in part due to difficulties of interpretation and in part due to experimental difficulties because of the generally fast electrode reaction kinetics. Further research directions are indicated. (author)