AC losses of single-core MgB{sub 2} wires with different metallic sheaths
Energy Technology Data Exchange (ETDEWEB)
Kováč, J., E-mail: elekjkov@savba.sk; Šouc, J.; Kováč, P.; Hušek, I.
2015-12-15
Highlights: • AC losses in single-core MgB{sub 2} wires with different metallic sheaths have been measured. • It has been shown that metallic sheath can affect the measured AC loss considerably. • GlidCop and Stainless Steel have negligible effect to the overall loss. • Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. • Due to Monel sheath AC loss of MgB{sub 2} core is not visible. - Abstract: AC losses of single-core MgB{sub 2} superconductors with different metallic sheaths (Cu, GlidCop, stainless steel and Monel) have been measured and analyzed. These wires were exposed to external magnetic field with frequencies 72 and 144 Hz and amplitudes up to 0.1 T at temperatures ranged from 18 to 40 K. The obtained results have shown that applied metallic sheath can affect the measured AC loss considerably. In the case of GlidCop and Stainless Steel a negligible small effect of metallic sheath was observed. Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. In the case of Monel sheath, the hysteresis loss of magnetic sheath is dominated and AC loss of MgB{sub 2} core is practically not visible.
Evaluation of Core Loss in Magnetic Materials Employed in Utility Grid AC Filters
DEFF Research Database (Denmark)
Beres, Remus Narcis; Wang, Xiongfei; Blaabjerg, Frede
2016-01-01
magnetic materials adopted in utility grid ac filters have been investigated and measured for both sinusoidal and rectangular excitation, with and without dc bias condition. The core loss information can ensure cost effective passive filter designs and may avoid trial-error design procedures of the passive......Inductive components play an important role in filtering the switching harmonics related to the pulse width modulation in voltage source converters. Particularly, the filter reactor on the converter side of the filter is subjected to rectangular excitation which may lead to significant losses...... in the core, depending on the magnetic material of choice and current ripple specifications. Additionally, shunt or series reactors that exists in LCL or trap filters and which are subjected to sinusoidal excitations have different specifications and requirements. Therefore, the core losses of different...
Energy Technology Data Exchange (ETDEWEB)
Jeon, Woo Jae; Chung, Soon Il; Hwang, Su Hyun; Lee, Kyung Jin; Lee, Byung Chul [FNC Tech., Yongin (Korea, Republic of); Yun, Duk Joo; Lee, Seung Chan [Korea Hydro and Nuclear Power Co. Ltd., Daejeon (Korea, Republic of)
2015-10-15
In this study, the reactor core damage time for OPR1000 type Nuclear Power Plant (NPP) was analyzed to develop a strategy to handle ELAP and to apply to the EOP. The reactor core damage time in the ELAP condition was calculated according to the time of Auxiliary Feedwater (AFW) loss. Fukushima accident was caused by long hours of Station Black Out (SBO) caused by natural disaster beyond Design Based Accident (DBA) criteria. It led to the reactor core damage. After the accident, the regulatory authorities of each country (Japan, US, EU, IAEA, and etc.) recommended developing the necessary systems and strategies in order to cover up the Extended Loss of All AC Power (ELAP) such as one occurred in the Fukushima accident. And the need of procedure or guideline to cope with ELAP has been raised through the stress test for Wolsong Nuclear Power Plant unit 1. Current Emergency Operating Procedures (EOP) used in domestic nuclear power plant are seemed to be insufficient to cope with ELAP. Therefore, it has been required to be improved. As the result, the time of AFW loss in the ELAP condition influences greatly on core damage time.
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Energy Technology Data Exchange (ETDEWEB)
Park, Da Hee; Kim, Min Gi; Lee, Kyung Jin; Hwang, Su hyun; Lee, Byung Chul [FNC Technology Co. Ltd., Yongin (Korea, Republic of); Yoon, Duk Joo; Lee, Seung Chan [Korea Hydro and Nuclear Power Co. Ltd., Daejeon (Korea, Republic of)
2015-10-15
In this study, in order to comprehend the Fukushima accident, the sensitivity analysis was performed to analyze the behavior of Reactor Coolant System (RCS) during ELAP using the RELAP5/MOD3.3 code. The Fukushima accident was caused by tsunami resulted in Station Black Out (SBO) followed by the reactor core melt-down and release of radioactive materials. After the accident, the equipment and strategies for the Extended Loss of All AC Power (ELAP) were recommended strongly. In this analysis, sensitivity studies for the RCP seal failure of the OPR1000 type NPP were performed by using RELAP5/MOD3.3 code. Six cases with different leakage rate of RCP seal were studied for ELAP with operator action or not. The main findings are summarized as follows: (1) Without the operator action, the core uncovery time is determined by the leakage rate of RCP seal. When the leakage rate per RCP seal are 5 gpm, 50 gpm, and 300 gpm respectively, the core uncovery time are 1.62 hr, 1.58 hr, and 1.29 hr respectively. Namely, If the leakage rate of RCP seal was much bigger, the uncover time of core would be shorter. (2) In case that the cooling by SG secondary side was performed using the TDAFP and SG ADV, the core uncovery time was significantly extended.
Study on core make-up water experiment of AC600 make-up water tank
International Nuclear Information System (INIS)
Ji Fuyun; Li Changlin; Zheng Hua; Liu Shaohua; Xu Xiaolan
1999-01-01
The core makeup tank (CMT) is a principal component of the passive high pressure safety injection systems for AC600 and has a function to inject cold borated water into reactor vessel during abnormal events. The purpose of this experiment is to verify the gravity drain behavior of the CMT and to provide experimental data to verify the computer codes used in the safety analyses. Five experiments with simulative small and medium break conditions are conducted at AC600 core makeup tank performance test facility of Nuclear Power Institute of China (NPIC). The author provides the results of one test. The simulated accident is a small break loss-of-coolant accident
ac loss and dc critical current densities of Nb3Sn tapes by the solid state diffusion process
International Nuclear Information System (INIS)
Suenaga, M.; Klamut, C.; Bussiere, J.F.
1976-01-01
The effects of metallurgical processing on 60 Hz ac losses and dc critical currents in Nb 3 Sn tapes fabricated by the solid state diffusion technique were investigated. An addition of Al to the Cu--Sn alloy for the matrix resulted in large reduction in the ac losses of Nb 3 Sn tapes, but the highest linear critical current densities were observed in Nb 3 Sn tapes produced with a Nb-1 wt percent Zr core in a Cu-13 wt percent Sn matrix. Values of the losses and the critical currents in these tapes can meet the present requirements for the ac superconducting power cables
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
Self-field AC losses and critical currents in multi-tube Ag-Bi-2223 conductors
Energy Technology Data Exchange (ETDEWEB)
Ciszek, M; Ashworth, S P; Campbell, A M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); James, M P; Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); Garre, R; Conti, S [Centro Ricerche Europa Metalli, Fornaci di Barga, LU (Italy)
1996-05-01
The purpose of this work was to investigate the influence of different technological treatments of silver sheathed Bi-2223 tapes on the critical current density and the AC transport losses. The tapes were produced using the 'tube-in-tube' technique, by including a silver rod in the centre of the superconducting powder during packing of the silver tube. The aim of the process is to increase the silver to superconductor surface area and thus also the alignment at the centre of the conductor ceramic core. AC transport losses were measured by means of an electrical method using sinusoidally varying currents in the frequency range 30-180 Hz. In this range the power losses are hysteretic. The measured variation in losses from those predicted by a critical state model is attributed to the complex geometry of superconducting regions existing in these tapes. (author)
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
A.C. losses in current-carrying superconductors
International Nuclear Information System (INIS)
Reuver, J.L. de.
1985-01-01
The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)
Self-field AC losses in Bi-2223 superconducting tapes
International Nuclear Information System (INIS)
Mueller, K. H.; Leslie, K.E.
1996-01-01
Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
Study on AC loss measurements of HTS power cable for standardizing
Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi
2017-09-01
High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..
Development of low AC loss windings for superconducting traction transformer
International Nuclear Information System (INIS)
Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K
2010-01-01
We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.
Calorimetric method of ac loss measurement in a rotating magnetic field
Energy Technology Data Exchange (ETDEWEB)
Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)
2010-07-15
A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.
ac power control in the Core Flow Test Loop
International Nuclear Information System (INIS)
McDonald, D.W.
1980-01-01
This work represents a status report on a development effort to design an ac power controller for the Core Flow Test Loop. The Core Flow Test Loop will be an engineering test facility which will simulate the thermal environment of a gas-cooled fast-breeder reactor. The problems and limitations of using sinusoidal ac power to simulate the power generated within a nuclear reactor are addressed. The transformer-thyristor configuration chosen for the Core Flow Test Loop power supply is presented. The initial considerations, design, and analysis of a closed-loop controller prototype are detailed. The design is then analyzed for improved performance possibilities and failure modes are investigated at length. A summary of the work completed to date and a proposed outline for continued development completes the report
Low ac loss geometries in YBCO coated conductors and impact on conductor stability
Energy Technology Data Exchange (ETDEWEB)
Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.
Reducing AC-Winding Losses in High-Current High-Power Inductors
DEFF Research Database (Denmark)
Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.
2009-01-01
Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...
Error Analysis of High Frequency Core Loss Measurement for Low-Permeability Low-Loss Magnetic Cores
DEFF Research Database (Denmark)
Niroumand, Farideh Javidi; Nymand, Morten
2016-01-01
in magnetic cores is B-H loop measurement where two windings are placed on the core under test. However, this method is highly vulnerable to phase shift error, especially for low-permeability, low-loss cores. Due to soft saturation and very low core loss, low-permeability low-loss magnetic cores are favorable...... in many of the high-efficiency high power-density power converters. Magnetic powder cores, among the low-permeability low-loss cores, are very attractive since they possess lower magnetic losses in compared to gapped ferrites. This paper presents an analytical study of the phase shift error in the core...... loss measuring of low-permeability, low-loss magnetic cores. Furthermore, the susceptibility of this measurement approach has been analytically investigated under different excitations. It has been shown that this method, under square-wave excitation, is more accurate compared to sinusoidal excitation...
Methods to reduce AC losses in HTS coated conductors with magnetic substrates
Energy Technology Data Exchange (ETDEWEB)
Tsukamoto, O. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)], E-mail: osami-t@ynu.ac.jp; Sekizawa, S.; Alamgir, A.K.M. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan); Miyagi, D. [Okayama University, 1-1, Tsushima-Naka, 1-Chome, Okayama 700-8530 (Japan)
2007-10-01
HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates.
Methods to reduce AC losses in HTS coated conductors with magnetic substrates
International Nuclear Information System (INIS)
Tsukamoto, O.; Sekizawa, S.; Alamgir, A.K.M.; Miyagi, D.
2007-01-01
HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates
AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios
Energy Technology Data Exchange (ETDEWEB)
Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z
2004-10-01
AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger.
AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios
International Nuclear Information System (INIS)
Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z.
2004-01-01
AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger
AC losses and stability on large cable-in-conduit superconductors
Bruzzone, Pierluigi
1998-12-01
The cable-in-conduit superconductors are preferred for applications where the AC losses and stability are a major concern, e.g., fusion magnets and SMES. A review of coupling currents loss results for both NbTi and Nb 3Sn cable-in-conduit conductors (CICC) is presented and the AC loss relevant features are listed, with special emphasis for the role of the interstrand resistance and strand coating. The transient stability approach for CICCs is discussed and the analytical models are quoted as well as the relevant experimental database. The likely spectrum of transient disturbance in CICC is reviewed and the need to account for interstrand current sharing in the design is outlined. Eventually a practical criterion for the interstrand resistance is proposed to link the stability and AC loss design.
Fast-ion losses induced by ACs and TAEs in the ASDEX Upgrade tokamak
International Nuclear Information System (INIS)
GarcIa-Munoz, M.; Hicks, N.; Classen, I.G.J.; Bilato, R.; Bobkov, V.; Brambilla, M.; Bruedgam, M.; Fahrbach, H.-U.; Igochine, V.; Maraschek, M.; Sassenberg, K.; Van Voornveld, R.; Jaemsae, S.
2010-01-01
The phase-space of convective and diffusive fast-ion losses induced by shear Alfven eigenmodes has been characterized in the ASDEX Upgrade tokamak. Time-resolved energy and pitch-angle measurements of fast-ion losses correlated in frequency and phase with toroidal Alfven eigenmodes (TAEs) and Alfven cascades (ACs) have allowed to identify both loss mechanisms. While single ACs and TAEs eject resonant fast-ions in a convective process, the overlapping of AC and TAE spatial structures leads to a large fast-ion diffusion and loss. The threshold for diffusive fast-ion losses depends on the ion energy (gyroradius). Diffusive fast-ion losses with gyroradius ∼70 mm have been observed with a single TAE for local radial displacements of the magnetic field lines larger than ∼2 mm. Multiple frequency chirping ACs cause an enhancement of the diffusive losses. The ACs and TAEs radial structures have been reconstructed by means of cross-correlation techniques between the fast-ion loss detector and the electron cyclotron emission radiometer.
AC-loss considerations of a pulse SMES for an accelerator
International Nuclear Information System (INIS)
Lyly, M; Hiltunen, I; Jaervelae, J; Korpela, A; Lehti, L; Stenvall, A; Mikkonen, R
2010-01-01
In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.
AC Losses and Their Thermal Effect in High Temperature Superconducting Machines
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan
2015-01-01
In transient operations or fault conditions, high temperature superconducting (HTS) machines suffer AC losses which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate AC losses and their thermal effect in HTS machines is presented....... The method consists of three sub-models that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an AC loss model which has...
AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan
2016-01-01
In transient operations or fault conditions, hightemperature superconducting (HTS) machines suffer ac losses, which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate ac losses and their thermal effect in HTS machines is presented....... The method consists of three submodels that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an ac loss model that has a homogeneous...
Complex study of transport AC loss in various 2G HTS racetrack coils
Energy Technology Data Exchange (ETDEWEB)
Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)
2013-04-15
Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.
Modelling and measurement of ac loss in BSCCO/Ag-tape windings
International Nuclear Information System (INIS)
Oomen, M P; Nanke, R; Leghissa, M
2003-01-01
High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications
Extension to AC Loss Minimisation in High Temperature Superconductors
National Research Council Canada - National Science Library
Campbell, Archie
2004-01-01
...: (a) Measure the AC losses of appropriate Yttrium Barium Copper Oxide (YBCO) samples with strong potential for minimizing losses at high frequencies and magnetic fields with the existing equipment. (b...
AC Loss Analysis of MgB2-Based Fully Superconducting Machines
Feddersen, M.; Haran, K. S.; Berg, F.
2017-12-01
Superconducting electric machines have shown potential for significant increase in power density, making them attractive for size and weight sensitive applications such as offshore wind generation, marine propulsion, and hybrid-electric aircraft propulsion. Superconductors exhibit no loss under dc conditions, though ac current and field produce considerable losses due to hysteresis, eddy currents, and coupling mechanisms. For this reason, many present machines are designed to be partially superconducting, meaning that the dc field components are superconducting while the ac armature coils are conventional conductors. Fully superconducting designs can provide increases in power density with significantly higher armature current; however, a good estimate of ac losses is required to determine the feasibility under the machines intended operating conditions. This paper aims to characterize the expected losses in a fully superconducting machine targeted towards aircraft, based on an actively-shielded, partially superconducting machine from prior work. Various factors are examined such as magnet strength, operating frequency, and machine load to produce a model for the loss in the superconducting components of the machine. This model is then used to optimize the design of the machine for minimal ac loss while maximizing power density. Important observations from the study are discussed.
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.
2008-02-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
International Nuclear Information System (INIS)
Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C
2008-01-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability
Low coupling loss core-strengthened Bi 2212\\/Ag Rutherford cables
Collings, E W; Scanlan, R M; Dietderich, D R; Motowidlo, L R
1999-01-01
In a comprehensive "vertically integrated" program multifilamentary (MF) high temperature superconducting (HTSC) Bi:2212/Ag strand was fabricated using the powder-in-tube process and heat treated in oxygen by a modified standard $9 procedure. The reaction-heat-treatment (HT) was adjusted to maximize critical current (density), I/sub c/ (J /sub c/), as measured in various magnetic fields, B. A series of Rutherford cables was designed, each of which included a $9 metallic (Nichrome-80) core for strengthening and reduction of coupling loss. Prior to cable winding a series of tests examined the possibility of strand "poisoning" by the core during HT. Small model Rutherford cables were wound, $9 and after HT were prepared for I/sub c/(B) measurement and calorimetric measurement of AC loss and hence interstrand contact resistance I/sub c/(B). It was deduced that, if in direct contact with the strand during HT, the core $9 material can degrade the I/sub c/ of the cable; but steps can be taken to eliminate this probl...
Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing
Energy Technology Data Exchange (ETDEWEB)
Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory
2009-10-01
The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.
AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications
Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.
2017-12-01
This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
AC loss in superconducting tapes and cables
Oomen, M.P.
2000-01-01
The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers
Transport ac losses in Bi-2223 multifilamentary tapes - conductor materials aspect
Energy Technology Data Exchange (ETDEWEB)
Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge BC2 3QZ (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Institute of Electrical Engineering, SAS, Bratislava (Slovakia)
2000-05-01
Transport ac losses in technical superconductors based on Bi-2223 tape material are influenced by many parameters. The major factors that define the ac performance of such conductors are the following: the size and number of filaments, their geometrical arrangement in the cross-section of the conductor, the twist pitch length, the resistivity of the matrix, the presence of oxide barriers around the filaments and deformation procedures such as sequential pressing or rolling followed by appropriate thermal treatment. In the present paper the above aspects are addressed from the viewpoint of the materials science of technical conductor design. Transport ac losses at power frequencies in different types of Bi-2223 conductor are presented and analysed. The results of conductor design analysis with respect to the coexistence of the superconductor with other materials in the conductor structure are presented. New concepts for minimization of the transport ac losses are discussed in detail. (author)
AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts
Energy Technology Data Exchange (ETDEWEB)
Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2011-01-01
While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.
Directory of Open Access Journals (Sweden)
Xiaojing Liu
2016-05-01
Full Text Available Amorphous and nanocrystalline alloys are now widely used for the cores of high-frequency transformers, and Litz-wire is commonly used as the windings, while it is difficult to calculate the resistance accurately. In order to design a high-frequency transformer, it is important to accurately calculate the core loss and copper loss. To calculate the core loss accurately, the additional core loss by the effect of end stripe should be considered. It is difficult to simulate the whole stripes in the core due to the limit of computation, so a scale down model with 5 stripes of amorphous alloy is simulated by the 2D finite element method (FEM. An analytical model is presented to calculate the copper loss in the Litz-wire, and the results are compared with the calculations by FEM.
A method for decreasing transport ac losses in multifilamentary and multistrip superconductors
Energy Technology Data Exchange (ETDEWEB)
Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom)
2000-07-01
A new method is proposed for decreasing transport ac losses in multifilamentary superconductors by the decoupling of the filaments using a magnetic material in the form of thin layers surrounding the individual filaments. For a superconductor with an elliptical cross section, the magnetic material surrounding the filaments affects the local magnetic field distribution that both reduces the critical current of the filaments and induces the transport ac losses in the magnetic material. Even by taking into account any detrimental influences of the presence of the magnetic material around the filaments, the analysis of the experimental data supported by computer modelling confirmed that for a Bi2223 tape with 100 filaments individually covered by magnetic material, such as iron powder, the transport ac losses should be 65 times lower than for the same multifilamentary conductor without the magnetic coating on the filaments. With an increasing number of filaments, the ac loss decrease would be even larger. (author)
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Distribution of AC loss in a HTS magnet for SMES with different operating conditions
Energy Technology Data Exchange (ETDEWEB)
Xu, Y., E-mail: xuyinghust@163.com [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Tang, Y.; Ren, L.; Jiao, F. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Song, M.; Cao, K.; Wang, D. [Yunnan Electric Power Research Institute, Kunming City 650217 (China); Wang, L.; Dong, H. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China)
2013-11-15
Highlights: •We present a model to calculate the distribution of AC loss for a storage magnet. •Comparative analysis of AC loss with different operating conditions has done. •The nonuniform distribution factor “d” is proposed to estimate the inhomogeneity of a storage magnet. •The model predicts the loss distribution and crucial areas which are suffering from the high AC loss. This is significant for the conduction-cooled structure design. -- Abstract: The AC loss induced in superconducting tape may affect the performance of a superconducting device applied to power system, such as transformer, cable, motor and even Superconducting Magnetic Energy Storage (SMES). The operating condition of SMES is changeable due to the need of compensation to the active or reactive power according to the demand of a power grid. In this paper, it is investigated that the distribution of AC loss for a storage magnet on different operating conditions, which is based on finite element method (FEM) and measured properties of BSCCO/Ag tapes. This analytical method can be used to optimize the SMES magnet.
Transport ac loss studies of YBCO coated conductors with nickel alloy substrates
International Nuclear Information System (INIS)
Duckworth, R C; Thompson, J R; Gouge, M J; Lue, J W; Ijaduola, A O; Yu, D; Verebelyi, D T
2003-01-01
Transport alternating current (ac) loss measurements were performed on a series of rolling-assisted biaxially textured substrate (RABiTS) processed YBa 2 Cu 3 O x (YBCO) coated conductors at 77 K. While each sample possessed a 1 μm layer of YBCO and a 3 μm silver cap layer, two different nickel alloy substrates were used and their impact on the ac loss was examined. Both substrates possessed a 75 μm Ni-5 at%W base, but one substrate also had a 2 μm nickel overlayer as part of the buffer layer architecture. The ac losses, which were determined by thermal and electrical measurements, contained two dominant contributions: superconductive hysteresis in the YBCO and ferromagnetic hysteresis in the substrates. The superconductive component followed the Norris elliptic model for the substrate with the nickel overlayer and the Norris thin strip model for the substrate without the nickel overlayer. The substrates' ferromagnetic loss was determined separately through magnetization measurements, which showed that this loss contribution was independent of the presence of the nickel overlayer for effective ac currents less than 50 A. While the overall loss was lower for the thin-strip-like conductor with no nickel overlayer, further research is necessary to strengthen this connection
AC losses in high Tc superconductors
International Nuclear Information System (INIS)
Campbell, A.M.
1998-01-01
Full text: Although in principle the AC losses in high Tc superconductors can be calculated from the critical current density, a number of complications make this difficult. The Jc is very field dependent, there are intergranular and intragranular critical currents, the material is anisotropic and there is usually a large demagnetising factor. Care must be taken in interpreting electrical measurements since the voltage depends on the position of the contacts. In spite of these complications the simple theory of Norris has proved surprisingly successful and arguments will be presented as to why this is the case. Results on a range of tapes will be compared with theory and numerical methods for predicting losses discussed. Finally a theory for coupling losses will be given for a composite conductor with high resistance barriers round the filaments
Measurement of AC losses in superconducting tapes by reproduction of thermometric dynamic response
Energy Technology Data Exchange (ETDEWEB)
Ligneris, Benoit des; Aubin, Marcel; Cave, Julian
2003-04-15
We have developed a dynamic response thermometric method for the measurement of AC losses in high T{sub c} superconductors. This method is based on the comparison of a temperature response caused by a known dissipation in the sample with that produced by the AC losses. By passing a DC current and measuring the DC voltage and corresponding temperature response the sample can be used as its own power dissipation reference. The advantages of this method are the short measurement duration time and the possibility to vary many experimental conditions: for example, AC and DC transport currents and AC, DC and rotating applied magnetic fields. In this article we present the basic method using variable short pulses of constant DC current for calibration and similarly of constant amplitude AC current to create the losses. The losses are obtained by numerical modelling and comparison of the thermometric dynamic response in the two above conditions. Finally, we present some experimental results for a Bi2223 superconducting tape at 50 Hz and 77 K.
AC loss measurement of superconducting dipole magnets by the calorimetric method
International Nuclear Information System (INIS)
Morita, Y.; Hara, K.; Higashi, N.; Kabe, A.
1996-01-01
AC losses of superconducting dipole magnets were measured by the calorimetric method. The magnets were model dipole magnets designed for the SSC. These were fabricated at KEK with 50-mm aperture and 1.3-m overall length. The magnet was set in a helium cryostat and cooled down to 1.8 K with 130 L of pressurized superfluid helium. Heat dissipated by the magnet during ramp cycles was measured by temperature rise of the superfluid helium. Heat leakage into the helium cryostat was 1.6 W and was subtracted from the measured heat to obtain AC loss of the magnet. An electrical measurement was carried out for calibration. Results of the two methods agreed within the experimental accuracy. The authors present the helium cryostat and measurement system in detail, and discuss the results of AC loss measurement
Energy Technology Data Exchange (ETDEWEB)
Kim, Chang Hyun; Ha, Sang Jun [KHNP CRI, Daejeon (Korea, Republic of); Han, Kee Soo [Nuclear Engineering Service and Solution (NESS) Co. Ltd., Deajeon (Korea, Republic of); Park, Chan Eok [KEPCO Engineering and Constructd., Deajeon (Korea, Republic of)
2016-10-15
In Korea, the government and industry performed comprehensive safety inspection on all domestic nuclear power plants against beyond design basis external events and fifty action items have been issued. In addition to post- Fukushima action items, the stress tests for all domestic nuclear power plants are on the way to enhance the safety of domestic nuclear power plants through finding the vulnerabilities in intentional stress conditions initiated by beyond design natural disaster. This paper presents assessment results of coping capability of KORI Unit 1 under the simultaneous Extended Loss of AC Power (ELAP) and Loss of Ultimate Heat Sink (LUHS) which is a representative plant condition initiated by beyond design natural disaster. The assessment of the coping capability of KORI Unit 1 has been performed under simultaneous the extended loss of AC power and loss of ultimate heat sink initiated by beyond design natural disaster. It is concluded that KORI Unit 1 has the capability, in the event of loss of safety functions by beyond design natural disaster, to sufficiently cool down the reactor core without fuel damage, to keep pressure boundaries of the reactor coolant system in transient condition and to control containment and temperature to maintain the integrity of the containment buildings.
International Nuclear Information System (INIS)
Kim, Chang Hyun; Ha, Sang Jun; Han, Kee Soo; Park, Chan Eok
2016-01-01
In Korea, the government and industry performed comprehensive safety inspection on all domestic nuclear power plants against beyond design basis external events and fifty action items have been issued. In addition to post- Fukushima action items, the stress tests for all domestic nuclear power plants are on the way to enhance the safety of domestic nuclear power plants through finding the vulnerabilities in intentional stress conditions initiated by beyond design natural disaster. This paper presents assessment results of coping capability of KORI Unit 1 under the simultaneous Extended Loss of AC Power (ELAP) and Loss of Ultimate Heat Sink (LUHS) which is a representative plant condition initiated by beyond design natural disaster. The assessment of the coping capability of KORI Unit 1 has been performed under simultaneous the extended loss of AC power and loss of ultimate heat sink initiated by beyond design natural disaster. It is concluded that KORI Unit 1 has the capability, in the event of loss of safety functions by beyond design natural disaster, to sufficiently cool down the reactor core without fuel damage, to keep pressure boundaries of the reactor coolant system in transient condition and to control containment and temperature to maintain the integrity of the containment buildings
AC magnetization loss characteristics of HTS coated-conductors with magnetic substrates
International Nuclear Information System (INIS)
Tsukamoto, O.; Liu, M.; Odaka, S.; Miyagi, D.; Ohmatsu, K.
2007-01-01
AC magnetization loss characteristics of an HTS coated tape conductor with magnetic substrate subjected to an external AC magnetic field were investigated. The external magnetic field was perpendicular or parallel to the wide face of the tape conductor. Magnetization losses in the conductor and in the magnetic substrate itself without the superconductor layer, were measured by electric and calorimetric methods. The influence of the magnetic property of the substrate was strongly dependent on the direction of the external magnetic field. When the external magnetic field was perpendicular, magnetic property of the substrate did not affect the magnetization loss characteristics. This result suggests that the magnetization losses can be reduced by subdivisions of the superconducting layers even in the case of magnetic substrate conductors. When the external magnetic field was parallel, the magnetization losses were dominated by the losses in the magnetic substrate. Therefore, to reduce the magnetization losses in this case, reduction of magnetization losses in the substrate is necessary
AC magnetization loss characteristics of HTS striated coated conductors with magnetic substrates
International Nuclear Information System (INIS)
Tsukamoto, O; Alamgir, A K M; Sekizawa, S; Miyagi, D
2008-01-01
AC magnetization losses in subdivided CC (Coated Conductor) with magnetic substrate were experimentally investigated comparing with those in subdivided CC with non-magnetic substrate for an AC external magnetic field perpendicular to the wide face of the CC. It is well known that the subdivision is effective to reduce magnetization losses in CC with non-magnetic substrate. The experimental results show that the subdivision is also effective for the CC with magnetic substrate and that the level of reduction of the losses by the subdivisions is almost the same as that of non-magnetic substrate CCs. It is concluded from the experimental results that the magnetic property of the substrate does not affect the magnetization losses in the subdivided conductor in the range of the experiment where the amplitude of the AC external magnetic field is 0 ∼ 0.1 T and the frequency is 16 ∼ 86 Hz
AC magnetization loss characteristics of HTS striated coated conductors with magnetic substrates
Energy Technology Data Exchange (ETDEWEB)
Tsukamoto, O; Alamgir, A K M; Sekizawa, S [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama, Kanagawa, 240-8501 (Japan); Miyagi, D [Okayama University, 1-1, Tsushima-Naka, 1-Chome, Okayama 700-8530 (Japan)], E-mail: Osami-t@ynu.ac.jp
2008-02-01
AC magnetization losses in subdivided CC (Coated Conductor) with magnetic substrate were experimentally investigated comparing with those in subdivided CC with non-magnetic substrate for an AC external magnetic field perpendicular to the wide face of the CC. It is well known that the subdivision is effective to reduce magnetization losses in CC with non-magnetic substrate. The experimental results show that the subdivision is also effective for the CC with magnetic substrate and that the level of reduction of the losses by the subdivisions is almost the same as that of non-magnetic substrate CCs. It is concluded from the experimental results that the magnetic property of the substrate does not affect the magnetization losses in the subdivided conductor in the range of the experiment where the amplitude of the AC external magnetic field is 0 {approx} 0.1 T and the frequency is 16 {approx} 86 Hz.
Measuring ac-loss in high temperature superconducting cable-conductors using four probe methods
DEFF Research Database (Denmark)
Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Olsen, Søren Krüger
1999-01-01
Measuring the ac-loss of superconducting cable conductors have many aspects in common with measuring the ac-loss of single superconducting tapes. In a cable conductor all tapes are connected to each other and to the test circuit through normal metal joints in each end. This makes such measurement...
Fe-based nanocrystalline powder cores with ultra-low core loss
Energy Technology Data Exchange (ETDEWEB)
Wang, Xiangyue, E-mail: wangxiangyue1986@163.com [China Iron and Steel Research Institute Group, Beijing 100081 (China); Center of Advanced Technology and Materials Co., Ltd., Beijing 100081 (China); Lu, Zhichao; Lu, Caowei; Li, Deren [China Iron and Steel Research Institute Group, Beijing 100081 (China); Center of Advanced Technology and Materials Co., Ltd., Beijing 100081 (China)
2013-12-15
Melt-spun amorphous Fe{sub 73.5}Cu{sub 1}Nb{sub 3}Si{sub 15.5}B{sub 7} alloy strip was crushed to make flake-shaped fine powders. The passivated powders by phosphoric acid were mixed with organic and inorganic binder, followed by cold compaction to form toroid-shaped bonded powder-metallurgical magnets. The powder cores were heat-treated to crystallize the amorphous structure and to control the nano-grain structure. Well-coated phosphate-oxide insulation layer on the powder surface decreased the the core loss with the insulation of each powder. FeCuNbSiB nanocrystalline alloy powder core prepared from the powder having phosphate-oxide layer exhibits a stable permeability up to high frequency range over 2 MHz. Especially, the core loss could be reduced remarkably. At the other hand, the softened inorganic binder in the annealing process could effectively improve the intensity of powder cores. - Highlights: • Fe-based nanocrystalline powder cores were prepared with low core loss. • Well-coated phosphate-oxide insulation layer on the powder surface decreased the core loss. • Fe-based nanocrystalline powder cores exhibited a stable permeability up to high frequency range over 2 MHz. • The softened inorganic binder in the annealing process could effectively improve the intensity of powder cores.
AC losses for the various voltage-leads in a semi-triple layer BSCCO conductor
International Nuclear Information System (INIS)
Li, Z.; Ryu, K.; Hwang, S.D.; Cha, G.; Song, H.J.
2011-01-01
Two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer. Voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The loss from the total-lead significantly differs from the sum of the wire losses. In order to investigate the AC loss of the multilayer conductor in a high temperature superconductor cable, a voltage-lead was generally attached to the outermost layer of the conductor. But the conductor's AC loss has not been completely cleared due to the various contact positions and arrangements of the voltage-lead. In this paper, we prepared a semi-triple layer conductor consisting of an inner layer and an outer layer with double layer structure. To measure the AC loss of the conductor, two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer and arranged along their surfaces, as well as another voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The results show that the AC losses for each layer measured from the inner-lead and the outer-lead, respectively, are identical to the sum of the wire losses. The AC losses in the semi-triple layer conductor measured from the total-lead and the outer-lead are identical for the uniform layer current density, and similar to the sum of the wire losses in both layers. However, the losses measured for the non-uniform layer current density from three voltage-leads are unequal to each other, and the loss from the total-lead significantly differs from the sum of the wire losses.
Application of AC servo motor on the in-core neutron flux instrumentation system
International Nuclear Information System (INIS)
Du Xiaoguang; Wang Mingtao
2010-01-01
The application of ac servo motor in the In-Core Neutron Flux Instrumentation System is described. The hardware component of ac servo motor control system is different from the dc motor control system. The effect of two control system on the instrumentation system is compared. The ac servo motor control system can improve the accuracy of the motion control, optimize the speed control and increase the reliability. (authors)
n value and Jc distribution dependence of AC transport current losses in HTS conductors
International Nuclear Information System (INIS)
Ogawa, Jun; Sawai, Yusuke; Nakayama, Haruki; Tsukamoto, Osami; Miyagi, Daisuke
2004-01-01
Compared with LTS materials, HTS materials have some peculiarities affecting AC loss characteristics of the conductors. We measured the AC transport current losses in YBCO thin film coated conductors and a Bi2223/Ag sheathed tape. Comparing the measured data with analytical calculations, the dependence of the AC transport current losses on the n value and critical current density distributions are studied. It is shown that, considering the n values and J c distributions, the peculiarities in the HTS materials can be taken into consideration and the transport current losses in HTS conductors can be calculated by the same analytical method used for LTS
Iwakuma, M; Funaki, K
2002-01-01
The ac loss properties of two-strand parallel conductors composed of superconducting multifilamentary strands were theoretically investigated. The constituent strands generally need to be insulated and transposed for the sake of uniform current distribution and low ac loss. In case the transposition points deviate from the optimum ones, shielding current is induced according to the interlinkage magnetic flux of the twisted loop enclosed by the insulated strands and the contact resistances at the terminals. It produces an additional ac loss. Supposing a simple situation where a two-strand parallel conductor with one-point transposition is exposed to a uniform ac magnetic field, the basic equations for the magnetic field were proposed and the theoretical expressions of the additional ac losses derived. As a result, the following features were shown. The additional ac loss in the non-saturation case, where the induced shielding current is less than the critical current of a strand, is proportional to the square ...
Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors
International Nuclear Information System (INIS)
Iijima, Y.; Hosaka, M.; Sadakata, N.; Saitoh, T.; Kohno, O.; Takeda, K.
1997-01-01
Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high J c sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low J c sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics
AC losses in multilayer power transmission cables comprised of YBCO tapes
International Nuclear Information System (INIS)
Noji, H.
2011-01-01
I calculate AC properties in YBCO cable by an electric circuit model. The optimal helical pitches are determined by the calculation. The layer's current distribution is uniform on the optimal helical pitches. The calculation is useful as a first approximation of AC losses. AC losses in multilayer power transmission cables can be reduced by adjusting the helical winding pitch of each layer to make the layer's current distribution uniform. The optimum helical pitch can be estimated using an electric circuit (EC) model based on the expression that calculates the losses in the superconducting tapes composing the cable. It is known that the losses in a monolayer cable depend on the cable parameters (i.e., the gap between neighboring tapes, number of tapes N, diameter of the cable former and width of the tape). However, regarding Amemiya et al.'s measurement on the losses in monolayer cables, the numerical results of the losses calculated using the Norris formula for an isolated thin strip N times are close to the experimental results. Then, to determine the losses in a three-layer cable that Mukoyama et al. have reported, the losses are calculated by the EC model based on the Norris formula. The helical pitch of each layer is adjusted to make the layer's current distribution uniform in the cable reported by Mukoyama et al. The optimum helical pitches are calculated using the condition where the standard deviation of the layer currents is minimum, and the losses of the cable at the optimum helical pitches are calculated at 1 kA rms . By comparing the results of these calculations with the previously measured results, it was found that the mean error of the calculated values relative to the measured values is 23.7%, which indicates that the calculation using the EC model is useful as a first approximation.
Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.
2010-11-01
AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.
Ac loss measurement of SSC dipole magnets
International Nuclear Information System (INIS)
Delchamps, S.; Hanft, R.; Jaffery, T.; Kinney, W.; Koska, W.; Lamm, M.J.; Mazur, P.O.; Orris, D.; Ozelis, J.P.; Strait, J.; Wake, M.
1992-09-01
AC losses in full length and 1.5 m model SSC collider dipoles were successfully measured by the direct observation of energy flow into and out of magnets during a ramp cycle. The measurement was performed by using two double-integrating type digital volt meters (DVM's) for current and voltage measurement. Measurements were performed for six is m long ASST magnets and five 1.5 m long model magnets, inducting one 40 mm diameter magnet. There were large variations in the eddy current losses. Since these magnets use conductors with slight deviations in their internal structures and processing of the copper surface depending on the manufacturer, it is likely that there are differences in the contact resistance between strands. Correlation between the ramp rate dependence of the,quench current and the eddy current loss was evident
Measurement of AC losses in a racetrack superconducting coil made from YBCO coated conductor
DEFF Research Database (Denmark)
Seiler, Eugen; Abrahamsen, Asger Bech; Kovac, Jan
2012-01-01
to reinforce it. The AC loss is measured versus the transport current Ia with the coil immersed in liquid nitrogen. Measurements at frequencies 21 Hz, 36 Hz and 72 Hz are compared. The AC losses follow I2 a dependence at low current amplitudes and I3 a at high amplitudes. After cutting the inner steel frame...
Energy Technology Data Exchange (ETDEWEB)
Fang, J [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Luo, X M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Chen, D X [ICREA and Grup Electromagnetisme, Departament de Fisica, Universitat Autonoma Barcelona, 08193 Bellaterra (Spain); Alamgir, A K M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Collings, E W [MSE, Ohio State University, Columbus, OH 43210 (United States); Lee, E [MSE, Ohio State University, Columbus, OH 43210 (United States); Sumption, M D [MSE, Ohio State University, Columbus, OH 43210 (United States); Fang, J G [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Yi, H P [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Song, X H [Innova Superconductor Technology Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Guo, S Q [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Liu, M L [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Xin, Y [Innopower Superconductor Cable Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Han, Z [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)
2004-10-01
On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field.
International Nuclear Information System (INIS)
Fang, J; Luo, X M; Chen, D X; Alamgir, A K M; Collings, E W; Lee, E; Sumption, M D; Fang, J G; Yi, H P; Song, X H; Guo, S Q; Liu, M L; Xin, Y; Han, Z
2004-01-01
On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field
International Nuclear Information System (INIS)
Miyagi, D.; Amadutsumi, Y.; Takahashi, N.; Tsukamoto, O.
2007-01-01
AC transport current losses of coated conductors with ferromagnetic substrates are higher than the loss calculated by the Norris equation. In order to reduce the AC transport current loss we propose in this paper a structure of the coated conductor that has wider substrate than the SC (Superconducting) layer. The current distribution and AC loss of the proposed model are analyzed by means of FEM. The AC transport current loss is reduced due to the change of current density distribution near the edge of SC layer, consequent to the high value of magnetic permeability of the ferromagnetic substrate, that is wider than the SC layer
International Nuclear Information System (INIS)
Ainslie, Mark D.; Flack, Tim J.; Campbell, Archie M.
2012-01-01
Properties of stacks of HTS coated conductors with and without a magnetic substrate. Non-magnetic substrate model is consistent with existing methods. Presence of a magnetic substrate increases the total AC loss of the stack. Differences and similarities between certain tapes within stacks are explained. Ferromagnetic loss of substrate negligible in most cases except small currents/fields. In this paper, the authors investigate the electromagnetic properties of stacks of high temperature superconductor (HTS) coated conductors with a particular focus on calculating the total transport AC loss. The cross-section of superconducting cables and coils is often modeled as a two-dimensional stack of coated conductors, and these stacks can be used to estimate the AC loss of a practical device. This paper uses a symmetric two dimensional (2D) finite element model based on the H formulation, and a detailed investigation into the effects of a magnetic substrate on the transport AC loss of a stack is presented. The number of coated conductors in each stack is varied from 1 to 150, and three types of substrate are compared: non-magnetic weakly magnetic and strongly magnetic. The non-magnetic substrate model is comparable with results from existing models for the limiting cases of a single tape (Norris) and an infinite stack (Clem). The presence of a magnetic substrate increases the total AC loss of the stack, due to an increased localized magnetic flux density, and the stronger the magnetic material, the further the flux penetrates into the stack overall. The AC loss is calculated for certain tapes within the stack, and the differences and similarities between the losses throughout the stack are explained using the magnetic flux penetration and current density distributions in those tapes. The ferromagnetic loss of the substrate itself is found to be negligible in most cases, except for small magnitudes of current. Applying these findings to practical applications, where AC
Ripple Field AC Losses in 10-MW Wind Turbine Generators With a MgB2 Superconducting Field Winding
DEFF Research Database (Denmark)
Liu, Dong; Polinder, Henk; Magnusson, Niklas
2016-01-01
Superconducting (SC) synchronous generators are proposed as a promising candidate for 10-20-MW direct-drive wind turbines because they can have low weights and small sizes. A common way of designing an SC machine is to use SC wires with high current-carrying capability in the dc field winding...... and the ac armature winding is made with copper conductors. In such generators, the dc field winding is exposed to ac magnetic field ripples due to space harmonics from the armature. In generator design phases, the ac loss caused by these ripple fields needs to be evaluated to avoid local overheating...... and an excessive cooling budget. To determine the applicability of different design solutions in terms of ac losses, this paper estimates the ac loss level of 10-MW wind generator designs employing a MgB2 SC field winding. The effects on ac losses are compared between nonmagnetic and ferromagnetic teeth...
International Nuclear Information System (INIS)
Matsui, Kunihiro; Koizumi, Norikiyo; Isono, Takaaki; Hamada, Kazuya; Nunoya, Yoshihiko
2003-01-01
The ITER Central Solenoid (CS) model coil, CS Insert and Nb 3 Al Insert were developed and tested from 2000 to 2002. The AC loss performances of these coils were investigated in various experiments. In addition, the AC losses of the CS and Nb 3 Al Insert conductors were measured using short CS and Nb 3 Al Insert conductors before the coil tests. The coupling time constants of these conductors were estimated to be 30 and 120 ms, respectively. On the other hand, the test results of the CS and Nb 3 Al Inserts show that the coupling currents induced in these conductors had multiple decay time constants. In fact, the existence of the coupling currents with long decay time constants, the order of which was in the thousands of seconds, was directly observed with hall sensors and voltage taps. Moreover, the AC loss test results show that electromagnetic force decreases coupling losses with exponential decay constants. This is because the weak sinter among the strands, which originated during heat treatment, was broken due to the electromagnetic force, and then the contact resistance among strands increased. It was found that this exponential decay constant was the function of a gap (i.e., a mechanical property of the cable) created between the cable and conduit due to electromagnetic force. The gap can be estimated by pressure drop, measured under the electromagnetic force. The pressure drop can easily be measured at an initial trial charge, and then it is possible to estimate the exponential decay constant before normal coil operation. Accordingly, it is possible to predict promptly how many times the trial operations are necessary to decrease the coupling losses to the designed value by measuring the coupling losses and the pressure drop during the initial coil operation trial. (author)
Gao, Hezhe; Li, Yongjian; Wang, Shanming; Zhu, Jianguo; Yang, Qingxin; Zhang, Changgeng; Li, Jingsong
2018-05-01
Practical core losses in electrical machines differ significantly from those experimental results using the standardized measurement method, i.e. Epstein Frame method. In order to obtain a better approximation of the losses in an electrical machine, a simulation method considering sinusoidal pulse width modulation (SPWM) and space vector pulse width modulation (SVPWM) waveforms is proposed. The influence of the pulse width modulation (PWM) parameters on the harmonic components in SPWM and SVPWM is discussed by fast Fourier transform (FFT). Three-level SPWM and SVPWM are analyzed and compared both by simulation and experiment. The core losses of several ring samples magnetized by SPWM, SVPWM and sinusoidal alternating current (AC) are obtained. In addition, the temperature rise of the samples under SPWM, sinusoidal excitation are analyzed and compared.
Design and AC loss analysis of a superconducting synchronous motor
Energy Technology Data Exchange (ETDEWEB)
Jiang, Q [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Majoros, M [Department of Materials Science and Engineering, Ohio State University (United States); Hong, Z [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Campbell, A M [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Coombs, T A [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)
2006-11-15
This paper gives a conceptual design of a superconducting synchronous motor consisting of both high-temperature superconducting rotating field winding and armature winding. The AC losses of the armature winding of the motor have been investigated experimentally and numerically, by considering the self-field of the superconducting coils and the rotating magnetic field exposed on the armature winding. The recent developments of YBCO-coated conductors present the possibility of achieving a wholly superconducting machine of significantly smaller size and weight than a conventional machine. Both the rotating field winding and the armature winding are composed of YBCO high-temperature superconducting (HTS) coils. A low AC loss armature winding design has been developed for this superconducting synchronous motor. The performance of the machine was investigated by modelling with the finite-element method. The machine's torque is calculated from first principles by considering the angle between the field and the armature main flux lines.
Low AC Loss in a 3 kA HTS Cable of the Dutch Project
Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan; Willén, Dag; Lentge, Heidi; Thidemann, Carsten; Traeholt, Chresten; Melnik, Irina; Geschiere, Alex
Requirements for a 6 km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160 mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in the cable, potentially affecting public acceptance of the project. A way out would be to substantially reduce AC losses from 1 down to about 0.1 W/m per phase at rated current of 3 kArms, frequency of 50 Hz and temperature of 77 K. In this paper we discuss a strategy towards this ambitious goal, a concept design of the single phase cable 3 kA conductor made of YBCO tapes and present corresponding experimental and simulation data supporting the developed approach leading directly to this goal. HTS cable model was made that show a drastically reduced AC loss. The low loss was achieved by using appropriate pitch angles for two-layer cable conductor of relatively large diameter, by minimizing the gaps between the HTS tapes, and by using narrow HTS tapes that conform well to the roundness of the underlying former. AC loss of 0.12 W/m at 3 kArms was measured at a frequency of 60 Hz and at a temperature of 77 K.
Effect of reduction of mechanical losses in AC superconducting coils having various FRP bobbins
International Nuclear Information System (INIS)
Sekine, N.; Tada, S.; Higuchi, T.; Takao, T.; Yamanaka, A.; Fukui, S.
2004-01-01
We have demonstrated in our previous works that a use of the particular structural material for superconducting coils was effective to mechanical-loss reduction under AC operation. In this study, we measured losses to investigate influence of the mechanical losses in the coils having various fiber reinforced plastics (FRPs) with different thermal expansion coefficients. The losses were small in the coils whose winding tension at coil-operating temperature were strong, on the contrary, the losses of the coil having the weak winding tension were large. The coil having the strongest winding tension at liquid helium temperature showed the smallest loss in all coils, and the loss agreed with a value from the Norris's analysis. We think that the mechanical loss becomes almost zero in this coil since the strong tension can prevent the periodic vibration of the superconducting wire. The dependence of the loss on the difference in surface conditions of the materials of the superconducting coil's bobbins was not observed, however, the mechanical losses in AC coils strongly depended on the winding tensions at cryogenic temperature
Inkjet printing of multifilamentary YBCO for low AC loss coated conductors
International Nuclear Information System (INIS)
Hopkins, S C; Joseph, D; Mitchell-Williams, T B; Glowacki, B A; Calleja, A; Vlad, V R; Vilardell, M; Ricart, S; Granados, X; Puig, T; Obradors, X; Usoskin, A; Falter, M; Bäcker, M
2014-01-01
Considerable progress has been made with the development of REBCO coated conductors in recent years, and high performance conductors are available commercially. For many applications, however, the cost remains prohibitive, and AC losses discourage their selection for higher frequency applications. Chemical solution deposition (CSD) methods are attractive for low-cost, scalable preparation of buffer and superconductor layers, and in many respects inkjet printing is the method of choice, permitting non-contact deposition with minimal materials wastage and excellent control of coating thickness. Highly textured coatings of YBCO and Gd-doped CeO 2 have previously been reported on buffered metal substrates. Inkjet printing also introduces the possibility of patterning - directly depositing two and three dimensional structures without subtractive processing - offering a low-cost route to coated conductors with reduced AC losses. In this contribution, the inkjet deposition of superconducting YBCO tracks is reported on industrially relevant buffered metal substrates both by direct printing and an inverse patterning approach. In the latter approach, ceria tracks were printed reported, which are a candidate both for resistive filament spacers and buffer layers. TFA-based precursor solutions have been printed on SS/ABAD-YSZ/CeO 2 and Ni-W/LZO/CeO 2 RABiTS substrates, and the resulting multifilamentary samples characterised by microscopy and scanning Hall probe measurements. The prospects for future inkjet-printed low AC loss coated conductors are discussed, including control of interfilamentary resistivity and bridging, transposed filamentary structures and stabilisation material.
Energy Technology Data Exchange (ETDEWEB)
Hong, Z; Jiang, Q; Pei, R; Campbell, A M; Coombs, T A [Engineering Department, University of Cambridge, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)
2007-04-15
A finite element method code based on the critical state model is proposed to solve the AC loss problem in YBCO coated conductors. This numerical method is based on a set of partial differential equations (PDEs) in which the magnetic field is used as the state variable. The AC loss problems have been investigated both in self-field condition and external field condition. Two numerical approaches have been introduced: the first model is configured on the cross-section plane of the YBCO tape to simulate an infinitely long superconducting tape. The second model represents the plane of the critical current flowing and is able to simulate the YBCO tape with finite length where the end effect is accounted. An AC loss measurement has been done to verify the numerical results and shows a good agreement with the numerical solution.
Energy Technology Data Exchange (ETDEWEB)
Hong, Z; Jiang, Y; Pei, R; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, CB2 1PZ (United Kingdom); Ye, L [Department of Electrical Power Engineering, CAU, P. O. Box 210, Beijing 100083 (China); Campbell, A M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, CB3 0HE (United Kingdom)], E-mail: Zh223@cam.ac.uk
2008-02-15
In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB{sub 2} wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB{sub 2} wires. The results demonstrate that the multi-element MgB{sub 2} wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement.
Low field critical currents and ac losses of thin film niobium--tin superconductors
International Nuclear Information System (INIS)
Howard, R.E.
1977-01-01
The results of a study of the low field critical current and ac loss properties of niobium-tin thin films and layered composites fabricated by electron-beam coevaporation are presented. Particular emphasis is placed upon determining the suitability of this material for use as a conductor in a superconducting power transmission line. Chapter I contains a summary of this work and its major results together with an introduction to the scientific and engineering concepts associated with a superconducting power transmission line. Chapter II is a discussion of the physics of current transport and the associated loss mechanisms in a type-II superconductor. Chapter III gives the details of the electron-beam coevaporation technique developed to fabricate the samples for this study. Also discussed in this chapter are the effects of the evaporation conditions on the growth morphology of the niobium-tin films. Chapter IV presents the details of the experimental techniques developed to measure the ac loss and critical current in these samples as a function of temperature. Chapter V shows the dependence of the critical current of these films and composites on temperature, magnetic field, and on the number of artificially introduced pinning centers in the layered composites. Experimental results are also presented concerning the stability of these conductors against flux jumps. Chapter VI is a discussion of the ac losses in these samples. Detailed comparisons are made between the measured loss and the predictions of the critical state model
The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets
International Nuclear Information System (INIS)
Moore, Martina; Roth, Stefan; Gebert, Annett; Schultz, Ludwig; Gutfleisch, Oliver
2015-01-01
Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated
The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets
Energy Technology Data Exchange (ETDEWEB)
Moore, Martina, E-mail: m.moore@ifw-dresden.de [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Roth, Stefan; Gebert, Annett [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Schultz, Ludwig [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); TU Dresden, Institute for Materials Science, 01062 Dresden (Germany); Gutfleisch, Oliver [TU Darmstadt, Department of Materials Science, Alarich-Weiß-Str. 16, 64287 Darmstadt (Germany); Fraunhofer Project Group for Materials Recycling and Resource Strategies IWKS, 63457 Hanau (Germany)
2015-02-01
Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated.
Low AC-Loss Superconducting Cable Technology for Electric Aircraft Propulsion, Phase I
National Aeronautics and Space Administration — The availability of low AC loss magnesium diboride (MgB2) superconducting wires enables much lighter weight superconducting stator coils than with any other metal or...
AC Transport Current Loss in a Coated Superconductor in the Bean Model
National Research Council Canada - National Science Library
Carr, Jr, W. J
2004-01-01
A new and straightforward calculation is made of the loss in a very thin superconducting strip of rectangular cross section carrying ac transport current in zero applied magnetic field, with a similar...
AC losses in a type II superconductor strip with inhomogeneous critical current distribution
International Nuclear Information System (INIS)
Tsukamoto, Osami
2005-01-01
Analytical formulae derived by Brandt and Indenbom (1993 Phys. Rev. B 48 12893-906) and Norris (1970 J. Phys. D: Appl. Phys. 3 489-507) are often used to calculate the magnetization and AC transport current losses in HTS strip conductors, respectively. In these formulae, homogeneous distribution of critical sheet current density σ c in the strip is assumed. However, it is considered that σ c distributions are inhomogeneous in actual HTS strips and that the inhomogeneous σ c distributions cause deviations of the measured AC loss data of actual HTS strips from those formulae. A semi-analytical method to calculate AC transport current and magnetization losses is derived for a type II superconductor strip with inhomogeneous distribution of σ c in the direction of the strip width. The method is derived modifying the analysis of Brandt et al. The validity of the semi-analytical method is shown by comparing the results calculated by this method with those calculated by the Norris and Brandt formulae and by a different method of our previous work and also with experimental data. Moreover, it is shown that the deviation of the measured data from the Norris and Brandt models can be estimated by assuming proper σ c distributions
Loss characteristics of FLTD magnetic cores under fast pulsed voltage
International Nuclear Information System (INIS)
Wang Zhiguo; Sun Fengju; Qiu Aici; Jiang Xiaofeng; Liang Tianxue; Yin Jiahui; Liu Peng; Wei Hao; Zhang Pengfei; Zhang Zhong
2012-01-01
The test platform has been developed to generate exciting pulsed voltages with the rise time less than 30 ns. The loss characteristics of cores of 25 μm 2605TCA Metglas and 50 μm DG6 electrical steel were then studied. A characteristic parameter, the gradient of the voltage pulse applied per unit core area, is proposed to describe the exciting condition applied on magnetic cores. The loss of the DG6 core is about 4 times that of the 2605TCA core. Most loss of the DG6 core, about 75%, is due to eddy current. For the 2605TCA core, the percentage is about 28%. (authors)
Yao, Atsushi; Sugimoto, Takaya; Odawara, Shunya; Fujisaki, Keisuke
2018-05-01
We report core loss properties of permanent magnet synchronous motors (PMSM) with amorphous magnetic materials (AMM) core under inverter and sinusoidal excitations. To discuss the core loss properties of AMM core, a comparison with non-oriented (NO) core is also performed. In addition, based on both experiments and numerical simulations, we estimate higher (time and space) harmonic components of the core losses under inverter and sinusoidal excitations. The core losses of PMSM are reduced by about 59% using AMM stator core instead of NO core under sinusoidal excitation. We show that the average decrease obtained by using AMM instead of NO in the stator core is about 94% in time harmonic components.
Directory of Open Access Journals (Sweden)
Atsushi Yao
2018-05-01
Full Text Available We report core loss properties of permanent magnet synchronous motors (PMSM with amorphous magnetic materials (AMM core under inverter and sinusoidal excitations. To discuss the core loss properties of AMM core, a comparison with non-oriented (NO core is also performed. In addition, based on both experiments and numerical simulations, we estimate higher (time and space harmonic components of the core losses under inverter and sinusoidal excitations. The core losses of PMSM are reduced by about 59% using AMM stator core instead of NO core under sinusoidal excitation. We show that the average decrease obtained by using AMM instead of NO in the stator core is about 94% in time harmonic components.
Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)
International Nuclear Information System (INIS)
Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.
2007-01-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured
Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)
Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.
2007-10-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured.
Murphy, J. P.; Gheorghiu, N. N.; Bullard, T.; Haugan, T.; Sumption, M. D.; Majoros, M.; Collings, E. W.
2017-09-01
A new facility for the measurement of AC loss in superconductors at high dB/dt has been developed. The test device has a spinning rotor consisting of permanent magnets arranged in a Halbach array; the sample, positioned outside of this, is exposed to a time varying AC field with a peak radial field of 0.566 T. At a rotor speed of 3600 RPM the frequency of the AC field is 240 Hz, the radial dB/dt is 543 T/s and the tangential dB/dt is 249 T/s. Loss is measured using nitrogen boiloff from a double wall calorimeter feeding a gas flow meter. The system is calibrated using power from a known resistor. YBCO tape losses were measured in the new device and compared to the results from a solenoidal magnet AC loss system measurement of the same samples (in this latter case measurements were limited to a field of amplitude 0.1 T and a dB/dt of 100 T/s). Solenoidal magnet system AC loss measurements taken on a YBCO sample agreed with the Brandt loss expression associated with a 0-0.1 T Ic of 128 A. Subsequently, losses for two more YBCO tapes nominally identical to the first were individually measured in this spinning magnet calorimeter (SMC) machine with a Bmax of 0.566 T and dB/dt of up to 272 T/s. The losses, compared to a simplified version of the Brandt expression, were consistent with the average Ic expected for the tape in the 0-0.5 T range at 77 K. The eddy current contribution was consistent with a 77 K residual resistance ratio, RR, of 4.0. The SMC results for these samples agreed to within 5%. Good agreement was also obtained between the results of the SMC AC loss measurement and the solenoidal magnet AC loss measurement on the same samples.
Nonlinear Dynamic Model of PMBLDC Motor Considering Core Losses
DEFF Research Database (Denmark)
Fasil, Muhammed; Mijatovic, Nenad; Jensen, Bogi Bech
2017-01-01
The phase variable model is used commonly when simulating a motor drive system with a three-phase permanent magnet brushless DC (PMBLDC) motor. The phase variable model neglects core losses and this affects its accuracy when modelling fractional-slot machines. The inaccuracy of phase variable mod...... on the detailed analysis of the flux path and the variation of flux in different components of the machine. A prototype of fractional slot axial flux PMBLDC in-wheel motor is used to assess the proposed nonlinear dynamic model....... of fractional-slot machines can be attributed to considerable armature flux harmonics, which causes an increased core loss. This study proposes a nonlinear phase variable model of PMBLDC motor that considers the core losses induced in the stator and the rotor. The core loss model is developed based...
Ac loss measurements on a superconducting transformer for a 25 kA superconducting rectifier
ten Kate, Herman H.J.; Mulders, J.M.; de Reuver, J.L.; van de Klundert, L.J.M.
1984-01-01
Ac loss measurements have been performed on a superconducting transformer. The transformer is a part of a 25 kA thermally switched superconducting rectifier operating at a frequency of 0.1 Hz. The loss measurements have been automatized by means of a microcomputer sampling four relevant signals and
Persistent breather excitations in an ac-driven sine-Gordon system with loss
International Nuclear Information System (INIS)
Lomdahl, P.S.; Samuelsen, M.R.
1986-01-01
In a sine-Gordon system with loss and applied ac driver, a breather can be maintained as a persistent entrained oscillation if the driver is strong enough. The threshold field is determined by a perturbation method and compared to numerical experiments. Excellent agreement is found
International Nuclear Information System (INIS)
Alamgir, A.K.M.; Gu, C.; Han, Z.
2006-01-01
An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 μm thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance
Energy Technology Data Exchange (ETDEWEB)
Alamgir, A.K.M. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)]. E-mail: alam643@hotmail.com; Gu, C. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Han, Z. [Department of Physics, Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)
2006-07-01
An approach of realizing high performance HTS coil comprised of ferromagnetic material-coated BSCCO tape is proposed. The concept of influencing critical current and ac loss is based on the magnetic shielding effect resulting in redirection of self-field flux-lines. In the previous article, ac performance of Ni-coated tape was demonstrated where the Ni-coating was introduced at the edge-regime of the finished tape in order to redirect the perpendicular component of self-field lines. In order to investigate the shielding effect on ac performance in HTS coil, a two-turn pancake coil comprised of Ni-coated Bi-2223/Ag tape is demonstrated in the present article. About 6.4% of critical current was enhanced and 30% of transport current ac loss was reduced by means of 40 {mu}m thick and 0.3 mm long (from the edge toward center of the tape) Ni-coating. This result suggests that additional ferromagnetic loss could be compensated well by the shielding effect of the partial Ni-coating. The degree of enhancement in critical current as well as ferromagnetic impact on ac losses depend on the volume and geometry of ferromagnetic coating introduced. Therefore, it is very important to control the parameter of ferromagnetic coating of the tape in order to balance the critical current and ac loss for optimum coil performance.
International Nuclear Information System (INIS)
Tsukamoto, Osami; Li, Z
2007-01-01
The influence of uniaxial tensile stress-strain on the AC loss characteristics of multifilamentary Bi2223/Ag sheathed tape wires was investigated. The uniaxial tensile stress-strain was applied to the sample wire in liquid nitrogen at atmospheric pressure, and the AC losses (transport, magnetization and total losses) were measured by an electric method. Two kinds of wire, oxide-dispersion strengthened Ag-alloy sheathed and Ag-alloy sheathed wires, were tested. The stress-strain curves of the tested wires were divided in three regions, i.e. elastic deformation, continuous plastic deformation and serrated-like plastic deformation regions, though the ranges of those regions were different for different kinds of wire. In the elastic and continuous plastic regions, the stress-strain curve was smooth and continuous, and in the serrated-like plastic region, the curve was rough. In the serrated-like plastic region, the wires kept elongating, while increase of the tensile stress was suspended. Dependences of the critical currents on the stress-strain were generally as follows. While decreases of the wire critical currents were in the range of less than 4% of the original values of the no-stress condition, the critical currents of the wires were reversible, that is, the critical currents recovered the original values at zero stress when the stress were released, regardless of whether the wires were in the elastic or continuous plastic region. In the continuous plastic region, the critical currents decreased up to 10%-15% of the original values and the critical currents were irreversible when the degradations of the critical currents exceeded about 4%. In the serrated-like plastic regions, the critical currents were more severely degraded. The AC loss characteristics of the wires are different in those regions. In the elastic and continuous plastic regions, the absolute values of AC losses were dependent on the stress-strain. However, the dependences of those normalized
AC loss in superconducting wires operating in a wind turbine like generator
DEFF Research Database (Denmark)
Seiler, Eugen; Zirngibl, Thomas; Mijatovic, Nenad
2010-01-01
We have manufactured a small circular superconducting coil impregnated with epoxy fibreglass. The coil was wound from a Bi-2223/Ag superconducting wire and it was tested in liquid nitrogen at 77 K. Current-voltage characteristic and the AC losses of the coil were measured and compared...
An ac susceptibility study in capped Ni/Ni(OH)2 core-shell nanoassemblies: dual peak observations
International Nuclear Information System (INIS)
Godsell, Jeffrey F; Roy, Saibal; Bala, Tanushree; Ryan, Kevin M.
2011-01-01
In this study, the ac susceptibility (χ' and χ'') variation with temperature (10-100 K) for oleic acid (OA) capped Ni/Ni(OH) 2 core-shell nanoparticle assemblies are reported at frequencies varying from 0.1 to 1000 Hz. Nanoparticle assemblies, with two average particle diameters of ∼34 nm and ∼14 nm, were synthesized using a wet chemical synthesis approach. Two peaks in the ac susceptibility versus temperature curves are clearly discernable for each of the samples. The first, occurring at ∼22 K was attributed to the paramagnetic/antiferromagnetic transition of the Ni(OH) 2 present in the shell. The second higher temperature peak was attributed to the superparamagnetic blocking of the pure Ni situated at the core of the nanoparticles. The higher temperature peaks in both the χ' and χ'' curves were observed to increase with increasing frequency. Thus the Neel and the blocking temperatures for such core-shell nanoassemblies were clearly identified from the ac analysis, whereas they were not discernible (superimposed) even from very low dc (FC/ZFC) field measurements. Interparticle interactions within the assemblies were studied through the fitting of phenomenological laws to the experimental datasets. It is observed that even with an OA capping layer, larger Ni/Ni(OH) 2 nanoparticles experience a greater degree of sub-capping layer oxidation thus producing lower magnetic interaction strengths.
Low frequency AC losses in multi filamentary superconductors up to 15 Tesla
International Nuclear Information System (INIS)
Orlando, T.; Braun, C.; Foner, S.; Schwartz, B.; Zieba, A.
1983-01-01
Low frequency (1 Hz) ac losses were measured in a variety of A15 superconducting wires having different fiber geometries. Field modulations ofless than or equal to 1 tesla were superimposed on a fixed background field up to 15 tesla. Losses were measured for Nb 3 Sn in continuous fiber, modified jelly-roll, In Situ, and powder metallurgy processed materials, and for Nb 3 Al powder metallurgy processed materials. The results are compared with dc magnetization measurements. The losses are purely hysteretic at these low frequencies, scale with J /SUB c/ (above about 3 tesla), and are reduced substantially by twisting for all the materials. The lowest losses are observed for the Nb 3 Al wires
Evaluation of stator core loss of high speed motor by using thermography camera
Sato, Takeru; Enokizono, Masato
2018-04-01
In order to design a high-efficiency motor, the iron loss that is generated in the motor should be reduced. The iron loss of the motor is generated in a stator core that is produced with an electrical steel sheet. The iron loss characteristics of the stator core and the electrical steel sheet are agreed due to a building factor. To evaluate the iron loss of the motor, the iron loss of the stator core should be measured more accurately. Thus, we proposed the method of the iron loss evaluation of the stator core by using a stator model core. This stator model core has been applied to the surface mounted permanent magnet (PM) motors without windings. By rotate the permanent magnet rotor, the rotating magnetic field is generated in the stator core like a motor under driving. To evaluate the iron loss of the stator model core, the iron loss of the stator core can be evaluated. Also, the iron loss can be calculated by a temperature gradient. When the temperature gradient is measured by using thermography camera, the iron loss of entire stator core can be evaluated as the iron loss distribution. In this paper, the usefulness of the iron loss evaluation method by using the stator model core is shown by the simulation with FEM and the heat measurement with thermography camera.
International Nuclear Information System (INIS)
Goldfarb, R.B.; Clark, A.F.
1985-01-01
Magnetization and ac susceptibility of a standard NbTi superconductor were measured as a function of longitudinal dc magnetic field. The ac-field-amplitude and frequency dependences of the complex susceptibility are examined. The magnetization is related to the susceptibility by means of a theoretical derivation based on the field dependence of the critical current density. Hysteresis losses, obtained directly from dc hysteresis loops and derived theoretically from ac susceptibility and critical current density, were in reasonable agreement
A Practical Core Loss Model for Filter Inductors of Power Electronic Converters
DEFF Research Database (Denmark)
Matsumori, Hiroaki; Shimizu, Toshihisa; Wang, Xiongfei
2018-01-01
This paper proposes a core loss model for filter inductors of power electronic converters. The model allows a computationally efficient analysis on the core loss of the inductor under the square voltage excitation and the premagnetization condition. First, the core loss of the filter inductor under...... buck chopper excitation is evaluated with the proposed model and compared with the conventional methods. The comparison shows that the proposed method results in a better core loss prediction under the premagnetized condition than that of conventional alternatives. Then, the core loss of the filter...... inductor with the pulsewidth modulated inverter excitation is evaluated, which shows that the proposed model not only accurately predicts the core loss but also identifies the hysteresis loss part. These results demonstrate that the approach can further be used for the development of magnetic materials...
Ac susceptibility of a Bi-2223/Ag tape in a perpendicular field
International Nuclear Information System (INIS)
Savvides, N.; Mueller, K.-H.
1999-01-01
Full text: We report experimental measurements and theoretical calculations of the real ( X ') and imaginary or loss ( X '') parts of the ac susceptibility as a function of temperature T = 4 - 130 K, frequency ω/2π = 5 Hz - 5 kHz and ac magnetic field amplitude μ 0 H m = 0.02 - 7 mT for of a monofilament silver-sheathed Bi-2223 tape. The susceptibilities consist of a hysteretic component due to ac loss ( Xsc '') in the superconductor core and an eddy current component due to eddy current loss ( Xed '') in the silver sheath. At high temperatures the low frequency limit is used to calculate the hysteretic and eddy current susceptibilities while at low temperatures the susceptibility is found to be due to eddy currents flowing along the edges of the tape. The measured loss at low frequencies (< 50 Hz) and high temperatures is dominated by the hysteresis loss which varies with amplitude but is essentially independent of frequency. At higher frequencies the eddy current loss of the silver sheath becomes dominant and it increases dramatically with frequency at both low and high temperatures
DEFF Research Database (Denmark)
Thummala, Prasanth; Schneider, Henrik; Ouyang, Ziwei
2013-01-01
In a bi-directional DC-DC converter for capacitive charging application, the losses associated with the transformer makes it a critical component. In order to calculate the transformer losses, its parameters such as AC resistance, leakage inductance and self capacitance of the high voltage (HV......) winding has to be estimated accurately. This paper analyzes the following losses of bi-directional flyback converter namely switching loss, conduction loss, gate drive loss, transformer core loss, and snubber loss, etc. Iterative analysis of transformer parameters viz., AC resistance, leakage inductance...
Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza
2008-01-01
AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.
International Nuclear Information System (INIS)
Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza
2008-01-01
AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency
Energy Technology Data Exchange (ETDEWEB)
Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza [Center of Excellence for Power System Automation and Operation, Electrical Engineering Department, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)
2008-01-15
AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.
Complex permeability and core loss of soft magnetic Fe-based nanocrystalline powder cores
Energy Technology Data Exchange (ETDEWEB)
Füzerová, Jana, E-mail: jana.fuzerova@tuke.sk [Faculty of Mechanical Engineering, Technical University, Letná 1, 042 00 Košice (Slovakia); Füzer, Ján; Kollár, Peter [Institute of Physics, P.J. Šafárik University, Park Angelinum 9, 040 23 Košice (Slovakia); Bureš, Radovan; Fáberová, Mária [Institute of Materials Research, Slovak Academy of Sciences, Watsonova 47, 043 53 Košice (Slovakia)
2013-11-15
Rapidly quenched ribbons of Fe{sub 73}Cu{sub 1}Nb{sub 3}Si{sub 16}B{sub 7} were ball milled and cryomilled to get powder and warm consolidated to get bulk compacts. The data presented here are relative to different experimental procedures, one corresponding to milling at room temperature (sample R1) and the other corresponding to cryomilling at temperature of liquid nitrogen (sample L1). It was found that the properties of the initial powder influenced the density, the electrical resistivity and electromagnetic properties of the resulting bulk alloys. Permeability and core loss are structure sensitive and depend on factors such as powder size and shape, porosity, purity, and internal stress. Permeability spectra of sample R1 decreases with increasing the frequency and its values are larger than that for sample L1 at low frequencies. On the other hand the permeability of sample L1 remains steady up to 1 kHz and at certain frequency is larger than that for sample R1. Also there are different frequency dependences of the imaginary parts of permeability and loss factor, respectively. The cryomilling of the amorphous ribbon positively influences on the AC magnetic properties at higher frequencies (above 100 Hz) of resulting bulk sample. - Highlights: • We prepared two different amorphous powder vitroperm samples. • We have examined changes in the properties of the bulk samples prepared by compaction. • It was found that properties of the initial powder influence the density, the electrical resistivity and electromagnetic properties of the resulting bulk alloys.
Modelling high-resolution electron microscopy based on core-loss spectroscopy
International Nuclear Information System (INIS)
Allen, L.J.; Findlay, S.D.; Oxley, M.P.; Witte, C.; Zaluzec, N.J.
2006-01-01
There are a number of factors affecting the formation of images based on core-loss spectroscopy in high-resolution electron microscopy. We demonstrate unambiguously the need to use a full nonlocal description of the effective core-loss interaction for experimental results obtained from high angular resolution electron channelling electron spectroscopy. The implications of this model are investigated for atomic resolution scanning transmission electron microscopy. Simulations are used to demonstrate that core-loss spectroscopy images formed using fine probes proposed for future microscopes can result in images that do not correspond visually with the structure that has led to their formation. In this context, we also examine the effect of varying detector geometries. The importance of the contribution to core-loss spectroscopy images by dechannelled or diffusely scattered electrons is reiterated here
Finite-element analysis and comparison of the AC loss performance of BSCCO and YBCO conductors
International Nuclear Information System (INIS)
Stavrev, Svetlomir; Grilli, Francesco; Dutoit, Bertrand; Ashworth, Stephen
2006-01-01
The AC loss performance of two BSCCO and two YBCO conductors of different geometry, characterized by the same self-field critical current of 150 A, is analysed and compared quantitatively. The comparison is made using the finite-element method with a nonlinear B-dependent E-J relation. A new shell-region model is utilised for the simulations of thin YBCO strips. Different AC working conditions are simulated: self-field, applied external field, and combined transport current and external perpendicular field application. Magnetic field and current density profiles are investigated in order to illustrate the reasons for the loss difference in the conductors. Depending on the application, the advantages of using BSCCO or YBCO conductors with specific geometry are outlined
Low Loss and Highly Birefringent Hollow-Core Photonic Crystal Fiber
DEFF Research Database (Denmark)
Roberts, P. John; Williams, D.P.; Mangan, Brian J.
2006-01-01
A hollow-core photonic crystal fiber design is proposed which enables both low-loss and polarization-maintained signal propagation. The design relies on an arrangement of antiresonant features positioned on the glass ring that surrounds the air core.......A hollow-core photonic crystal fiber design is proposed which enables both low-loss and polarization-maintained signal propagation. The design relies on an arrangement of antiresonant features positioned on the glass ring that surrounds the air core....
Toward quantitative core-loss EFTEM tomography
International Nuclear Information System (INIS)
Jin-Phillipp, N.Y.; Koch, C.T.; Aken, P.A. van
2011-01-01
Core-loss EFTEM tomography provides three-dimensional structural and chemical information. Multiple inelastic scattering occurring in thick specimens as well as orientation-dependent diffraction contrast due to multiple elastic scattering, however, often limit its applications. After demonstrating the capability of core-loss EFTEM tomography to reconstruct just a few monolayers thin carbon layer covering a Fe catalyst particle we discuss its application to thicker samples. We propose an approximate multiple-scattering correction method based on the use of zero-loss images and apply it successfully to copper whiskers, providing a significant improvement of the reconstructed 3D elemental distribution. We conclude this paper by a general discussion on experimental parameters affecting the accuracy of EFTEM 3D elemental mapping. -- Research highlights: → EFTEM 3D elemental mapping has been applied to a catalyst particle from which a CNT has grown and a copper whisker. → Correction of multiple inelastic scattering shows significant improvements in the reconstruction of 3D elemental maps. → Experimental parameters affecting the accuracy of EFTEM 3D elemental mapping are discussed.
International Nuclear Information System (INIS)
Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A; Rodriguez-Zermeno, Victor M; Hong Zhiyong
2011-01-01
AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.
Energy Technology Data Exchange (ETDEWEB)
Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A [Department of Engineering, University of Cambridge, 9 J J Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Rodriguez-Zermeno, Victor M [Department of Mathematics, Technical University of Denmark, Kongens Lyngby 2800 (Denmark); Hong Zhiyong, E-mail: mda36@cam.ac.uk [School of Electronic, Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai (China)
2011-04-15
AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.
Magnetic loss analysis in Mn-Zn ferrite cores
International Nuclear Information System (INIS)
Beatrice, C.; Bottauscio, O.; Chiampi, M.; Fiorillo, F.; Manzin, A.
2006-01-01
Magnetic losses have been measured and analyzed upon a wide range of frequencies in Mn-Zn ferrite ring cores. Exploiting the concept of loss separation and modeling the conductivity process in the heterogeneous material as a function of frequency, the role of the different energy dissipation mechanisms has been elucidated. It is shown, in particular, that eddy current effects can be appreciated, in standard materials and cores, only on approaching and overcoming the MHz range. The basic mechanism for hysteresis and low-frequency losses is therefore identified with the domain wall relaxation engendered by spin damping processes. Resonant absorption of energy associated with magnetization rotation is in turn deemed to chiefly contribute to the loss upon the practical range of frequencies going from a few 10 4 Hz to a few MHz
Bean model and ac losses in Bi2Ca2Cu3O10/Ag tapes
International Nuclear Information System (INIS)
Suenaga, M.; Chiba, T.; Wiesmann, H.J.; Haldar, P.
1997-01-01
The Bean model is almost solely used to interpret ac losses in the powder-in-tube processed composite conductor, Bi 2 Sr 2 Ca 2 Cu 3 O 10 /Ag. In order to examine the limits of the applicability of the model, a detailed comparison was made between the values of critical current density J c for Bi(2223)/Ag tapes which were determined by standard four-probe-dc measurement, and which were deduced from the field dependence of the ac losses utilizing the model. A significant inconsistency between these values of J c were found, particularly at high fields. Possible sources of the discrepancies are discussed
Ac-loss measurement of coated conductors: The influence of the pick-up coil position
International Nuclear Information System (INIS)
Schmidt, Curt
2008-01-01
The ac-loss measurement by the magnetization method requires calibration for obtaining absolute values. A convenient way of calibration is the calorimetric measurement which yields, within the measuring accuracy, absolute loss values. In the magnetization measurement the hysteresis loop of sample magnetization which determines the losses is measured via the integration of magnetic flux penetrating a pick-up coil. The ratio of flux integral to magnetization integral and hence the calibration factor is however, for a given pick-up coil geometry, not exactly a constant, but depends on the magnetization current pattern within the sample. Especially for thin tapes in perpendicular external field this effect has to be taken into consideration in order to avoid miss measurements. The relation between measured flux and sample magnetization was calculated for special cases of magnetization current distribution in the sample as a function of the pick-up coil position. Furthermore calibration factors were measured as a function of the ac-field amplitude and the result compared with available theoretical models. A good agreement was found between experiment and theory
Evaluation of CCTF Core-II second acceptance Test C2-AC2 (Run 052)
International Nuclear Information System (INIS)
Okubo, Tsutomu; Murao, Yoshio
1984-03-01
In order to investigate the thermo-hydrodynamic behavior in a PWR during the reflood phase of the LOCA, large scale reflooding tests have been conducted at JAERI using the CCTF Core-I and Core-II facilities. This report presents the investigation on the difference in the thermo-hydrodynamic behavior observed between in the CCTF Core-I and Core-II facilities. For this purpose the test data of the second CCTF Core-II acceptance test C2-AC2 (Run 052) were evaluated by using the data of the Test CL-21 (Run 040) in the Core-I test series. The experimental conditions for these two tests were almost identical. Comparing the data of those two tests, the following is obtained. 1. The system behavior observed in the Core-II facility was nearly identical to that observed in the Core-I facility. 2. The core behavior observed in the Core-II facility was also nearly identical to that observed in the Core-I facility except for the top quenching behavior. 3. The differences in the top quenching behavior between the two facilities were as follows: (1) The selective occurrence of top quenching below the open holes of the upper core support plate observed in the Core-I facility was not observed in the Core-II facility. (2) Top quenching tended to occur less in the Core-II facility in the region where the initial average linear power density was over 1.69 kW/m. (author)
Understanding losses in three core armoured submarine cables
DEFF Research Database (Denmark)
Silva, Filipe Miguel Faria da; Ebdrup, Thomas; Bak, Claus Leth
2016-01-01
. For practical an economical reasons the preferred choice of cable for both the array and the transmission cables are three-core armoured submarine cables. Therefore, it has becoming increasingly important to be able to calculate the ampacity of such cables accurately. At present time, the ampacity of three......-core armoured submarine cables is calculated according to IEC 60287-1-1 [1]. Various measurements conducted both by cable manufacturers and transmission system operators (TSO) have shown that using the cable rating method stated in IEC 60287-1-1 underestimates the cable ampacity [2]-[6]. Furthermore......, measurements conducted within the cable industry have shown that an armoured three core cable has higher losses than equal unarmoured three core cables. It is also suggested that the inaccuracy in the IEC armour’s loss factor (λ2) is the main responsible for the conservatism in the IEC cable rating method...
AC loss in the superconducting cables of the CERN Fast Cycled Magnet Prototype
Borgnolutti, F.; Bottura, L.; Nijhuis, Arend; Zhou, Chao; Liu, Bo; Miyoshi, Y.; Krooshoop, Hendrikus J.G.; Richter, D.
2011-01-01
Fast Cycled Superconducting Magnets (FCM's) are an option of interest for the long-term consolidation and upgrade plan of the LHC accelerator complex. The economical advantage of FCM's in the range of 2 T bore field, continuously cycled at 0.5 Hz repetition rate, depends critically on the AC loss
Directory of Open Access Journals (Sweden)
Nicolas Denis
2016-05-01
Full Text Available In this paper, an interior permanent magnet synchronous motor (IPMSM with a stator core made of amorphous magnetic material (AMM is presented. The IPMSM is driven by a voltage source three-phase inverter with classical pulse width modulation (PWM control. The core losses under no-load condition are measured by experiment and compared to an equivalent IPMSM with a stator core made of NO steel. Under these conditions, the core losses are influenced by the stator, rotor and magnet shapes but also by the PWM carrier signal that implies a high frequency harmonic in the magnetic flux density. It is demonstrated that the AMM can reduce the core losses by about 56 %.
Investigating the impact of uneven magnetic flux density distribution on core loss estimation
DEFF Research Database (Denmark)
Niroumand, Farideh Javidi; Nymand, Morten; Wang, Yiren
2017-01-01
is calculated according to an effective flux density value and the macroscopic dimensions of the cores. However, the flux distribution in the core can alter by core shapes and/or operating conditions due to nonlinear material properties. This paper studies the element-wise estimation of the loss in magnetic......There are several approaches for loss estimation in magnetic cores, and all these approaches highly rely on accurate information about flux density distribution in the cores. It is often assumed that the magnetic flux density evenly distributes throughout the core and the overall core loss...
Yagotintsev, K.; Nijhuis, A.
2018-07-01
Two prototype Nb3Sn cable-in-conduit conductors conductors were designed and manufactured for the toroidal field (TF) magnet system of the envisaged European DEMO fusion reactor. The AC loss, contact resistance and mechanical properties of two sample conductors were tested in the Twente Cryogenic Cable Press under cyclic load up to 30 000 cycles. Though both conductors were designed to operate at 82 kA in a background magnetic field of 13.6 T, they reflect different approaches with respect to the magnet winding pack assembly. The first approach is based on react and wind technology while the second is the more common wind and react technology. Each conductor was tested first for AC loss in virgin condition without handling. The impact of Lorentz load during magnet operation was simulated using the cable press. In the press each conductor specimen was subjected to transverse cyclic load up to 30 000 cycles in liquid helium bath at 4.2 K. Here a summary of results for AC loss, contact resistance, conductor deformation, mechanical heat production and conductor stiffness evolution during cycling of the load is presented. Both conductors showed similar mechanical behaviour but quite different AC loss. In comparison with previously tested ITER TF conductors, both DEMO TF conductors possess very low contact resistance resulting in high coupling loss. At the same time, load cycling has limited impact on properties of DEMO TF conductors in comparison with ITER TF conductors.
International Nuclear Information System (INIS)
Polak, M.; Jansak, L.
2000-01-01
We experimentally studied the effects of a single artificial defect and a linear array of artificial defects on I-V curves, critical currents and transport current ac losses of 55 filament untwisted Bi-2223/Ag tapes. The artificial defect was a small hole drilled into the tape. The reduction in the critical current measured on a 1 cm long section due to one hole of diameter 0.9 mm was 33% and that due to a linear array of seven similar holes was 62%. The slopes of the I-V curves, n, measured in this section were 33, 16 and 5.8 in the original sample, in the sample with one defect and the sample with seven defects, respectively. Both I c and the slope reduction were smaller if the distance between the potential taps was increased. The transport current ac losses at 50 Hz and I rms = 10 A in the sample with one defect measured in a 1 cm long section were practically the same as those in the original sample (4.1x10 -4 W m -1 ), but they increased by 83% in the sample with a linear array of seven defects. The measured increase in losses per unit length was the smaller, the larger the distance between the potential taps. A comparison between the measured and calculated losses revealed that a formal application of the Norris equations for loss calculations in samples with local defects leads to an overestimation of the ac losses. A procedure for the calculation of transport current losses in samples with local defects based on the Norris model is proposed and verified. (author)
Nijhuis, Arend; ten Kate, Herman H.J.
1994-01-01
AC losses in cables carrying DC as well as AC transport currents at different DC background fields up to 2T have been measured on three types of Nb3Sn subcables in a new test facility. In this facility it is possible to apply sinusoidal transverse AC fields up to dB/dt=5T/s and longitudinal AC
Dependence of the ac loss on the aspect ratio in a cable in conduit conductor
International Nuclear Information System (INIS)
Cau, F; Bruzzone, P
2010-01-01
The coupling current loss in rectangular superconducting cables is strictly dependent on their aspect ratio, which has an impact on the area linked by the field variation and consequently on the currents induced between strands. The relation between the ac loss and aspect ratio is studied with reference to the testing of three short cable in conduit conductor (CICC) samples at the SULTAN test facility. The first conductor is a 25 kA NbTi cable for the JT60-SA tokamak; the second is a 20 kA Nb 3 Sn cable for the HZB hybrid magnet. The last CICC is a 68 kA Nb 3 Sn cable with layout similar to that of the ITER toroidal field (TF) conductor (called the 'European toroidal field (EUTF) alternate'). All the samples are assembled with two conductor sections differing only in their orientation with respect to the external variable field. In the first and third samples, the cable of one leg is rotated by 90 0 , while in the HZB sample it is rotated by 45 0 with respect to the other leg. The ac loss is measured at the SULTAN test facility using a gas flow calorimetric method. A sample length of 39 cm is exposed to a sinusoidal field with an amplitude of ± 0.3 or ± 0.2 T (depending on the superconductor) and frequency variable in the range 0.1-0.8 Hz. A background field of 2 T perpendicular both to the sinusoidal field and to the sample axis is also applied. The ac loss is assessed by measuring the variation of the He enthalpy, assuming the metal enthalpy to be negligible. The loss curve for both legs is discussed in terms of the respective aspect ratios and the results, including data from former test campaigns, are compared with the aim of finding an analytical relation between the loss and the conductor dimensions.
Zhu, Shimao; Wang, Wei; Wang, Yan; Yuan, Meijin; Yang, Kai
2013-10-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac83 is a baculovirus core gene whose function in the AcMNPV life cycle is unknown. In the present study, an ac83-knockout AcMNPV (vAc83KO) was constructed to investigate the function of ac83 through homologous recombination in Escherichia coli. No budded virions were produced in vAc83KO-transfected Sf9 cells, although viral DNA replication was unaffected. Electron microscopy revealed that nucleocapsid assembly was aborted due to the ac83 deletion. Domain-mapping studies revealed that the expression of Ac83 amino acid residues 451 to 600 partially rescued the ability of AcMNPV to produce infectious budded virions. Bioassays indicated that deletion of the chitin-binding domain of Ac83 resulted in the failure of oral infection of Trichoplusia ni larvae by AcMNPV, but AcMNPV remained infectious following intrahemocoelic injection, suggesting that the domain is involved in the binding of occlusion-derived virions to the peritrophic membrane and/or to other chitin-containing insect tissues. It has been demonstrated that Ac83 is the only component with a chitin-binding domain in the per os infectivity factor complex on the occlusion-derived virion envelope. Interestingly, a functional inner nuclear membrane sorting motif, which may facilitate the localization of Ac83 to the envelopes of occlusion-derived virions, was identified by immunofluorescence analysis. Taken together, these results demonstrate that Ac83 plays an important role in nucleocapsid assembly and the establishment of oral infection.
DEFF Research Database (Denmark)
Wang, Lei; Wang, Qiuliang; Wang, Hui
2016-01-01
A conduction-cooled split-gap superconducting magnet system with a center field of 8 T has been designed and fabricated in the Institute of Electrical Engineering, Chinese Academy of Sciences. The system consists of two Bi-2223/Ag coils and six NbTi coils. Due to a large aspect ratio of the high-...... in the second case. Hence, it is a good way to reduce the ac losses by changing the charging sequences of the Bi-2223/Ag and NbTi cols. Afterward, the calculated results are compared with the experimental data, and they show a good agreement.......A conduction-cooled split-gap superconducting magnet system with a center field of 8 T has been designed and fabricated in the Institute of Electrical Engineering, Chinese Academy of Sciences. The system consists of two Bi-2223/Ag coils and six NbTi coils. Due to a large aspect ratio of the high......-temperature superconducting tape, there will be large ac losses when the magnet is ramped up and down. An accurate estimation of the total ac losses in the high-temperature superconducting coils is essential for the cryogenic system design. In the Bi-2223/Ag coils, the total ac losses mainly originate from two parts: One...
Design and A.C. loss considerations for the 60 mm dipole magnet in the High Energy Booster
International Nuclear Information System (INIS)
Snitchler, G.; Jayakumar, R.; Kovachev, V.; Orrell, D.
1991-01-01
The baseline design for the SSC High Energy Booster (HEB) has dipole bending magnets with a 50 mm aperture. A recent dynamic aperture study for the High Energy Booster (HEB) suggests that an increased aperture dipole magnet (DM) is desirable. Two cost neutral options for a 60 mm aperture HEBDM design are investigated. Field transfer function, field harmonics, and relative cost impact for these designs are presented. An analysis of the cryogenic heat load due to A.C. losses generated in the HEB ramp cycle are also reported. Included in this analysis are losses from superconductor hysteresis, yoke hysteresis, strand eddy currents, and cable eddy currents. The A.C. loss impact of 2.5 μm vs. 6 μm filament conductor is presented. Superconducting proximity effect is also considered for 2.5 μm filament conductors
AC losses in Ag-sheathed Bi2223 tapes with Ca2CuO3 as interfilamentary resistive barriers
International Nuclear Information System (INIS)
Inada, R.; Iwata, Y.; Tateyama, K.; Nakamura, Y.; Oota, A.; Zhang, P.X.
2006-01-01
In this study, we prepared the Bi2223 multifilamentary tapes with Ca 2 CuO 3 as interfilamentary resistive barriers and evaluated their AC magnetization loss properties at 77 K. The Bi2223 tapes with thin barrier layers of Ca 2 CuO 3 around the filaments were prepared by using a standard powder-in-tube (PIT) method. To fabricate the Ca 2 CuO 3 layers around each filament, the outside surface of monocore Ag-sheathed wires was coated by Ca 2 CuO 3 with the slurry. After the heat treatment to decompose and evaporate the organic binder in the slurry, the several coated monocore wires were stacked and packed into another Ag-tube. Then, the packed tube was drawn and rolled into tape shape. The tape was subsequently sintered to form Bi2223 phase inside filaments. The AC magnetization losses in an AC transverse magnetic field were measured by a pick-up coil method. The loss properties in the barrier tape were compared with those in the tape without barriers. The results indicated that introducing Ca 2 CuO 3 barriers is very effective to suppress the electromagnetic coupling among the filaments and also to reduce the magnetization losses under parallel transverse field
Energy Technology Data Exchange (ETDEWEB)
Magnusson, N., E-mail: niklas.magnusson@sintef.no [SINTEF Energy Research, NO-7465 Trondheim (Norway); Abrahamsen, A.B. [DTU Wind Energy, Technical University of Denmark, DK-4000 Roskilde (Denmark); Liu, D. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands); Runde, M. [SINTEF Energy Research, NO-7465 Trondheim (Norway); Polinder, H. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands)
2014-11-15
Highlights: • A method for calculating hysteresis losses in the low AC – high DC magnetic field and transport current range has been shown. • The method can be used in the design of wind turbine generators for calculating the losses in the generator DC rotor. • First estimates indicate tolerable current ripple in the 0.1% range for a 4 T DC MgB{sub 2} generator rotor coil. - Abstract: MgB{sub 2} superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be evaluated in the design of the generator to ensure a sufficient overall efficiency. A major loss component is the hysteresis losses in the superconductor itself. In the high DC – low AC current and magnetic field region experimental results still lack for MgB{sub 2} conductors. In this article we reason towards a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting equations use the DC in-field critical current, the geometry of the superconductor and the magnitude of the AC magnetic field component as parameters. This simplified approach can be valuable in the design of MgB{sub 2} DC coils in the 1–4 T range with low AC magnetic field and current ripples.
Design and A.C. loss considerations for the 60 mm dipole magnet in the high energy booster
International Nuclear Information System (INIS)
Snitchler, G.; Jayakumar, R.; Kovachev, V.; Orrell, D.
1991-04-01
The baseline design for the SSC High Energy Booster (HEB) has dipole bending magnets with a 50 mm aperture. A recent dynamic aperture study for the High Energy Booster (HEB) suggests that an increased aperture dipole magnet (DM) is desirable. Two cost neutral options for a 60 mm aperture HEBDM design are investigated. Field transfer function, field harmonics, and relative cost impact for these designs are presented. An analysis of the cryogenic heat and load due to A.C. losses generated in the HEB ramp cycle are also reported. Included in this analysis are losses from superconductor hysteresis, yoke hysteresis, strand eddy currents, and cable eddy currents. The A.C. loss impact of 2.5 μm vs. 6 μm filament conductor will be presented. Superconducting proximity effect is also considered for 2.5 μm filament conductors. 13 refs., 3 figs., 7 tabs
Directory of Open Access Journals (Sweden)
Xuezhi Wan
2017-05-01
Full Text Available Rotational core loss of the silicon steel laminations are measured under elliptical rotating excitation. The core loss decomposition model is very important in magnetic core design, in which the decomposition coefficients are calculated through the measurement data. By using the transformation of trigonometric function, the elliptical rotational magnetic flux can be decomposed into two parts along two directions. It is assumed that the rotating core loss is the sum of alternating core losses along rolling and transverse directions. The magnetic strength vector H of non-grain oriented (NGO silicon steel 35WW270 along rolling and transverse directions is measured by a novel designed 3-D magnetic properties tester. Alternating core loss along the rolling, transverse directions and rotating core loss in the xoy-plane of this specimen in different frequencies such as 50 Hz, 100 Hz, and 200 Hz. Experimental results show that the core loss model is more accurate and useful to predict the total core loss.
Transport ac loss in a rectangular thin strip with power-law E(J) relation
International Nuclear Information System (INIS)
Li, Shuo; Chen, Du-Xing; Fan, Yu; Fang, Jin
2015-01-01
Highlights: • Transport ac loss in a thin strip with power-law E(J) is systematically computed. • The scaled results can be accurately used for strips with any critical current and frequency. • Experiments may be unambiguously compared with modeling results at a critical frequency. - Abstract: Transport ac losses of a rectangular thin strip obeying relation E/E c =(J/J c ) n with a fixed critical current I c and n=5,10,20,30, and 40 are accurately computed at a fixed frequency f as functions of the current amplitude I m . The results may be interpolated and scaled to those at any values of I c ,f, and 5⩽n⩽40. Normalized in the same way as that in Norris’ analytical formula derived from the critical-state model and converting f to a critical frequency f c , the modeling results may be better compared with the Norris formula and experimental data. A complete set of calculated modeling data are given with necessary formulas to be easily used by experimentalists in any particular case
AC loss time constant measurements on Nb3Al and NbTi multifilamentary superconductors
International Nuclear Information System (INIS)
Painter, T.A.
1988-03-01
The AC loss time constant is a previously univestigated property of Nb 3 Al, a superconductor which, with recent technological developments, shows some advantages over the more commonly used superconductors, NbTi and Nb 3 Sn. Four Nb 3 Al samples with varying twist pitches and one NbTi sample are inductively measured for their AC loss time constants. The measured time constants are compared to the theoretical time constant limits imposed by the limits of the transverse resistivity found by Carr [5] and to the theoretical time constants found using the Bean Model as well as to each other. The measured time constants of the Nb 3 Al samples fall approximately halfway between the theoretical time constant limits, and the measured time constants of the NbTi sample is close to the theoretical lower time constant limit. The Bean Model adequately accounts for the variance of the permeability of the Nb 3 Al superconductor in a background magnetic field. Finally, the measured time constant values of the Nb 3 Al samples vary approximately according to the square of their twist pitch. (author)
AC losses in superconductors: a multi-scale approach for the design of high current cables
International Nuclear Information System (INIS)
Escamez, Guillaume
2016-01-01
The work reported in this PhD deals with AC losses in superconducting material for large scale applications such as cables or magnets. Numerical models involving FEM or integral methods have been developed to solve the time transient electromagnetic distributions of field and current densities with the peculiarity of the superconducting constitutive E-J equation. Two main conductors have been investigated. First, REBCO superconductors for applications operating at 77 K are studied and a new architecture of conductor (round wires) for 3 kA cables. Secondly, for very high current cables, 3-D simulations on MgB_2 wires are built and solved using FEM modeling. The following chapter introduced new development used for the calculation of AC losses in DC cables with ripples. The thesis ends with the use of the developed numerical model on a practical example in the european BEST-PATHS project: a 10 kA MgB_2 demonstrator [fr
Low-Loss Hollow-Core Anti-Resonant Fibers With Semi-Circular Nested Tubes
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
Hollow-core fibers with a single ring of circular antiresonant tubes as the cladding provide a simple way of getting a negative-curvature hollow core, resulting in broadband low-loss transmission with little power overlap in the glass. These fibers show a significant improvement in loss performan...
7-cell core hollow-core photonic crystal fibers with low loss in the spectral region around 2 mu m
DEFF Research Database (Denmark)
Lyngsøe, Jens Kristian; Mangan, B.J.; Jakobsen, C.
2009-01-01
Several 7 cell core hollow-core photonic crystal fibers with bandgaps in the spectral range of 1.4 μm to 2.3 μm have been fabricated. The transmission loss follows the ≈ λ−3 dependency previously reported, with a minimum measured loss of 9.5 dB/km at 1.99 μm. One fiber with a transmission loss...... of 26 dB/km at 2.3 μm is reported, which is significantly lower than the transmission loss of solid silica fibers at this wavelength....
Flux Pinning and AC Loss in Second Generation High Temperature Superconductor Wires
Energy Technology Data Exchange (ETDEWEB)
Paranthaman, Mariappan Parans [ORNL; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2007-01-01
Major advances have been made in the last 18 years in high-temperature superconductor (HTS) reserach and development, resulting in increased use of HTS materials in commerical and pre-commercial electric-power applications. This new and important book addresses the issues related to flux pinning, AC losses and thick YBCO film growth. Written by top most scientists in the world, it presents the current status and issues related to YBCO coated conductors and the need for further fundamental materials science work in YBCO coated conductor. It will be a useful handbook for years to come.
Reduction of core loss in non-oriented (NO) electrical steel by electroless-plated magnetic coating
International Nuclear Information System (INIS)
Chivavibul, Pornthep; Enoki, Manabu; Konda, Shigeru; Inada, Yasushi; Tomizawa, Tamotsu; Toda, Akira
2011-01-01
An important issue in development of electrical steels for core-laminated products is to reduce core loss to improve energy conversion efficiency. This is usually obtained by tailoring the composition, microstructure, and texture of electrical steels themselves. A new technique to reduce core loss in electrical steel has been investigated. This technique involves electroless plating of magnetic thin coating onto the surface of electrical steel. The material system was electroless Ni-Co-P coatings with different thicknesses (1, 5, and 10 μm) deposited onto the surface of commercially available Fe-3% Si electrical steel. Characterization of deposited Ni-Co-P coating was carried out using X-ray diffraction (XRD), scanning electron microscope (SEM), and energy dispersive X-ray (EDX) spectrometer. The deposited Ni-Co-P coatings were amorphous and composed of 56-59% Ni, 32-35% Co, and 8-10% P by mass. The effect of coatings on core loss of the electrical steel was determined using single sheet test. A core loss reduction of 4% maximum was achieved with the Ni-Co-P coating of 1 μm thickness at 400 Hz and 0.3 T. - Research Highlights: → New approach to reduce core loss of electrical steel by magnetic coating. → Ni-Co-P coating influences core loss of NO electrical steel. → Core loss increases in RD direction but reduces in TD direction.
International Nuclear Information System (INIS)
Kovachev, V.T.
1980-01-01
ac losses P/sub L/ of bronze-processed (Nb/sub 0.99/Zr/sub 0.01/) 3 Sn strips have been measured between 4.2 and 16.5 K in the presence of a dc magnetic field H 0 . The measurements were performed using an electronic wattmeter with both ac and dc fields parallel to the long flat surfaces of the sample. A minimum in the function P/sub L/(H 0 ) was observed for fixed ac amplitudes h 0 . This minimum was found to occur in the entire temperature range between 4.2 and 16.5 K. A similar minimum was recently reported in Nb 3 Ge [Thompson et al., J. Appl. Phys. 50, 3514 (1979)] at 4.2 K. The position of the minimum is explained here by the same physical model as in Thompson et al. [J. Appl. Phys. 50, 3514 (1979)]; and Clem (ibid. 3518), but extending the model to include the temperature dependence of the entry surface shielding fields ΔH/sub en/(B,T) for flux density in the sample B=0. It is also shown here that loss minimum measurements can be used for the determination of ΔH/sub en/(0,T) in the temperature range 4.2--16.5 K
Prediction of high frequency core loss for electrical steel using the data provided by manufacturer
Energy Technology Data Exchange (ETDEWEB)
Roy, Rakesh [National Institute of Technology Meghalaya, Shillong (India); Dalal, Ankit; Kumar, Praveen [Indian Institute of Technology Guwahati, Assam (India)
2016-07-15
This paper describes a technique to determine the core loss data, at high frequencies, using the loss data provided by the lamination manufacturer. Steinmetz equation is used in this proposed method to determine core loss at high frequency. This Steinmetz equation consists of static hysteresis and eddy current loss. The presented technique considers the coefficients of Steinmetz equation as variable with frequency and peak magnetic flux density. The high frequency core loss data, predicted using this model is compared with the catalogue data given by manufacturer and very good accuracy has been obtained for a wide range of frequency. - Highlights: • A curve fitting algorithm is proposed to predict core loss at high frequency. • The loss data given by the steel manufacturers are used in curve fitting algorithm. • The algorithm is tested on nine different material’s data set given by the manufacturer.
Prediction of high frequency core loss for electrical steel using the data provided by manufacturer
International Nuclear Information System (INIS)
Roy, Rakesh; Dalal, Ankit; Kumar, Praveen
2016-01-01
This paper describes a technique to determine the core loss data, at high frequencies, using the loss data provided by the lamination manufacturer. Steinmetz equation is used in this proposed method to determine core loss at high frequency. This Steinmetz equation consists of static hysteresis and eddy current loss. The presented technique considers the coefficients of Steinmetz equation as variable with frequency and peak magnetic flux density. The high frequency core loss data, predicted using this model is compared with the catalogue data given by manufacturer and very good accuracy has been obtained for a wide range of frequency. - Highlights: • A curve fitting algorithm is proposed to predict core loss at high frequency. • The loss data given by the steel manufacturers are used in curve fitting algorithm. • The algorithm is tested on nine different material’s data set given by the manufacturer.
Xiang, Ying; Zhou, Meng-jie; Xu, Ming-Ya; Salamon, Péter; Éber, Nándor; Buka, Ágnes
2015-04-01
Electric-field-induced patterns of diverse morphology have been observed over a wide frequency range in a recently synthesized bent-core nematic (BCN) liquid crystal. At low frequencies (up to ∼25 Hz), the BCN exhibited unusual polarity-dependent patterns. When the amplitude of the ac field was enhanced, these two time-asymmetrical patterns turned into time-symmetrical prewavylike stripes. At ac frequencies in the middle-frequency range (∼50-3000 Hz), zigzag patterns were detected whose obliqueness varied with the frequency. Finally, if the frequency was increased above 3 kHz, the zigzag pattern was replaced by another, prewavylike pattern, whose threshold voltage depended on the frequency; however, the wave vector did not. For a more complete characterization, material parameters such as elastic constants, dielectric permittivities, and the anisotropy of the diamagnetic susceptibility were also determined.
Lithium-ion backup batteries for coping extended loss of AC power (ELAP)
International Nuclear Information System (INIS)
Chang, Choong-koo
2017-01-01
Per NRC Regulations Title 10, Code of Federal Regulations (CFR) 50.63 'Loss of all alternating current power' all Korean nuclear power plants have a coping capability for SBO conditions for a limited time ranging from approximately eight (8) to sixteen (16) hours. The 125V DC systems are designed for eight (8) hours range except Class 1E channel A and B 125V DC system of which duty cycle is 2 hours in APR1400. The strategies proposed by this paper for coping extended loss of AC power (ELAP) involve a three-phase approach. In the first extend class 1E batteries' backup time until 24 hours. Then augment class 1E batteries with Lithium-ion batteries by 72 hours from the event initiation. In addition, obtain additional capability and redundancy from off-site equipment until power systems are restored or commissioned. (author)
Evolution of beam losses after a power cut of the SR7 AC supply
GOMEZ ALONSO, A
2009-01-01
Magnet failures in the LHC could lead to equipment damage if the energy stored in the accelerator was not discharged properly. The Machine Protection Systems (MPS) ensure this proper discharge and knowledge about the evolution of losses in case of failure is needed to evaluate the adequacy of the protection. A power cut of the AC supply in SR7 would lead to a simultaneous current decay in three normal conducting circuits. The evolution of the losses after such failure is slow, with a loss time constant of more than 100 ms both at 450 GeV and 7 TeV, and in both cases the damage level is not reached before 45 ms. This leaves sufficient time for the MPS to ensure redundant protection. A similar scenario would be expected for a power cut at SR3.
Full-duplex transmission of IEEE 802.11ac-compliant MIMO WLAN signals over a 2-km 7-core fiber
Fan, Yuting; Li, Jianqiang; Lei, Yi; Tang, Ming; Yin, Feifei; Dai, Yitang; Xu, Kun
2017-01-01
In this Letter, we experimentally demonstrate a full-duplex transmission system of IEEE 802.11ac-compliant multiple-input multiple-output (MIMO) signals over a 2-km 7-core fiber for in-building wireless local-area network (WLAN) distributed antenna systems. For full-duplex 3 � 3 MIMO
Prediction of high frequency core loss for electrical steel using the data provided by manufacturer
Roy, Rakesh; Dalal, Ankit; Kumar, Praveen
2016-07-01
This paper describes a technique to determine the core loss data, at high frequencies, using the loss data provided by the lamination manufacturer. Steinmetz equation is used in this proposed method to determine core loss at high frequency. This Steinmetz equation consists of static hysteresis and eddy current loss. The presented technique considers the coefficients of Steinmetz equation as variable with frequency and peak magnetic flux density. The high frequency core loss data, predicted using this model is compared with the catalogue data given by manufacturer and very good accuracy has been obtained for a wide range of frequency.
Core-powered mass-loss and the radius distribution of small exoplanets
Ginzburg, Sivan; Schlichting, Hilke E.; Sari, Re'em
2018-05-01
Recent observations identify a valley in the radius distribution of small exoplanets, with planets in the range 1.5-2.0 R⊕ significantly less common than somewhat smaller or larger planets. This valley may suggest a bimodal population of rocky planets that are either engulfed by massive gas envelopes that significantly enlarge their radius, or do not have detectable atmospheres at all. One explanation of such a bimodal distribution is atmospheric erosion by high-energy stellar photons. We investigate an alternative mechanism: the luminosity of the cooling rocky core, which can completely erode light envelopes while preserving heavy ones, produces a deficit of intermediate sized planets. We evolve planetary populations that are derived from observations using a simple analytical prescription, accounting self-consistently for envelope accretion, cooling and mass-loss, and demonstrate that core-powered mass-loss naturally reproduces the observed radius distribution, regardless of the high-energy incident flux. Observations of planets around different stellar types may distinguish between photoevaporation, which is powered by the high-energy tail of the stellar radiation, and core-powered mass-loss, which depends on the bolometric flux through the planet's equilibrium temperature that sets both its cooling and mass-loss rates.
RBMK-1500 accident management for loss of long-term core cooling
International Nuclear Information System (INIS)
Uspuras, E.; Kaliatka, A.
2001-01-01
Results of the Level 1 probabilistic safety assessment of the Ignalina NPP has shown that in topography of the risk, transients dominate above the accidents with LOCAs and failure of the core long-term cooling are the main factors to frequency of the core damage. Previous analyses have shown, that after initial event, as a rule, the reactivity control, as well as short-term and intermediate cooling are provided. However, the acceptance criteria of the long-term cooling are not always carried out. It means that from this point of view the most dangerous accident scenarios are the scenarios related to loss of the core long-term cooling. On the other hand, the transition to the core condition due to loss of the long-term cooling specifies potential opportunities for the management of the accident consequences. Hence, accident management for the mitigation of the accident consequences should be considered and developed. The most likely initiating event, which probably leads to the loss of long term cooling accident, is station blackout. The station blackout is the loss of normal electrical power supply for local needs with an additional failure on start-up of all diesel generators. In the case of loss of electrical power supply MCPs, the circulating pumps of the service water system and MFWPs are switched-off. At the same time, TCV of both turbines are closed. Failure of diesel generators leads to the non-operability of the ECCS long-term cooling subsystem. It means the impossibility to feed MCC by water. The analysis of the station blackout for Ignalina NPP was performed using RELAP5 code. (author)
International Nuclear Information System (INIS)
Barrett, A.J.; Marquino, W.
2013-01-01
U.S. federal regulations require light water cooled nuclear power plants to cope with Station Blackout for a predetermined amount of time based on design factors for the plant. U.S. regulations define Station Blackout (SBO) as a loss of the offsite electric power system concurrent with turbine trip and unavailability of the onsite emergency AC power system. According to U.S. regulations, typically the coping period for an SBO is 4 hours and can be as long as 16 hours for currently operating BWR plants. Being able to cope with an SBO and loss of all AC power is required by international regulators as well. The U.S. licensing basis for the ESBWR is a coping period of 72 hours for an SBO based on U.S. NRC requirements for passive safety plants. In the event of an extended SBO (viz., greater than 72 hours), the ESBWR response shows that the design is able to cope with the event for at least 7 days without AC electrical power or operator action. ESBWR is a Generation III+ reactor design with an array of passive safety systems. The ESBWR primary success path for mitigation of an SBO event is the Isolation Condenser System (ICS). The ICS is a passive, closed loop, safety system that initiates automatically on a loss of power. Upon Station Blackout or loss of all AC power, the ICS begins removing decay heat from the Reactor Pressure Vessel (RPV) by (i) condensing the steam into water in heat exchangers located in pools of water above the containment, and (ii) transferring the decay heat to the atmosphere. The condensed water is then returned by gravity to cool the reactor again. The ICS alone is capable of maintaining the ESBWR in a safe shutdown condition after an SBO for an extended period. The fuel remains covered throughout the SBO event. The ICS is able to remove decay heat from the RPV for at least 7 days and maintains the reactor in a safe shutdown condition. The water level in the RPV remains well above the top of active fuel for the duration of the SBO event
Loss measurement and analysis for the prototype generator with HTS stator and permanent magnet rotor
Energy Technology Data Exchange (ETDEWEB)
Song, Peng, E-mail: songp10@mails.tsinghua.edu.cn [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China); Qu, Timing, E-mail: tmqu@mail.tsinghua.edu.cn [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China); Department of Mechanical Engineering, Tsinghua University, Key Laboratory for Advanced Materials Processing Technology, Ministry of Education, Beijing 100084 (China); Yu, Xiaoyu [Department of Mechanical Engineering, Tsinghua University, Key Laboratory for Advanced Materials Processing Technology, Ministry of Education, Beijing 100084 (China); Li, Longnian; Gu, Chen [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China); Li, Xiaohang [Innova Superconductor Technology Co., Ltd., Beijing 100084 (China); Wang, Dewen; Hu, Boping [Beijing Zhong Ke San Huan Hi-Tech Co., Ltd., Beijing 100084 (China); Chen, Duxing [Department Fis, University Autonoma Barcelona, Barcelona 08193 (Spain); Han, Zhenghe [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China)
2013-11-15
Highlights: •A novel prototype HTS generator with HTS armature windings was developed. •No-load loss and the iron loss at low temperature were measured. •The total loss at low temperature is much larger than the room temperature case. •The reason for no-load loss increment at low temperature is discussed. -- Abstract: A prototype HTS synchronous generator with a permanent magnet rotor and HTS armature windings was developed. The rated armature frequency is 10 Hz. The cryogenic Dewar is tightly surrounded outside the iron core. Both HTS coils and the iron core were cooled by using conduction cooling method. During the process of no-load running, the no-load loss power data were obtained through the torque measurement. The temperature evolution characteristics of the stator was measured by PT-100 temperature sensors. These results show that the no-load loss power at around 77 K are much larger than that at room temperature. The possible reason for the no-load loss increment is discussed. The ac loss power of one individual HTS coil used in this generator was also tested. Compared with the iron loss power, the ac loss power is rather small and could be neglected.
effect of number of rotor poles on ac losses of permanent magnet
African Journals Online (AJOL)
HOD
A study on permanent magnet (PM) eddy current and core losses of dual-stator PM machines is investigated in this paper. ... material in the retaining sleeves of surface-mounted ... rotor-pole numbers (13-poleand 14-pole in particular) ... Table 2: Optimized Machine Parameters. Number of rotor poles. 4. 5. 7. 8. 10. 11. 13. 14.
International Nuclear Information System (INIS)
Pe, T.; McDonald, J.; Clem, J.R.
1995-01-01
The voltage V ab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path C s through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path C s and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent ac loss (the time average of the product IV ab ) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) ac loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real ac losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit dimensions. Corresponding calculations also are presented for a sample of elliptical cross section
Application of response theory to steam venting during a loss of AC power transient
Energy Technology Data Exchange (ETDEWEB)
Cady, K.B.; Miller, R.J.
1987-05-01
We have applied the theory of response to the loss of AC power transient for an LMFBR design to determine the ultimate loss of coolant inventory and the sensitivity of this figure with respect to the initial conditions and input parameters. Using a simple four region heat transfer model, the analysis shows that 3717 kg coolant are vented after feed water is lost and before venting stops. The sensitivity analysis reveals that this figure is strongly dependent on design parameters and system assumptions. The uncertainty in the lost inventory caused by the uncertainties and correlations in the input parameters and initial conditions is found to be 3464 kg. We thus report the result of the calculation as lost inventory (kg)=3717+-3464 and conclude that the available inventory of 8775 kg is sufficient to ensure an adequate heat sink.
Low-loss single-mode hollow-core fiber with anisotropic anti-resonant elements
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
A hollow-core fiber using anisotropic anti-resonant tubes in thecladding is proposed for low loss and effectively single-mode guidance. We show that the loss performance and higher-order mode suppression is significantly improved by using symmetrically distributed anisotropic antiresonant tubes i...
AC losses in (Bi,Pb) 2Sr 2Ca 2Cu 3O x tapes
D'Anna, G.; Indenbom, M. V.; André, M.-O.; Benoit, W.; Grivel, J.-C.; Hensel, B.; Flükiger, R.
1994-05-01
A double peak structure is observed in the AC losses of (Bi,Pb) 2Sr 2Ca 2Cu 3O x silver-sheathed tapes using a torsion-pendulum oscillator. The low-temperature peak is associated to the intragrain flux expulsion, while the high-temperature peak results from a macroscopic current path around the whole sample due to a well-coupled fraction of the grains. The flux pinning by the dislocations forming small-angle grain boundaries is suggested to control the transport current.
International Nuclear Information System (INIS)
Ludwig, Frank; Heim, Erik; Schilling, Meinhard
2009-01-01
We have compared the structure parameters of magnetic core-shell nanoparticles determined from fluxgate magnetorelaxometry measurements applying the moment superposition model with the results from other methods. For the characterization of the magnetic cores, the nanoparticles are immobilized by freeze-drying. The core size distribution estimated for superparamagnetic Fe 3 O 4 magnetic nanoparticles (MNPs) with polyacrylic acid shell agrees well with that from transmission electron microscopy measurements. The distribution of hydrodynamic diameters of nanoparticle suspensions estimated from magnetorelaxometry measurements is in good agreement with that obtained from ac susceptibility and photon correlation spectroscopy measurements. Advantages of magnetorelaxometry compared to the other two integral techniques are that it is fast and the signal is less dominated by larger particles.
Energy Technology Data Exchange (ETDEWEB)
Alatawneh, Natheer, E-mail: natheer80@yahoo.com [Department of Mining and Materials Engineering, McGill University, QC H3A 0G4 (Canada); Rahman, Tanvir; Lowther, David A. [Department of Electrical and Computer Engineering, McGill University, QC H3A 0E9 (Canada); Chromik, Richard [Department of Mining and Materials Engineering, McGill University, QC H3A 0G4 (Canada)
2017-06-15
Highlights: • Develop a toroidal tester for magnetic measurements under compressive axial stress. • The shape of the toroidal ring has been verified using 3D stress analysis. • The developed design has been prototyped, and measurements were carried out. • Physical explanations for the core loss trend due to stress are provided. - Abstract: Electric machine cores are subjected to mechanical stresses due to manufacturing processes. These stresses include radial, circumferential and axial components that may have significant influences on the magnetic properties of the electrical steel and hence, on the output and efficiencies of electrical machines. Previously, most studies of iron losses due to mechanical stress have considered only radial and circumferential components. In this work, an improved toroidal tester has been designed and developed to measure the core losses and the magnetic properties of electrical steel under a compressive axial stress. The shape of the toroidal ring has been verified using 3D stress analysis. Also, 3D electromagnetic simulations show a uniform flux density distribution in the specimen with a variation of 0.03 T and a maximum average induction level of 1.5 T. The developed design has been prototyped, and measurements were carried out using a steel sample of grade 35WW300. Measurements show that applying small mechanical stresses normal to the sample thickness rises the delivered core losses, then the losses decrease continuously as the stress increases. However, the drop in core losses at high stresses does not go lower than the free-stress condition. Physical explanations for the observed trend of core losses as a function of stress are provided based on core loss separation to the hysteresis and eddy current loss components. The experimental results show that the effect of axial compressive stress on magnetic properties of electrical steel at high level of inductions becomes less pronounced.
International Nuclear Information System (INIS)
Nguyen, Doan N.; Ashworth, Stephen P.; Willis, Jeffrey O.
2009-01-01
In this paper we present a finite element model using the commercial COMSOL software package for calculating the ac loss in bifilar stacks of high temperature superconducting tape. In the model, the current-voltage relationship characterizing the superconducting properties is assumed to follow a power law. The calculations were performed for infinite bifilar stacks with different values of layer-to-layer separation D. With appropriate settings for the boundary conditions, the numerical results agree well with the analytical data obtained from a recently proposed model [J. R. Clem, Phys. Rev. B 77, 134506 (2008)]. The numerical approach was also used to investigate the end effects in a bifilar stack to answer the following question: how many layers away from the end of a stack are required before the environment of a given layer is identical to that in an infinite stack? We find that the answer to this question depends strongly on the value of D. Based on this study, a model for calculating the ac loss in bifilar noninductively wound coils with a finite number of turns is proposed
Size analysis of single-core magnetic nanoparticles
Energy Technology Data Exchange (ETDEWEB)
Ludwig, Frank, E-mail: f.ludwig@tu-bs.de [Institut für Elektrische Messtechnik und Grundlagen der Elektrotechnik, TU Braunschweig, Braunschweig (Germany); Balceris, Christoph; Viereck, Thilo [Institut für Elektrische Messtechnik und Grundlagen der Elektrotechnik, TU Braunschweig, Braunschweig (Germany); Posth, Oliver; Steinhoff, Uwe [Physikalisch-Technische Bundesanstalt, Berlin (Germany); Gavilan, Helena; Costo, Rocio [Instituto de Ciencia de Materiales de Madrid, ICMM/CSIC, Madrid (Spain); Zeng, Lunjie; Olsson, Eva [Department of Applied Physics, Chalmers University of Technology, Göteborg (Sweden); Jonasson, Christian; Johansson, Christer [ACREO Swedish ICT AB, Göteborg (Sweden)
2017-04-01
Single-core iron-oxide nanoparticles with nominal core diameters of 14 nm and 19 nm were analyzed with a variety of non-magnetic and magnetic analysis techniques, including transmission electron microscopy (TEM), dynamic light scattering (DLS), static magnetization vs. magnetic field (M-H) measurements, ac susceptibility (ACS) and magnetorelaxometry (MRX). From the experimental data, distributions of core and hydrodynamic sizes are derived. Except for TEM where a number-weighted distribution is directly obtained, models have to be applied in order to determine size distributions from the measurand. It was found that the mean core diameters determined from TEM, M-H, ACS and MRX measurements agree well although they are based on different models (Langevin function, Brownian and Néel relaxation times). Especially for the sample with large cores, particle interaction effects come into play, causing agglomerates which were detected in DLS, ACS and MRX measurements. We observed that the number and size of agglomerates can be minimized by sufficiently strong diluting the suspension. - Highlights: • Investigation of size parameters of single-core magnetic nanoparticles with nominal core diameters of 14 nm and 19 nm utilizing different magnetic and non-magnetic methods • Hydrodynamic size determined from ac susceptibility measurements is consistent with the DLS findings • Core size agrees determined from static magnetization curves, MRX and ACS data agrees with results from TEM although the estimation is based on different models (Langevin function, Brownian and Néel relaxation times).
Design of low-loss and highly birefringent hollow-core photonic crystal fiber
DEFF Research Database (Denmark)
Roberts, Peter John; Williams, D.P.; Sabert, H.
2006-01-01
A practical hollow-core photonic crystal fiber design suitable for attaining low-loss propagation is analyzed. The geometry involves a number of localized elliptical features positioned on the glass ring that surrounds the air core and separates the core and cladding regions. The size of each...... feature is tuned so that the composite core-surround geometry is antiresonant within the cladding band gap, thus minimizing the guided mode field intensity both within the fiber material and at material / air interfaces. A birefringent design, which involves a 2-fold symmetric arrangement of the features...
Extremely Low Loss THz Guidance Using Kagome Lattice Porous Core Photonic Crystal Fiber
DEFF Research Database (Denmark)
Hossain, Anwar; Hasanuzzaman, G.K.M.; Habib, Selim
2015-01-01
A novel porous core Kagome lattice photonic crystal fiber is proposed for extremely low loss THz waves guiding. It has been reported that 82.5% of bulk effective material loss of Topas can be reduced...
DEFF Research Database (Denmark)
Däumling, Manfred; Olsen, Søren Krüger; Rasmussen, Carsten
1998-01-01
be recorded using, for example, a digital oscilloscope. The amplitude decay of the periodic voltage or current accurately reflects the power loss in the system. It consists of two components-an ohmic purely exponential one (from leads, contacts, etc.), and a nonexponential component originating from......A simple way to obtain true ac losses with a resonant circuit containing a superconductor, using the decay of the circuit current, is described. For the measurement a capacitor is short circuited with a superconducting cable. Energy in the circuit is provided by either charging up the capacitors...... with a certain voltage, or letting a de flow in the superconductor. When the oscillations are started-either by opening a switch in case a de is flowing or by closing a switch to connect the charged capacitors with the superconductor-the current (via a Rogowski coil) or the voltage on the capacitor can...
Alatawneh, Natheer; Rahman, Tanvir; Lowther, David A.; Chromik, Richard
2017-06-01
Electric machine cores are subjected to mechanical stresses due to manufacturing processes. These stresses include radial, circumferential and axial components that may have significant influences on the magnetic properties of the electrical steel and hence, on the output and efficiencies of electrical machines. Previously, most studies of iron losses due to mechanical stress have considered only radial and circumferential components. In this work, an improved toroidal tester has been designed and developed to measure the core losses and the magnetic properties of electrical steel under a compressive axial stress. The shape of the toroidal ring has been verified using 3D stress analysis. Also, 3D electromagnetic simulations show a uniform flux density distribution in the specimen with a variation of 0.03 T and a maximum average induction level of 1.5 T. The developed design has been prototyped, and measurements were carried out using a steel sample of grade 35WW300. Measurements show that applying small mechanical stresses normal to the sample thickness rises the delivered core losses, then the losses decrease continuously as the stress increases. However, the drop in core losses at high stresses does not go lower than the free-stress condition. Physical explanations for the observed trend of core losses as a function of stress are provided based on core loss separation to the hysteresis and eddy current loss components. The experimental results show that the effect of axial compressive stress on magnetic properties of electrical steel at high level of inductions becomes less pronounced.
Low-loss hollow-core silica fibers with adjacent nested anti-resonant tubes
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2015-01-01
We report on numerical design optimization of hollow-core antiresonant fibers with the aim of reducing transmission losses. We show that re-arranging the nested anti-resonant tubes in the cladding to be adjacent has the effect of significantly reducing leakage as well as bending losses, and for r...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Ac losses of transposed superconductors
International Nuclear Information System (INIS)
Eckert, D.; Enderlein, G.; Lange, F.
1975-01-01
Eastham and Rhodes published results of loss measurements on transposed superconducting NbTi cables and concluded basing on an extrapolation to very large numbers of wires that transposed superconductors could be used favorably in cables for power transmission. There are some reasons to question the correctness of their extrapolation. Losses were calculated for transposed superconductors in self field and got results different from those of Eastham and Rhodes. Loss measurements were performed the results of which give evidence for the correctness of our calculations. The results lead to the conclusion that the use of transposed cables of irreversible type 2 superconductors for power transmission is not advantageous
International Nuclear Information System (INIS)
Vilaragut Llanes, J.J.; Valhuerdi Debesa, C.
1996-01-01
The loss offsite power is defined as the interruption of the preferred power supply to the essential and non essential switchgear buses necessitating or resulting in the use of emergency AC power supply. Because many safety system required for reactor core decay heat removal and containment heat removal depend on AC power, a loss of offsite power, if emergency power supply (diesel generators) fails, could be severe accidents The purpose of this work was to determine, for the Probabilistic Safety Assessment of the Juragua NPP, the causes, frequency and duration relationships of the loss of offsite power. A description is presented of the different factor that determine the occurrence of this event and the characteristics for the Juragua NPP
Study of AC Magnetic Properties and Core Losses of Fe/Fe3O4-epoxy Resin Soft Magnetic Composite
Laxminarayana, T. A.; Manna, Subhendu Kumar; Fernandes, B. G.; Venkataramani, N.
Soft Magnetic Composites (SMC) were prepared by coating of nanocrystalline Fe3O4 particles, synthesized by co-precipitation method, on atomized iron powder of particle size less than 53 μm in size using epoxy resin as a binder between iron and Fe3O4. Fe3O4 was chosen, for its high electric resistivity and suitable magnetic properties, to keep the coating layer magnetic and seek improvement to the magnetic properties of SMC. SEM images and XRD patterns were recorded in order to investigate the coatings on the surface of iron powder. A toroid was prepared by cold compaction of coated iron powder at 1050 MPa and subsequently cured at 150˚C for 1 hr in argon atmosphere. For comparison of properties, a toroid of uncoated iron powder was also compacted at 1050 MPa and annealed at 600˚C for 2 hr in argon atmosphere. The coated iron powder composite has a resistivity of greater than 200 μΩm, measured by four probe method. A comparison of Magnetic Hysteresis loops and core losses using B-H Loop tracer in the frequency range 0 to 1500 Hz on the coated and uncoated iron powder is reported.
Wang, Jiayi; Ren, Qiang; Luo, Yan; Zhang, Lifeng
2018-04-01
In the current study, the number density and size of non-metallic precipitates and the size of grains on the core loss of the 50W800 non-oriented electrical silicon steel sheets were investigated. The number density and size of precipitates and grains were statistically analyzed using an automatic scanning electron microscope (ASPEX) and an optical microscope. Hypothesis models were established to reveal the physical feature for the function of grain size and precipitates on the core loss of the steel. Most precipitates in the steel were AlN particles smaller than 1 μm so that were detrimental to the core loss of the steel. These finer AlN particles distributed on the surface of the steel sheet. The relationship between the number density of precipitates (x in number/mm2 steel area) and the core loss (P1.5/50 in W/kg) was regressed as P1.5/50 = 4.150 + 0.002 x. The average grain size was approximately 25-35 μm. The relationship between the core loss and grain size (d in μm) was P1.5/50 = 3.851 + 20.001 d-1 + 60.000 d-2.
Schmidt, F.
1980-11-01
The components of a superconducting 110 kV ac cable for power ratings or = 2000 MVA were developed. The cable design is of the semiflexible type, with a rigid cryogenic envelope containing a flexible hollow coaxial cable core. The cable core consists of spirally wound Nb-A1 composite wires electrically insulated by high pressure polyethylene tape wrappings. A 35 m long single phase test cable with full load terminals rated at 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of this cable design.
International Nuclear Information System (INIS)
Schmidt, F.
1980-01-01
The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de
Forni, F.; Shi, Y.; Van Den Boom, H.P.A.; Tangdiongga, E.; Koonen, A.M.J.
2017-01-01
We demonstrated the simultaneous transmission of multiband LTE-A signals, a WiFi IEEE802.11ac and a gigabit/s baseband 4-PAM signal over 1mm core diameter PMMA GI-POF. The optical link used a red light 650 nm laser diode and a p-i-n photodiode with a transimpedance amplifier. The 4-PAM transmission
Zhang, Yide (Inventor); Wang, Shihe (Inventor); Xiao, Danny (Inventor)
2004-01-01
A series of bulk-size magnetic/insulating nanostructured composite soft magnetic materials with significantly reduced core loss and its manufacturing technology. This insulator coated magnetic nanostructured composite is comprises a magnetic constituent, which contains one or more magnetic components, and an insulating constituent. The magnetic constituent is nanometer scale particles (1-100 nm) coated by a thin-layered insulating phase (continuous phase). While the intergrain interaction between the immediate neighboring magnetic nanoparticles separated by the insulating phase (or coupled nanoparticles) provide the desired soft magnetic properties, the insulating material provides the much demanded high resistivity which significantly reduces the eddy current loss. The resulting material is a high performance magnetic nanostructured composite with reduced core loss.
Anisotropic anti-resonant elements gives broadband single-mode low-loss hollow-core fibers
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
Hollow-core fibers with node-free anisotropic anti-resonant elements give broadband low-loss fibers that are also single-moded. At 1.06 μm silica-based fiber designs show higher-order-mode extinction-ratio >1000 and losses below 10 dB/km over a broad wavelength range....
Low loss mid-IR transmission bands using silica hollow-core anisotropic anti-resonant fibers
DEFF Research Database (Denmark)
Habib, Selim; Bang, Ole; Bache, Morten
2016-01-01
In this paper, a node-free anisotropic hollow-core anti-resonant fiber has been proposed to give low transmission loss in the near-IR to mid-IR spectral regime. The proposed silica-based fiber design shows transmission loss below 10 dB/km at 2.94 μm with multiple low loss transmission bands. Tran...
Frequency dependence of magnetic ac loss in a Roebel cable made of YBCO on a Ni-W substrate
Lakshmi, L. S.; Staines, M. P.; Badcock, R. A.; Long, N. J.; Majoros, M.; Collings, E. W.; Sumption, M. D.
2010-08-01
We have investigated the frequency dependent contributions to the magnetic ac loss in a 10 strand Roebel cable with 2 mm wide non-insulated strands and a transposition length of 90 mm. This cable is made from 40 mm wide YBCO coated conductor tape manufactured by AMSC and stabilized by electroplating 25 µm thick copper on either side prior to the mechanical punching of the cable strands. The measurements were carried out in both perpendicular and parallel field orientation, at frequencies in the range of 30-200 Hz. While the loss in the perpendicular orientation is predominantly hysteretic in nature, we observe some frequency dependence of the loss when the cable approaches full flux penetration at high field amplitudes. The magnitude is consistent with eddy current losses in the copper stabilization layer. This supports the fact that the inter-strand coupling loss is not significant in this frequency range. In the parallel field orientation, the hysteresis loss in the Ni-W alloy substrate dominates, but we see an unusually strong frequency dependent contribution to the loss which we attribute to intra-strand current loops.
Emergency core cooling system sump chemical effects on strainer head loss
International Nuclear Information System (INIS)
Edwards, M.K.; Qiu, L.; Guzonas, D.A.
2010-01-01
Chemical precipitates formed in the recovery water following a Loss of Coolant Accident (LOCA) have the potential to increase head loss across the Emergency Core Cooling System (ECCS) strainer, and could lead to cavitation of the ECCS pumps, pump failure and loss of core cooling. AECL, as a strainer vendor and research organization, has been involved in the investigation of chemical effects on head loss for its CANDU® and Pressurized Water Reactor (PWR) customers. The chemical constituents of the recovery sump water depend on the combination of chemistry control additives and the corrosion and dissolution products from metals, concrete, and insulation materials. Some of these dissolution and corrosion products (e.g., aluminum and calcium) may form significant quantities of precipitates. The presence of chemistry control additives such as sodium hydroxide, trisodium phosphate and boric acid can significantly influence the precipitates formed. While a number of compounds may be shown to be thermodynamically possible under the conditions assumed for precipitation, kinetic factors play a large role in the morphology of precipitates. Precipitation is also influenced by insulation debris, which can trap precipitates and act as nucleation sites for heterogeneous precipitation. This paper outlines the AECL approach to resolving the issue of chemical effects on ECCS strainer head loss, which included modeling, bench top testing and reduced-scale testing; the latter conducted using a temperature-controlled variable-flow closed-loop test rig that included an AECL Finned Strainer® test section equipped with a differential pressure transmitter. Models of corrosion product release and the effects of precipitates on head loss will also be presented. Finally, this paper discusses the precipitates found in test debris beds and presents a possible method for chemical effects head loss modeling. (author)
International Nuclear Information System (INIS)
Parsapour, Amir; Dehkordi, Behzad Mirzaeian; Moallem, Mehdi
2015-01-01
In applications in which the high torque per ampere at low speed and rated power at high speed are required, the continuous current method is the best solution. However, there is no report on calculating the core loss of SRM in continuous current mode of operation. Efficiency and iron loss calculation which are complex tasks in case of conventional mode of operation is even more involved in continuous current mode of operation. In this paper, the Switched Reluctance Motor (SRM) is modeled using finite element method and core loss and copper loss of SRM in discontinuous and continuous current modes of operation are calculated using improved analytical techniques to include the minor loop losses in continuous current mode of operation. Motor efficiency versus speed in both operation modes is obtained and compared. - Highlights: • Continuous current method for Switched Reluctance Motor (SRM) is explained. • An improved analytical technique is presented for SRM core loss calculation. • SRM losses in discontinuous and continuous current operation modes are presented. • Effect of mutual inductances on SRM performance is investigated
Energy Technology Data Exchange (ETDEWEB)
Parsapour, Amir, E-mail: amirparsapour@gmail.com [Department of Electrical Engineering, University of Isfahan, Isfahan (Iran, Islamic Republic of); Dehkordi, Behzad Mirzaeian, E-mail: mirzaeian@eng.ui.ac.ir [Department of Electrical Engineering, University of Isfahan, Isfahan (Iran, Islamic Republic of); Moallem, Mehdi, E-mail: moallem@cc.iut.ac.ir [Department of Electrical Engineering, Isfahan University of Technology, Isfahan (Iran, Islamic Republic of)
2015-03-15
In applications in which the high torque per ampere at low speed and rated power at high speed are required, the continuous current method is the best solution. However, there is no report on calculating the core loss of SRM in continuous current mode of operation. Efficiency and iron loss calculation which are complex tasks in case of conventional mode of operation is even more involved in continuous current mode of operation. In this paper, the Switched Reluctance Motor (SRM) is modeled using finite element method and core loss and copper loss of SRM in discontinuous and continuous current modes of operation are calculated using improved analytical techniques to include the minor loop losses in continuous current mode of operation. Motor efficiency versus speed in both operation modes is obtained and compared. - Highlights: • Continuous current method for Switched Reluctance Motor (SRM) is explained. • An improved analytical technique is presented for SRM core loss calculation. • SRM losses in discontinuous and continuous current operation modes are presented. • Effect of mutual inductances on SRM performance is investigated.
First AC loss test and analysis of a Bi2212 cable-in-conduit conductor for fusion application
Qin, Jinggang; Shi, Yi; Wu, Yu; Li, Jiangang; Wang, Qiuliang; He, Yuxiang; Dai, Chao; Liu, Fang; Liu, Huajun; Mao, Zhehua; Nijhuis, Arend; Zhou, Chao; Devred, Arnaud
2018-01-01
The main goal of the Chinese fusion engineering test reactor (CFETR) is to build a fusion engineering tokamak reactor with a fusion power of 50-200 MW, and plan to test the breeding tritium during the fusion reaction. This may require a maximum magnetic field of the central solenoid and toroidal field coils up to 15 T. New magnet technologies should be developed for the next generation of fusion reactors with higher requirements. Bi2Sr2CaCu2Ox (Bi2212) is considered as a potential and promising superconductor for the magnets in the CFETR. R&D activities are ongoing at the Institute of Plasma Physics, Chinese Academy of Sciences for demonstration of the feasibility of a CICC based on Bi2212 round wire. One sub-size conductor cabled with 42 wires was designed, manufactured and tested with limited strand indentation during cabling and good transport performance. In this paper, the first test results and analysis on the AC loss of Bi2212 round wires and cabled conductor samples are presented. Furthermore, the impact of mechanical load on the AC loss of the sub-size conductor is investigated to represent the operation conditions with electromagnetic loads. The first tests provide an essential basis for the validation of Bi2212 CICC and its application in fusion magnets.
DEFF Research Database (Denmark)
Pittini, Riccardo; Zhang, Zhe; Ouyang, Ziwei
2012-01-01
on winding resistance and leakage inductances which represent the main concerns related to low-voltage high-current applications. The PCB winding design has a one to one turn ratio with no interleaving between primary and secondary windings. The main goal was to determine if ER planar core could provide...... a significant advantage in terms of winding losses compared to planar E cores. Results from finite element analysis highlight that low frequency winding resistance is lower for the ER core since it is dominated by the lower mean turn length however, as the AC-resistance becomes dominating the winding eddy...... more realistic results when computing the winding AC-resistance....
Zhang, Naiqian; Wang, Zefeng; Xi, Xiaoming
2017-10-01
In this paper, we demonstrate a novel method for the low-loss coupling between solid-core multi-mode fibers (MMFs) and anti-resonant hollow-core fibers (AR-HCFs). The core/cladding diameter of the MMF is 50/125μm and the mode field diameter of the AR-HCFs are 33.3μm and 71.2μm of the ice-cream type AR-HCFs and the non-node type ARHCFs, respectively. In order to match the mode field diameters of these two specific AR-HCFs, the mode field diameter of the MMFs is increased or decreased by up-tapering or down-tapering the MMFs. Then, according to the principle of coupled fiber mode matching, the optimal diameter of tapered fiber for low-loss coupling is calculated. Based on beam propagation method, the calculated coupling losses without tapering process are 0.31dB and 0.89dB, respectively for a MMF-HCF-MMF structure of the ice-cream type AR-HCFs and the non-node type AR-HCFs. These values can be reduced to 0.096dB and 0.047dB when the outer diameters of the MMF are down-tapered to 116μm and up-tapered to 269μm, respectively. What's more, these results can also be verified by existing experiments.
DEFF Research Database (Denmark)
Magnusson, N.; Abrahamsen, Asger Bech; Liu, Dawei
2014-01-01
MgB2 superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must...... a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting...
Loss-of-Fluid Test findings in pressurized water reactor core's thermal-hydraulic behavior
International Nuclear Information System (INIS)
Russell, M.
1983-01-01
This paper summarizes the pressurized water reactor (PWR) core's thermal-hydraulic behavior findings from experiments performed at the Loss-of-Fluid Test (LOFT) Facility at the Idaho National Engineering Laboratory. The potential impact of these findings on the safety and economics of PWR's generation of electricity is also discussed. Reviews of eight important findings in the core's physical behavior and in experimental methods are presented with supporting evidence
DEFF Research Database (Denmark)
Olsen, Søren Krüger; Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten
1999-01-01
The ac loss of a superconducting cable conductor carrying an ac current is small. Therefore the ratio between the inductive (out-of-phase) and the resistive (in-phase) voltages over the conductor is correspondingly high. In vectorial representations this results in phase angles between the current......-in amplifiers can be exploited. In this paper we present the results from ac-loss measurements on a low loss 10 metre long high temperature superconducting cable conductor using such a correction scheme. Measurements were carried out with and without a compensation circuit that could reduce-the inductive...... voltage. The 1 mu V cm(-1) critical current of the conductor was 3240 A at 77 K. At an rms current of 2 kA (50 Hz) the ac loss was derived to be 0.6 +/- 0.15 W m(-1). This is, to the best of our knowledge, the lowest value of ac loss of a high temperature superconducting cable conductor reported so far...
2-µm wavelength-range low-loss inhibited-coupling hollow-core PCF
Maurel, M.; Chafer, M.; Delahaye, F.; Amrani, F.; Debord, B.; Gerome, F.; Benabid, F.
2018-02-01
We report on the design and fabrication of inhibited-coupling guiding hollow-core photonic crystal fiber with a transmission band optimized for low loss guidance around 2 μm. Two fibers design based on a Kagome-lattice cladding have been studied to demonstrate a minimum loss figure of 25 dB/km at 2 μm associated to an ultra-broad transmission band spanning from the visible to our detection limit of 3.4 μm. Such fibers could be an excellent tool to deliver and compress ultra-short pulse laser systems, especially for the emerging 2-3 μm spectral region.
The influence of losses in the core of an inductor on characteristics of the boost converter
International Nuclear Information System (INIS)
Górecki, Krzysztof; Detka, Kalina
2016-01-01
In the paper the influence of core losses on characteristics of the boost converter is considered. In calculations, the average electrothermal models of the diode-transistor switch and of the inductor are used. The applied electrothermal models and the obtained results of calculations are presented. The selected results of calculations are compared with the results of measurements. The influence of such factors as converter load resistance and frequency of the control signal and lossiness of the core on characteristics of the considered converter and the loss of energy in the inductor are discussed
Effect of steam corrosion on core post strength loss: I. Low, chronic steam ingress rates
International Nuclear Information System (INIS)
Wichner, R.P.
1976-10-01
The purpose of the study was to assess the effect of chronic, low levels of steam ingress into the primary system of the HTGR on the corrosion, and consequent strength loss of the core support posts. The assessment proceeded through the following three steps: (1) The impurity composition in the primary system was estimated as a function of a range of steady ingress rates of from 0.001 to 1.0 g/sec, both by means of an analysis of the Dragon steam ingress experiment and a computer code, TIMOX, which treats the primary system as a well-mixed pot. (2) The core post burnoffs which result from 40-year exposures to these determined impurity atmospheres were then estimated using a corrosion rate expression derived from published ATJ-graphite corrosion rate data. Burnoffs were determined for both the core posts at the nominal and the maximum sustained temperature, estimated to be 90 0 C above nominal. (3) The final step involved assessment of the degree of strength loss resulting from the estimated burnoffs. An empirical equation was developed for this purpose which compares reasonably well with strength loss data for a number of different graphites and specimen geometries
AC application of second generation HTS wire
Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.
2008-02-01
For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.
Single stage buck-boost DC-AC neutral point clamped inverter
DEFF Research Database (Denmark)
Mo, Wei; Loh, Poh Chiang; Andrew, A.
2012-01-01
This paper proposes a new single stage buck-boost DC-AC neutral point clamped inverter topology which integrates the cascaded configurations of recently introduced inductor-capacitor-capacitor-transformer impedance source network (by Adamowicz) and classic NPC configuration. As a consequence......, it has enhanced buck-boost functionality and low output voltage distortions compared to the traditional Z-source inverter; it has continuous input current which reduces the source stress and inverter noise; it also contains two built-in capacitors which can block the DC current in the transformer...... windings thus preventing the core from saturation; lowers the voltage stresses and power losses of inverter switches and reduces the sizes of filtering devices and as well as obtains better output performance compared to the original two-level Z-source inverters. A phase disposition pulse width modulation...
Energy Technology Data Exchange (ETDEWEB)
Yuan Weijia; Campbell, A M; Hong, Z; Ainslie, M D; Coombs, T A, E-mail: wy215@cam.ac.u [Electronic, Power and Energy Conversion Group, Electrical Engineering Division, Engineering Department, University of Cambridge, Cambridge CB3 0FA (United Kingdom)
2010-08-15
A model is presented for calculating the AC losses, magnetic field/current density distribution and critical currents of a circular superconducting pancake coil. The assumption is that the magnetic flux lines will lie parallel to the wide faces of tapes in the unpenetrated area of the coil. Instead of using an infinitely long stack to approximate the circular coil, this paper gives an exact circular coil model using elliptic integrals. A new efficient numerical method is introduced to yield more accurate and fast computation. The computation results are in good agreement with the assumptions. For a small value of the coil radius, there is an asymmetry along the coil radius direction. As the coil radius increases, this asymmetry will gradually decrease, and the AC losses and penetration depth will increase, but the critical current will decrease. We find that if the internal radius is equal to the winding thickness, the infinitely long stack approximation overestimates the loss by 10% and even if the internal radius is reduced to zero, the error is still only 60%. The infinitely long stack approximation is therefore adequate for most practical purposes. In addition, the comparison result shows that the infinitely long stack approximation saves computation time significantly.
Core dynamics analysis for reactivity insertion and loss of coolant flow tests using the HTTR
International Nuclear Information System (INIS)
Takamatsu, Kuniyoshi; Nakagawa, Shigeaki; Takeda, Tetsuaki
2007-01-01
The High Temperature engineering Test Reactor (HTTR) is a graphite-moderated and a gas-cooled reactor with a thermal power of 30 MW and a reactor outlet coolant temperature of 950degC (SAITO, 1994). Safety demonstration tests using the HTTR are in progress to verify its inherent safety features and improve the safety technology and design methodology for High-Temperature Gas-cooled Reactors (HTGRs) (TACHIBANA 2002) (NAKAGAWA 2004). The reactivity insertion test is one of the safety demonstration tests for the HTTR. This test simulates the rapid increase in the reactor power by withdrawing the control rod without operating the reactor power control system. In addition, the loss of coolant flow tests has been conducted to simulate the rapid decrease in the reactor power by tripping one, two or all out of three gas circulators. The experimental results have revealed the inherent safety features of HTGRs, such as the negative reactivity feedback effect. The numerical analysis code, which was named ACCORD (TAKAMATSU 2006), was developed to analyze the reactor dynamics including the flow behavior in the HTTR core. We used a conventional method, namely, a one-dimensional flow channel model and reactor kinetics model with a single temperature coefficient, taking into account the temperature changes in the core. However, a slight difference between the analytical and experimental results was observed. Therefore, we have modified this code to use a model with four parallel channels and twenty temperature coefficients in the core. Furthermore, we added another analytical model of the core for calculating the heat conduction between the fuel channels and the core in the case of the loss of coolant flow tests. This paper describes the validation results for the newly developed code using the experimental results of the reactivity insertion test as well as the loss of coolant flow tests by tripping one or two out of three gas circulators. Finally, the pre-analytical result of
Healy, Noel; Fokine, Michael; Franz, Yohann; Hawkins, Thomas; Jones, Maxwell; Ballato, John; Peacock, Anna C.; Gibson, Ursula J.
2016-01-01
Reduced losses in silicon-core fibers are obtained using CO2 laser directional recrystallization of the core. Single crystals with aspect ratios up to 1500:1 are reported, limited by the scan range of the equipment. This processing technique holds promise for bringing crystalline silicon-core fibers to a central role in nonlinear optics and signal processing applications.
Analysis of forces on core structures during a loss-of-coolant accident. Final report
International Nuclear Information System (INIS)
Griggs, D.P.; Vilim, R.B.; Wang, C.H.; Meyer, J.E.
1980-08-01
There are several design requirements related to the emergency core cooling which would follow a hypothetical loss-of-coolant accident (LOCA). One of these requirements is that the core must retain a coolable geometry throughout the accident. A possible cause of core damage leading to an uncoolable geometry is the action of forces on the core and associated support structures during the very early (blowdown) stage of the LOCA. An equally unsatisfactory design result would occur if calculated deformations and failures were so extensive that the geometry used for calculating the next stages of the LOCA (refill and reflood) could not be known reasonably well. Subsidiary questions involve damage preventing the operation of control assemblies and loss of integrity of other needed safety systems. A reliable method of calculating these forces is therefore an important part of LOCA analysis. These concerns provided the motivation for the study. The general objective of the study was to review the state-of-the-art in LOCA force determination. Specific objectives were: (1) determine state-of-the-art by reviewing current (and projected near future) techniques for LOCA force determination, and (2) consider each of the major assumptions involved in force determination and make a qualitative assessment of their validity
Study of dielectric relaxation and AC conductivity of InP:S single crystal
El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.
2012-07-01
The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.
Low loss hollow-core waveguide on a silicon substrate
Yang, Weijian; Ferrara, James; Grutter, Karen; Yeh, Anthony; Chase, Chris; Yue, Yang; Willner, Alan E.; Wu, Ming C.; Chang-Hasnain, Connie J.
2012-07-01
Optical-fiber-based, hollow-core waveguides (HCWs) have opened up many new applications in laser surgery, gas sensors, and non-linear optics. Chip-scale HCWs are desirable because they are compact, light-weight and can be integrated with other devices into systems-on-a-chip. However, their progress has been hindered by the lack of a low loss waveguide architecture. Here, a completely new waveguiding concept is demonstrated using two planar, parallel, silicon-on-insulator wafers with high-contrast subwavelength gratings to reflect light in-between. We report a record low optical loss of 0.37 dB/cm for a 9-μm waveguide, mode-matched to a single mode fiber. Two-dimensional light confinement is experimentally realized without sidewalls in the HCWs, which is promising for ultrafast sensing response with nearly instantaneous flow of gases or fluids. This unique waveguide geometry establishes an entirely new scheme for low-cost chip-scale sensor arrays and lab-on-a-chip applications.
Broadband magnetic losses of nanocrystalline ribbons and powder cores
Energy Technology Data Exchange (ETDEWEB)
Beatrice, Cinzia, E-mail: c.beatrice@inrim.it [Istituto Nazionale di Ricerca Metrologica, Nanoscience and Materials Division, Torino (Italy); Dobák, Samuel [Institute of Physics, Faculty of Science, P.J. Šafárik University, Košice (Slovakia); Ferrara, Enzo; Fiorillo, Fausto [Istituto Nazionale di Ricerca Metrologica, Nanoscience and Materials Division, Torino (Italy); Ragusa, Carlo [Politecnico di Torino, Energy Department, Torino (Italy); Füzer, Ján; Kollár, Peter [Institute of Physics, Faculty of Science, P.J. Šafárik University, Košice (Slovakia)
2016-12-15
Finemet type alloys have been investigated from DC to 1 GHz at different induction levels upon different treatments: as amorphous precursors, as ribbons nanocrystallized with and without an applied saturating field, as consolidated powders. The lowest energy losses at all frequencies and maximum Snoek's product are exhibited by the transversally field-annealed ribbons. This is understood in terms of rotation-dominated magnetization process in the low-anisotropy material. Intergrain eddy currents are responsible for the fast increase of the losses with frequency and for early permeability relaxation of the powder cores. Evidence for resonant phenomena at high frequencies and for the ensuing inadequate role of the static magnetic constitutive equation of the material in solving the magnetization dynamics via the Maxwell's diffusion equation of the electromagnetic field is provided. It is demonstrated that, by taking the Landau–Lifshitz–Gilbert equation as a constitutive relation, the excellent frequency response of the transverse anisotropy ribbons can be described by analytical method.
Sound Transmission Loss Through a Corrugated-Core Sandwich Panel with Integrated Acoustic Resonators
Schiller, Noah H.; Allen, Albert R.; Zalewski, Bart F; Beck, Benjamin S.
2014-01-01
The goal of this study is to better understand the effect of structurally integrated resonators on the transmission loss of a sandwich panel. The sandwich panel has facesheets over a corrugated core, which creates long aligned chambers that run parallel to the facesheets. When ports are introduced through the facesheet, the long chambers within the core can be used as low-frequency acoustic resonators. By integrating the resonators within the structure they contribute to the static load bearing capability of the panel while also attenuating noise. An analytical model of a panel with embedded resonators is derived and compared with numerical simulations. Predictions show that acoustic resonators can significantly improve the transmission loss of the sandwich panel around the natural frequency of the resonators. In one configuration with 0.813 m long internal chambers, the diffuse field transmission loss is improved by more than 22 dB around 104 Hz. The benefit is achieved with no added mass or volume relative to the baseline structure. The embedded resonators are effective because they radiate sound out-of-phase with the structure. This results in destructive interference, which leads to less transmitted sound power.
International Nuclear Information System (INIS)
Nakahata, Masaaki; Amemiya, Naoyuki
2008-01-01
Two-dimensional electromagnetic field analyses were undertaken using two representative cross sections of two-layer cables consisting of coated conductors with magnetic and non-magnetic substrates. The following two arrangements were used for the coated conductors between the inner and outer layers: (1) tape-on-tape and (2) alternate. The calculated magnetic flux profile around each coated conductor was visualized. In the case of the non-magnetic substrate, the magnetic field to which coated conductors in the outer layer are exposed contains more perpendicular component to the conductor wide face (perpendicular field component) when compared to that in the inner layer. On the other hand, for the tape-on-tape arrangement of coated conductors with a magnetic substrate, the reverse is true. In the case of the alternate arrangement of the coated conductor with a magnetic substrate, the magnetic field to which the coated conductors in the inner and outer layers are exposed experiences a small perpendicular field component. When using a non-magnetic substrate, the AC loss in the superconductor layer of the coated conductors in the two-layer cables is dominated by that in the outer layer, whereas the reverse is true in the case of a magnetic substrate. When comparing the AC losses in superconductor layers of coated conductors with non-magnetic and magnetic substrates in two-layer cables, the latter is larger than the former, but the influence of the magnetism of substrates on AC losses in superconductor layers is not remarkable
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
An investigation of core liquid level depression in small break loss-of-coolant accidents
International Nuclear Information System (INIS)
Schultz, R.R.; Watkins, J.C.; Motley, F.E.; Stumpf, H.; Chen, Y.S.
1991-08-01
Core liquid level depression can result in partial core dryout and heatup early in a small break loss-of-coolant accident (SBLOCA) transient. Such behavior occurs when steam, trapped in the upper regions of the reactor primary system (between the loop seal and the core inventory), moves coolant out of the core region and uncovers the rod upper elevations. The net result is core liquid level depression. Core liquid level depression and subsequent core heatups are investigated using subscale data from the ROSA-IV Program's 1/48-scale Large Scale Test Facility (LSTF) and the 1/1705-scale Semiscale facility. Both facilities are Westinghouse-type, four-loop, pressurized water reactor simulators. The depression phenomena and factors which influence the minimum core level are described and illustrated using examples from the data. Analyses of the subject experiments, conducted using the TRAC-PF1/MOD1 (Version 12.7) thermal-hydraulic code, are also described and summarized. Finally, the response of a typical Westinghouse four-loop plant (RESAR-3S) was calculated to qualitatively study coal liquid level depression in a full-scale system. 31 refs., 37 figs., 6 tabs
Energy Technology Data Exchange (ETDEWEB)
Li, Junnan, E-mail: junnanli1991@163.com, E-mail: rzhgong@hust.edu.cn; Wang, Xian; Xu, Xiaojun; Gong, Rongzhou, E-mail: junnanli1991@163.com, E-mail: rzhgong@hust.edu.cn; Feng, Zekun [School of Optical and Electronic Information, Huazhong University of Science and Technology, Wuhan 430074 (China); Chen, Yajie; Harris, V. G. [Department of Electrical and Computer Engineering, Center for Microwave Magnetic Materials and Integrated Circuits, Northeastern University, Boston, Massachusetts 02115 (United States)
2015-05-07
Fe-6.5%Si alloy powders coated with manganese oxides using an innovative in situ process were investigated. The in-situ coating of the insulating oxides was realized with a KMnO{sub 4} solution by a chemical process. The insulating manganese oxides with mixed valance state were verified by X-ray photoelectron spectroscopy analysis. The thickness of the insulating layer on alloy particles was determined to be in a range of 20–210 nm, depending upon the KMnO{sub 4} concentration. The powder core loss and the change in permeability under a DC-bias field were measured at frequencies ranging from 50 to 100 kHz. The experiments indicated that the Fe-6.5%Si powder cores with a 210 nm-thick manganese oxide layer not only showed a low core loss of 459 mW/cm{sup 3} at 100 kHz but also showed a small reduction in permeability (μ(H)/μ(0) = 85% for μ = 42) at a DC-bias field of 80 Oe. This work has defined a novel pathway to realizing low core loss and field-insensitive permeability for Fe-Si powder cores.
The HST/ACS Coma Cluster Survey : II. Data Description and Source Catalogs
Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Chiboucas, Kristin; Davies, Jonathan I.; del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.; Huxor, Avon; Jenkins, Leigh; Karick, Arna; Khosroshahi, Habib; Kourkchi, Ehsan; Komiyama, Yutaka; Lotz, Jennifer; Marzke, Ronald O.; Marinova, Irina; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mobasher, Bahram; Mouhcine, Mustapha; Okamura, Sadanori; Percival, Sue; Phillipps, Steven; Poggianti, Bianca M.; Price, James; Sharples, Ray M.; Tully, R. Brent; Valentijn, Edwin
The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ~50% of the core high-density region in
International Nuclear Information System (INIS)
Krueger Olsen, S.; Kuehle, A.; Traeholt, C.; C Rasmussen, C.; Toennesen, O.; Daeumling, M.; Rasmussen, C.N.; Willen, D.W.A.
1999-01-01
The ac loss of a superconducting cable conductor carrying an ac current is small. Therefore the ratio between the inductive (out-of-phase) and the resistive (in-phase) voltages over the conductor is correspondingly high. In vectorial representations this results in phase angles between the current and the voltage over the cable close to 90 degrees. This has the effect that the loss cannot be derived directly using most commercial lock-in amplifiers due to their limited absolute accuracy. However, by using two lock-in amplifiers and an appropriate correction scheme the high relative accuracy of such lock-in amplifiers can be exploited. In this paper we present the results from ac-loss measurements on a low loss 10 metre long high temperature superconducting cable conductor using such a correction scheme. Measurements were carried out with and without a compensation circuit that could reduce the inductive voltage. The 1 μV cm -1 critical current of the conductor was 3240 A at 77 K. At an rms current of 2 kA (50 Hz) the ac loss was derived to be 0.6±0.15 W m -1 . This is, to the best of our knowledge, the lowest value of ac loss of a high temperature superconducting cable conductor reported so far at these high currents. (author)
Analysis of the loss of coolant accident for LEU cores of Pakistan research reactor-1
International Nuclear Information System (INIS)
Khan, L.A.; Bokhari, I.H.; Raza, S.H.
1993-12-01
Response of LEU cores for PARR-1 to a Loss of Coolant Accident (LOCA) has been studied. It has been assumed that pool water drains out to double ended rupture of primary coolant pipe or complete shearing of an experimental beam tube. Results show that for an operating power level of 10 MW, both the first high power and equilibrium cores would enter into melting conditions if the pool drain time is less than 22 h and 11 h respectively. However, an Emergency Core Cooling System (ECCS) capable of spraying the core at flow rate of 8.3 m/sup 3/h, for the above mentioned duration, would keep the peak core temperature much below the critical value. Maximum operating power levels below which melting would not occur have been assessed to 3.4 MW and 4.8 MW, respectively, for the first high power and equilibrium cores. (author) 5 figs
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
DEFF Research Database (Denmark)
Lyngsøe, Jens Kristian; Mangan, Brian Joseph; Jakobsen, C.
2009-01-01
Five 7-cell core hollow-core fibers with photonic bandgap spectral positions between 1.4 μm and 2.3 μm were fabricated. The loss follows the ≈ λ-3 dependency previously reported [1] with a minimum measured loss of 9.5 dB/km at 1992 nm.......Five 7-cell core hollow-core fibers with photonic bandgap spectral positions between 1.4 μm and 2.3 μm were fabricated. The loss follows the ≈ λ-3 dependency previously reported [1] with a minimum measured loss of 9.5 dB/km at 1992 nm....
Energy Technology Data Exchange (ETDEWEB)
Yuan Weijia; Campbell, A M; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, Cambridge CB2 1PZ (United Kingdom)], E-mail: wy215@cam.ac.uk
2009-07-15
A model is presented for calculating the AC losses of a stack of second-generation high temperature superconductor tapes. This model takes as a starting point the model of Clem and co-workers for a stack in which each tape carries the same current. It is based on the assumption that the magnetic flux lines lie parallel to the tapes within the part of the stack where the flux has not penetrated. In this paper we allow for the depth of penetration of field to vary across the stack, and use the Kim model to allow for the variation of J{sub c} with B. The model is applied to the cases of a transport current and an applied field. For a transport current the calculated result differs from the Norris expression for a single tape carrying a uniform current and it does not seem possible to define a suitable average J{sub c} which could be used. Our method also gives a more accurate value for the critical current of the stack than other methods. For an applied field the stack behaves as a solid superconductor with the J{sub c} averaged locally over several tapes, but still allowed to vary throughout the stack on a larger scale. For up to about ten tapes the losses rise rapidly with the number of tapes, but in thicker stacks the tapes shield each other and the losses become that of a slab with a field parallel to the faces.
Low frequency ac conduction and dielectric relaxation in poly(N ...
Indian Academy of Sciences (India)
The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.
Technical feasibility and reliability of passive safety systems of AC600
International Nuclear Information System (INIS)
Niu, W.; Zeng, X.
1996-01-01
The first step conceptual design of the 600 MWe advanced PWR (AC-600) has been finished by the Nuclear Power Institute of China. Experiments on the passive system of AC-600 are being carried out, and are expected to be completed next year. The main research emphases of AC-600 conceptual design include the advanced core, the passive safety system and simplification. The design objective of AC-600 is that the safety, reliability, maintainability, operation cost and construction period are all improved upon compared to those of PWR plant. One of important means to achieve the objective is using a passive system, which has the following functions whenever its operation is required: providing the reactor core with enough coolant when others fail to make up the lost coolant; reactor residual heat removal; cooling and reducing pressure in the containment and preventing radioactive substances from being released into the environment after occurrence of accident (e.g. LOCA). The system should meet the single failure criterion, and keep operating when a single active component or passive component breaks down during the first 72 hour period after occurrence of accident, or in the long period following the 72 hour period. The passive safety system of AC-600 is composed of the primary safety injection system, the secondary emergency core residual heat removal system and the containment cooling system. The design of the system follows some relevant rules and criteria used by current PWR plant. The system has the ability to bear single failure, two complete separate subsystems are considered, each designed for 100% working capacity. Normal operation is separate from safety operation and avoids cross coupling and interference between systems, improves the reliability of components, and makes it easy to maintain, inspect and test the system. The paper discusses the technical feasibility and reliability of the passive safety system of AC-600, and some issues and test plans are also
Technical feasibility and reliability of passive safety systems of AC600
Energy Technology Data Exchange (ETDEWEB)
Niu, W; Zeng, X [Nuclear Power Inst. of China, Chendu (China)
1996-12-01
The first step conceptual design of the 600 MWe advanced PWR (AC-600) has been finished. Experiments on the passive system of AC-600 are being carried out, and are expected to be completed next year. The main research emphases of AC-600 conceptual design include the advanced core, the passive safety system and simplification. The design objective of AC-600 is that the safety, reliability, maintainability, operation cost and construction period are all improved upon compared to those of PWR plant. One of important means to achieve the objective is using a passive system, which has the following functions whenever its operation is required: providing the reactor core with enough coolant when others fail to make up the lost coolant; reactor residual heat removal; cooling and reducing pressure in the containment and preventing radioactive substances from being released into the environment after occurrence of accident (e.g. LOCA). The system should meet the single failure criterion, and keep operating when a single active component or passive component breaks down during the first 72 hour period after occurrence of accident, or in the long period following the 72 hour period. The passive safety system of AC-600 is composed of the primary safety injection system, the secondary emergency core residual heat removal system and the containment cooling system. The design of the system follows some relevant rules and criteria used by current PWR plant. The system has the ability to bear single failure, two complete separate subsystems are considered, each designed for 100% working capacity. Normal operation is separate from safety operation and avoids cross coupling and interference between systems, improves the reliability of components, and makes it easy to maintain, inspect and test the system. The paper discusses the technical feasibility and reliability of the passive safety system of AC-600, and some issues and test plans are also involved. (author). 3 figs, 1 tab.
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Objectives and status of development of AC600
International Nuclear Information System (INIS)
Zhao Chengkun
1997-01-01
AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600
Low Loss Single-Mode Porous-Core Kagome Photonic Crystal Fiber for THz Wave Guidance
DEFF Research Database (Denmark)
Hasanuzzaman, G. K. M.; Habib, Selim; Abdur Razzak, S. M.
2015-01-01
A novel porous-core kagome lattice photonic crystal fiber (PCF) is designed and analyzed in this paper for terahertz (THz) wave guidance. Using finite element method (FEM), properties of the proposed kagome lattice PCF are simulated in details including the effective material loss (EML), confinem...
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
International Nuclear Information System (INIS)
Pointner, W.; Broecker, A.
2012-01-01
The report on safeguarding of emergency core cooling in case of loss-of-coolant accidents with insulation material release covers the following issues: assessment of the relevant status for PWR, evaluation of the national and international (USA, Canada, France) status, actualization of recommendations, transferability from PWR to BWR. Generic studies on the core cooling capability in case of insulation material release in BWR-type reactors were evaluated.
Neutrino energy loss rates due to key iron isotopes for core-collapse physics
International Nuclear Information System (INIS)
Nabi, J.-U.
2008-07-01
Accurate estimates of neutrino energy loss rates are needed for the study of the late stages of the stellar evolution, in particular for the cooling of neutron stars and white dwarfs. The energy spectra of neutrinos and antineutrinos arriving at the Earth can also provide useful information on the primary neutrino fluxes as well as neutrino mixing scenario. Proton-neutron quasi-particle random phase approximation (pn-QRPA) theory has recently being used for a microscopic calculation of stellar weak interaction rates of fp-shell nuclide, particularly iron isotopes, with success. Here I present the calculation of neutrino and antineutrino energy loss rates due to key iron isotopes in stellar matter using the pn-QRPA theory. The rates are calculated on a fine grid of temperature-density scale suitable for core-collapse simulators. The calculated rates are compared against earlier calculations. The neutrino cooling rates due to even-even isotopes of iron, 54,56 Fe, are in good agreement with the rates calculated using the large-scale shell model. The pn-QRPA calculated neutrino energy loss rates due to 55 Fe are enhanced roughly around an order of magnitude compared to the large-scale shell model calculation during the oxygen and silicon shell burning stages of massive stars and favor a lower entropy for the cores of massive stars. (author)
BEND-INDUCED LOSSES IN A SINGLE-MODE MICROSTRUCTURED FIBER WITH A LARGE CORE
Directory of Open Access Journals (Sweden)
Y. A. Gatchin
2015-03-01
Full Text Available A study of bend-induced losses in a silica-based single-mode microstructured fiber with a core diameter ranging from 20 to 35 microns and increased relative air content in the holey cladding has been conducted. With the use of the equivalent step-index profile method in approximation of waveguide parameters of microstructured fiber (normalized frequency and normalized transverse attenuation constant the effect of bending on the spectral position of the fundamentalmode short-wavelength leakage boundary has been analyzed. Upon measurement of spectral characteristics of attenuation in the considered fibers good accordance of numerical and experimental data has been found out. It is shown that increase of the air content in the holey cladding leads to expansion of the mentioned boundary to lower wavelengths for the value from 150 to 800 nm depending on the core size and bending conditions. A single-transverse-mode propagation is achieved on fiber length of 5-10 meters due to a substantial difference in losses of fundamental and higher-order guided modes attained by bending. Optical losses in all studied samples are less than 10 dB/km at the wavelength λ = 1550 nm. The results of the study can be applied in the design of high-power laser systems having such basic requirements as a relatively large mode spot and high beam quality.
Reactor core flow rate control system
International Nuclear Information System (INIS)
Sakuma, Hitoshi; Tanikawa, Naoshi; Takahashi, Toshiyuki; Miyakawa, Tetsuya.
1996-01-01
When an internal pump is started by a variable frequency power source device, if magnetic fields of an AC generator are introduced after the rated speed is reached, neutron flux high scram occurs by abrupt increase of a reactor core flow rate. Then, in the present invention, magnetic fields for the AC generator are introduced at a speed previously set at which the fluctuation range of the reactor core flow rate (neutron flux) by the start up of the internal pump is within an allowable value. Since increase of the speed of the internal pump upon its start up is suppressed to determine the change of the reactor core flow rate within an allowable range, increase of neutron fluxes is suppressed to enable stable start up. Then, since transition boiling of fuels caused by abrupt decrease of the reactor core flow rate upon occurrence of abnormality in an external electric power system is prevented, and the magnetic fields for the AC generator are introduced in such a manner to put the speed increase fluctuation range of the internal pump upon start up within an allowable value, neutron flux high scram is not caused to enable stable start-up. (N.H.)
Nguyen, Doan Ngoc
Alternating current (AC) loss and current carrying capacity are two of the most crucial considerations in large-scale power applications of high temperature superconducting (HTS) conductors. AC losses result in an increased thermal load for cooling machines, and thus increased operating costs. Furthermore, AC losses can stimulate quenching phenomena or at least decrease the stability margin for superconducting devices. Thus, understanding AC losses is essential for the development of HTS AC applications. The main focus of this dissertation is to make reliable total AC loss measurements and interpret the experimental results in a theoretical framework. With a specially designed magnet, advanced total AC loss measurement system in liquid nitrogen (77 K) has been successfully built. Both calorimetric and electromagnetic methods were employed to confirm the validity of the measured results and to have a more thorough understanding of AC loss in HTS conductors. The measurement is capable of measuring total AC loss in HTS tapes over a wide range of frequency and amplitude of transport current and magnetic field. An accurate phase control technique allows measurement of total AC loss with any phase difference between the transport current and magnetic field by calorimetric method. In addition, a novel total AC loss measurement system with variable temperatures from 30 K to 100 K was successfully built and tested. Understanding the dependence of AC losses on temperature will enable optimization of the operating temperature and design of HTS devices. As a part of the dissertation, numerical calculations using Brandt's model were developed to study electrodynamics and total AC loss in HTS conductors. In the calculations, the superconducting electrical behavior is assumed to follow a power-law model. In general, the practical properties of conductors, including field-dependence of critical current density Jc, n-value and non-uniform distribution of Jc, can be accounted for in
Structural, ac conductivity and dielectric properties of 3-formyl chromone
Ali, H. A. M.
2017-07-01
The structure for the powder of 3-formyl chromone was examined by X-ray diffraction technique in the 2θ° range ( 4° - 60° . The configuration of Al/3-formyl chromone/Al samples was designed. The electrical and dielectric properties were studied as a function of frequency (42- 5 × 106 Hz) and temperature (298-408K). The ac conductivity data of bulk of 3-formyl chromone varies as a power law with the frequency at different temperatures. The predominant mechanism for ac conduction was deduced. The ac conductivity shows a thermally activated process at different frequencies. The dielectric constant and dielectric loss were determined using the capacitance and dissipation factor measurements at different temperatures. The dielectric loss shows a peak of relaxation time that shifted to higher frequency with an increase in the temperature. The activation energy of the relaxation process was estimated.
International Nuclear Information System (INIS)
Chao, C.C.; Chen, C.T.; Lee, M.
1995-01-01
The core damage frequency caused by loss of residual heat removal (RHR) events was assessed during midloop operation of a Westinghouse-designed three-loop pressurized water reactor. The assessment considers two types of outages (refueling and drained maintenance) and uses failure data collected specifically for shutdown condition. Event trees were developed for five categories of loss of RHR events. Human actions to mitigate the loss of RHR events were identified and human error probabilities were quantified using the human cognitive reliability (HCR) and the technique for human error rate prediction (THERP) models. The results showed that the core damage frequency caused by loss of RHR events during midloop operation was 3.4 x 10 -5 per year. The results also showed that the core damage frequency can be reduced significantly by removing a pressurizer safety valve before entering midloop operation. The establishment of reflux cooling, i.e., decay heat removal through the steam generator secondary side, also plays an important role in mitigating the loss of RHR events during midloop operation
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
Analysis of core damage frequency: Surry, Unit 1 internal events
International Nuclear Information System (INIS)
Bertucio, R.C.; Julius, J.A.; Cramond, W.R.
1990-04-01
This document contains the accident sequence analysis of internally initiated events for the Surry Nuclear Station, Unit 1. This is one of the five plant analyses conducted as part of the NUREG-1150 effort by the Nuclear Regulatory Commission. NUREG-1150 documents the risk of a selected group of nuclear power plants. The work performed and described here is an extensive of that published in November 1986 as NUREG/CR-4450, Volume 3. It addresses comments form numerous reviewers and significant changes to the plant systems and procedures made since the first report. The uncertainty analysis and presentation of results are also much improved. The context and detail of this report are directed toward PRA practitioners who need to know how the work was performed and the details for use in further studies. The mean core damage frequency at Surry was calculated to be 4.05-E-5 per year, with a 95% upper bound of 1.34E-4 and 5% lower bound of 6.8E-6 per year. Station blackout type accidents (loss of all AC power) were the largest contributors to the core damage frequency, accounting for approximately 68% of the total. The next type of dominant contributors were Loss of Coolant Accidents (LOCAs). These sequences account for 15% of core damage frequency. No other type of sequence accounts for more than 10% of core damage frequency. 49 refs., 52 figs., 70 tabs
Effect of dc field on ac-loss peak in a commercial Bi:2223/Ag tape
Öztürk, Ali; Düzgün, İbrahim; Çelebi, Selahattin
2017-12-01
Measurements of the ac susceptibility in a commercial Bi:2223/Ag tape for some different ac magnetic field amplitudes, Hac, in the presence of bias magnetic field Hdc directed along Hac are reported. It is found that the peak values of the imaginary component of ac susceptibility χ″max versus Hac trace a valley for the orientation where applied field Ha perpendicular to wide face of the tape total. We note that the observation of the valley depends on various parameters such as field dependence parameter n in the critical current density, in the simple power law expression jc = α(T)/Bn, choice of the bias field Hdc together with selected ac field amplitudes Hac, and dimension and geometry of sample studied. Our calculations based on critical state model with jc = α(1 - T/Tcm)p/Bn using the fitting parameters of n = 0.25, p = 2.2, Tcm = 108 K gives quite good results to compare the experimental and calculated curves.
Transition from the adiabatic to the sudden limit in core-electron photoemission
Hedin, Lars; Michiels, John; Inglesfield, John
1998-12-01
Experimental results for core-electron photoemission Jk(ω) are often compared with the one-electron spectral function Ac(ɛk-ω), where ω is the photon energy, ɛk is the photoelectron energy, and the optical transition matrix elements are taken as constant. Since Jk(ω) is nonzero only for ɛk>0, we must actually compare it with Ac(ɛk-ω)θ(ɛk). For metals Ac(ω) is known to have a quasiparticle (QP) peak with an asymmetric power-law [theories of Mahan, Nozières, de Dominicis, Langreth, and others (MND)] singularity due to low-energy particle-hole excitations. The QP peak starts at the core-electron energy ɛc, and is followed by an extended satellite (shakeup) structure at smaller ω. For photon energies ω just above threshold, ωth=-ɛc, Ac(ɛk-ω)θ(ɛk) as a function of ɛk (ω constant) is cut just behind the quasiparticle peak, and neither the tail of the MND line nor the plasmon satellites are present. The sudden (high-energy) limit is given by a convolution of Ac(ω) and a loss function, i.e., by the Berglund-Spicer two-step expression. Thus Ac(ω) alone does not give the correct photoelectron spectrum, neither at low nor at high energies. We present an extension of the quantum-mechanical (QM) models developed earlier by Inglesfield, and by Bardyszewski and Hedin to calculate Jk(ω). It includes recoil and damping, as well as shakeup effects and extrinsic losses, is exact in the high-energy limit, and allows calculations of Jk(ω) including the MND line and multiple plasmon losses. The model, which involves electrons coupled to quasibosons, is motivated by detailed arguments. As an illustration we have made quantitative calculations for a semi-infinite jellium with the density of aluminum metal and an embedded atom. The coupling functions (fluctuation potentials) between the electron and the quasibosons are related to the random-phase-approximation dielectric function, and different levels of approximations are evaluated numerically. The differences
Analysis of core damage frequency, Surry, Unit 1 internal events appendices
International Nuclear Information System (INIS)
Bertucio, R.C.; Julius, J.A.; Cramond, W.R.
1990-04-01
This document contains the appendices for the accident sequence analyses of internally initiated events for the Surry Nuclear Station, Unit 1. This is one of the five plant analyses conducted as part of the NUREG-1150 effort by the Nuclear Regulatory Commission. NUREG-1150 documents the risk of a selected group of nuclear power plants. The work performed is an extensive reanalysis of that published in November 1986 as NUREG/CR-4450, Volume 3. It addresses comments from numerous reviewers and significant changes to the plant systems and procedures made since the first report. The uncertainty analysis and presentation of results are also much improved. The context and detail of this report are directed toward PRA practitioners who need to know how the work was performed and the details for use in further studies. The mean core damage frequency at Surry was calculated to be 4.0E-5 per year, with a 95% upper bound of 1.3E-4 and 5% lower bound of 6.8E-6 per year. Station blackout type accidents (loss of all AC power) were the largest contributors to the core damage frequency, accounting for approximately 68% of the total. The next type of dominant contributors were Loss of Coolant Accidents (LOCAs). These sequences account for 15% of core damage frequency. No other type of sequence accounts for more than 10% of core damage frequency
Reliability of emergency ac power systems at nuclear power plants
International Nuclear Information System (INIS)
Battle, R.E.; Campbell, D.J.
1983-07-01
Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project
A nuclear reactor core fuel reload optimization using artificial ant colony connective networks
International Nuclear Information System (INIS)
Lima, Alan M.M. de; Schirru, Roberto; Carvalho da Silva, Fernando; Medeiros, Jose Antonio Carlos Canedo
2008-01-01
The core of a nuclear Pressurized Water Reactor (PWR) may be reloaded every time the fuel burn-up is such that it is not more possible to maintain the reactor operating at nominal power. The nuclear core fuel reload optimization problem consists in finding a pattern of burned-up and fresh-fuel assemblies that maximize the number of full operational days. This is an NP-Hard problem, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Moreover, the problem is non-linear and its search space is highly discontinuous and multi-modal. Ant Colony System (ACS) is an optimization algorithm based on artificial ants that uses the reinforcement learning technique. The ACS was originally developed to solve the Traveling Salesman Problem (TSP), which is conceptually similar to the nuclear core fuel reload problem. In this work a parallel computational system based on the ACS, called Artificial Ant Colony Networks is introduced to solve the core fuel reload optimization problem
A nuclear reactor core fuel reload optimization using artificial ant colony connective networks
Energy Technology Data Exchange (ETDEWEB)
Lima, Alan M.M. de [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: alanmmlima@yahoo.com.br; Schirru, Roberto [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: schirru@lmp.ufrj.br; Carvalho da Silva, Fernando [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: fernando@con.ufrj.br; Medeiros, Jose Antonio Carlos Canedo [Universidade Federal do Rio de Janeiro, PEN/COPPE - UFRJ, Ilha do Fundao s/n, CEP 21945-970 Rio de Janeiro (Brazil)], E-mail: canedo@lmp.ufrj.br
2008-09-15
The core of a nuclear Pressurized Water Reactor (PWR) may be reloaded every time the fuel burn-up is such that it is not more possible to maintain the reactor operating at nominal power. The nuclear core fuel reload optimization problem consists in finding a pattern of burned-up and fresh-fuel assemblies that maximize the number of full operational days. This is an NP-Hard problem, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Moreover, the problem is non-linear and its search space is highly discontinuous and multi-modal. Ant Colony System (ACS) is an optimization algorithm based on artificial ants that uses the reinforcement learning technique. The ACS was originally developed to solve the Traveling Salesman Problem (TSP), which is conceptually similar to the nuclear core fuel reload problem. In this work a parallel computational system based on the ACS, called Artificial Ant Colony Networks is introduced to solve the core fuel reload optimization problem.
International Nuclear Information System (INIS)
Lee, Jeong-Hun; Cho, Hyoung-Kyu; Park, Goon-Cherl
2016-01-01
Highlights: • Cross flow experimental data are produced with wedge-shaped and parallel gaps. • The results of a CFD analysis and experimental data are in good agreement. • Pressure loss coefficient for the cross gap between fuel blocks in PMR200 is found. • A new correlation of the cross flow loss coefficient for PMR200 is proposed. - Abstract: The core of the very high temperature reactor (VHTR) PMR200 (a prismatic modular reactor rated at 200 MW of thermal power) consists of hexagonal prismatic fuel blocks and reflector blocks made of graphite. If the core bypass flow ratio increases, the coolant channel flow is decreased and can then lower the heat removal efficiency, resulting in a locally increased fuel block temperature. The coolant channels in the fuel blocks are connected to bypass gaps by the cross gap, complicating flow distribution in the VHTR core. Therefore, reliable estimation of the bypass flow is highly important for the design and safety analysis of the VHTR core. Because of the complexity of the core geometry and gap configuration, it is challenging to predict the flow distribution in the VHTR core. To analyze this flow distribution accurately, it is necessary to determine the cross flow phenomena, and the loss coefficient across the cross gap has to be evaluated to determine the flow distribution in the VHTR core when a lumped parameter code or a flow network analysis code that uses the correlation of the loss coefficient is employed. The purpose of this paper is to develop a loss coefficient correlation applicable to the cross gap in the PMR200 core. The cross flow was evaluated experimentally using the difference between the measured inlet and outlet mass flow rates. Next, the applicability of a commercial computational fluid dynamics (CFD) code, CFX 15, was confirmed by comparing the experimental data and CFD analysis results. To understand the cross flow phenomena, the loss coefficient was evaluated; in the high Reynolds number region
Energy Technology Data Exchange (ETDEWEB)
Lee, Jeong-Hun, E-mail: huny12@snu.ac.kr; Cho, Hyoung-Kyu, E-mail: chohk@snu.ac.kr; Park, Goon-Cherl, E-mail: parkgc@snu.ac.kr
2016-10-15
Highlights: • Cross flow experimental data are produced with wedge-shaped and parallel gaps. • The results of a CFD analysis and experimental data are in good agreement. • Pressure loss coefficient for the cross gap between fuel blocks in PMR200 is found. • A new correlation of the cross flow loss coefficient for PMR200 is proposed. - Abstract: The core of the very high temperature reactor (VHTR) PMR200 (a prismatic modular reactor rated at 200 MW of thermal power) consists of hexagonal prismatic fuel blocks and reflector blocks made of graphite. If the core bypass flow ratio increases, the coolant channel flow is decreased and can then lower the heat removal efficiency, resulting in a locally increased fuel block temperature. The coolant channels in the fuel blocks are connected to bypass gaps by the cross gap, complicating flow distribution in the VHTR core. Therefore, reliable estimation of the bypass flow is highly important for the design and safety analysis of the VHTR core. Because of the complexity of the core geometry and gap configuration, it is challenging to predict the flow distribution in the VHTR core. To analyze this flow distribution accurately, it is necessary to determine the cross flow phenomena, and the loss coefficient across the cross gap has to be evaluated to determine the flow distribution in the VHTR core when a lumped parameter code or a flow network analysis code that uses the correlation of the loss coefficient is employed. The purpose of this paper is to develop a loss coefficient correlation applicable to the cross gap in the PMR200 core. The cross flow was evaluated experimentally using the difference between the measured inlet and outlet mass flow rates. Next, the applicability of a commercial computational fluid dynamics (CFD) code, CFX 15, was confirmed by comparing the experimental data and CFD analysis results. To understand the cross flow phenomena, the loss coefficient was evaluated; in the high Reynolds number region
AC magnetic transport on heterogeneous ferromagnetic wires and tubes
International Nuclear Information System (INIS)
Sinnecker, J.P.; Pirota, K.R.; Knobel, M.; Kraus, L.
2002-01-01
The AC current density radial distribution is calculated on heterogeneous composite materials with cylindrical geometry. The composites have an inner core and thin outer shell that can be either from the same material (homogenous material like simple wires) or from different materials with different physical properties. The case in which a non-magnetic inner core is surrounded by a magnetic layer, like electrodeposited wires, is mainly studied. The effect of frequency and applied magnetic field is simulated. The current density distribution as a function of frequency and applied field, as well as the total current over the inner core and outer shells are calculated. The results agree substantially well with the experimentally observed data for simple electrodeposited wires
A decomposition method for network-constrained unit commitment with AC power flow constraints
International Nuclear Information System (INIS)
Bai, Yang; Zhong, Haiwang; Xia, Qing; Kang, Chongqing; Xie, Le
2015-01-01
To meet the increasingly high requirement of smart grid operations, considering AC power flow constraints in the NCUC (network-constrained unit commitment) is of great significance in terms of both security and economy. This paper proposes a decomposition method to solve NCUC with AC power flow constraints. With conic approximations of the AC power flow equations, the master problem is formulated as a MISOCP (mixed integer second-order cone programming) model. The key advantage of this model is that the active power and reactive power are co-optimised, and the transmission losses are considered. With the AC optimal power flow model, the AC feasibility of the UC result of the master problem is checked in subproblems. If infeasibility is detected, feedback constraints are generated based on the sensitivity of bus voltages to a change in the unit reactive power generation. They are then introduced into the master problem in the next iteration until all AC violations are eliminated. A 6-bus system, a modified IEEE 30-bus system and the IEEE 118-bus system are used to validate the performance of the proposed method, which provides a satisfactory solution with approximately 44-fold greater computational efficiency. - Highlights: • A decomposition method is proposed to solve the NCUC with AC power flow constraints • The master problem considers active power, reactive power and transmission losses. • OPF-based subproblems check the AC feasibility using parallel computing techniques. • An effective feedback constraint interacts between the master problem and subproblem. • Computational efficiency is significantly improved with satisfactory accuracy
Superconductor design and loss analysis for a 20 MJ induction heating coil
International Nuclear Information System (INIS)
Walker, M.S.; Declercq, J.G.; Zeitlin, B.A.
1980-01-01
The design of a 50 k Ampere conductor for use in a 20 MJ Induction Heating Coil is described. The conductor is a wide flat cable of 36 subcables, each of which contains six NbTi strands around a stainless steel core strand. The 2.04 mm (0.080'') diameter monolithic strands allow bubble clearing for cryostable operation at a pool boiling heat transfer from the unoccluded strand surface of 0.26 Watts/cm 2 . A thin, tough polyester amide-imide (Westinghouse Omega) insulation provides a rugged coating that will resist flaking and chipping during the cabling and compaction operations and provide (1) a reliable adherent surface for enhanced heat transfer, and (2) a low voltage standoff preventing interstrand coupling losses. The strands are uniquely configured using CuNi elements to provide low ac losses with NbTi filaments in an all-copper matrix. AC losses are expected to be approximately 0.3% of 20 MJ for a -7.5 T to 7.5 T one-second 1/2-cosinusoidal bipolar operation in a 20 MJ coil. They will be approximately 0.1% of 100 MJ for 1.8 second -8 T and +8 T ramped operation in a 100 MJ coil. The design is firmly based on the results of tests performed on prototype strands and subcables
AC-600 passive ECRHR system and its research program
International Nuclear Information System (INIS)
Chen Bingde; Xiao Zejun; Zhou Renmin; Liu Yiyang
1997-01-01
The secondary-side passive emergency core residual heat removal system (ECRHR System) is an important part of AC-600 PWR passive safety system, with which the core decay heat can be removed through nature circulation in primary and secondary system. Since 1991, the program for AC-600 passive ECRHR system has been conducted to investigate its distinct thermal-hydraulic phenomena, heat removal capability, affecting factors, and to develop computer codes. The test facility, designed according to the power/volume simulating law, is a full pressure and temperature operating loop with volume scaling factor of 1/390. It is composed of main loop system, emergence feedwater system, depression system, heat tracing, I and C system and power supply system. A total of sixteen tests is planned in first stage and fifteen of them have been done. The preliminary result analysis showed that the system has efficient heat removal capability in most conditions and some special thermal hydraulic phenomena, for example, flow fluctuation, which has negative impact on system's nature circulation, were identified
Analysis of loss of coolant accident and emergency core cooling system
International Nuclear Information System (INIS)
Abe, Kiyoharu; Kobayashi, Kenji; Hayata, Kunihisa; Tasaka, Kanji; Shiba, Masayoshi
1977-01-01
In this paper, the analysis for the performance evaluation of emergency core cooling system is described, which is the safety protection device to the loss of coolant accidents due to the break of primary cooling pipings of light water reactors. In the LOCA analysis for the performance evaluation of ECCS, it must be shown that a reactor core keeps the form which can be cooled with the ECCS in case of LOCA, and the overheat of the core can be prevented. Namely, the shattering of fuel cladding tubes is never to occur, and for the purpose, the maximum temperature of Zircaloy 2 or 4 cladding tubes must be limited to 1200 deg C, and the relative thickness of oxide film must be below 15%. The calculation for determining the temperature of cladding tubes in case of the LOCA in BWRs and PWRs is explained. First, the primary cooling system, the ECCS and the related installations of BWRs and PWRs are outlined. The code systems for LOCA/ECCS analysis are divid ed into several steps, such as blowdown process, reflooding process and heatup calculation. The examples of the sensitivity analysis of the codes are shown. The LOCA experiments carried out so far in Japan and foreign countries and the LOCA analysis of a BWR with RELAP-4J code are described. The guidance for the performance evaluation of ECCS was established in 1975 by the Reactor Safety Deliberation Committee in Japan, and the contents are quoted. (Kako, I.)
Calculation of AC losses in large HTS stacks and coils
DEFF Research Database (Denmark)
Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad
2012-01-01
In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting...... allowing for overcritical current densities to be considered. The method presented here allowed for a computational speedup factor of up to 2 orders of magnitude when compared to full 2-D simulations taking into account the actual structure of the stacks without compromising accuracy....
Three-Phase AC Optimal Power Flow Based Distribution Locational Marginal Price: Preprint
Energy Technology Data Exchange (ETDEWEB)
Yang, Rui; Zhang, Yingchen
2017-05-17
Designing market mechanisms for electricity distribution systems has been a hot topic due to the increased presence of smart loads and distributed energy resources (DERs) in distribution systems. The distribution locational marginal pricing (DLMP) methodology is one of the real-time pricing methods to enable such market mechanisms and provide economic incentives to active market participants. Determining the DLMP is challenging due to high power losses, the voltage volatility, and the phase imbalance in distribution systems. Existing DC Optimal Power Flow (OPF) approaches are unable to model power losses and the reactive power, while single-phase AC OPF methods cannot capture the phase imbalance. To address these challenges, in this paper, a three-phase AC OPF based approach is developed to define and calculate DLMP accurately. The DLMP is modeled as the marginal cost to serve an incremental unit of demand at a specific phase at a certain bus, and is calculated using the Lagrange multipliers in the three-phase AC OPF formulation. Extensive case studies have been conducted to understand the impact of system losses and the phase imbalance on DLMPs as well as the potential benefits of flexible resources.
Control of a resonant d.c.-link converter for a.c. motor drives
Directory of Open Access Journals (Sweden)
Astrid Petterteig
1992-10-01
Full Text Available This paper presents the control of the resonant d.c.-link converter for a.c. motor drives. This is a low loss converter with higher efficiency than a conventional PWM converter, but it requires complex control. It needs a special control of the resonant d.c.-link voltage in addition to the discrete control of the a.c. side currents. Simulations show how the control of the a.c. currents, the modulation principle, influences the overall performance of the converter.
AC Application of HTS Conductors in Highly Dynamic Electric Motors
International Nuclear Information System (INIS)
Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K
2006-01-01
Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit
Flux-transfer losses in helically wound superconducting power cables
International Nuclear Information System (INIS)
Clem, John R; Malozemoff, A P
2013-01-01
Minimization of ac losses is essential for economic operation of high-temperature superconductor (HTS) ac power cables. A favorable configuration for the phase conductor of such cables has two counter-wound layers of HTS tape-shaped wires lying next to each other and helically wound around a flexible cylindrical former. However, if magnetic materials such as magnetic substrates of the tapes lie between the two layers, or if the winding pitch angles are not opposite and essentially equal in magnitude to each other, current distributes unequally between the two layers. Then, if at some point in the ac cycle the current of either of the two layers exceeds its critical current, a large ac loss arises from the transfer of flux between the two layers. A detailed review of the formalism, and its application to the case of paramagnetic substrates including the calculation of this flux-transfer loss, is presented. (paper)
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Calculation of single phase AC and monopolar DC hybrid corona effects
International Nuclear Information System (INIS)
Zhao, T.; Sebo, S.A.; Kasten, D.G.
1996-01-01
Operating a hybrid HVac and HVdc line is an option for increasing the efficiency of power transmission and overcoming the difficulties in obtaining a new right-of-way. This paper proposes a new calculation method for the study of hybrid line corona. The proposed method can be used to calculate dc corona losses and corona currents in dc or ac conductors for single phase ac and monopolar dc hybrid lines. Profiles of electric field strength and ion current density at ground level can be estimated. The effects of the presence of an energized ac conductor on dc conductor corona and dc voltage on ac conductor corona are included in the method. Full-scale and reduced-scale experiments were utilized to investigate the hybrid line corona effects. Verification of the proposed calculation method is given
Analysis of the core reflooding of a PWR reactor under a loss-of-coolant postulated accident
International Nuclear Information System (INIS)
Austregesilo Filho, H.
1978-12-01
The main purpose of this work is to analyse the termohydraulic behaviour of emergency cooling water, during reflooding of a PWR core submitted to a postulated loss-of-coolant accident, with the scope of giving the boundary conditions needed to verify fuel element and containment integrity. The analytical model presented was applied to the simulation of Angra I core reflooding phase, after a double-ended break between pressure vessel and discharge of one of the main coolant pumps. For this accident, with a discharge coefficient of C sub(D) = 0.4, the highest peak cladding temperature is expected. (author) [pt
AC-600 reactor reloading pattern optimization by using genetic algorithms
International Nuclear Information System (INIS)
Wu Hongchun; Xie Zhongsheng; Yao Dong; Li Dongsheng; Zhang Zongyao
2000-01-01
The use of genetic algorithms to optimize reloading pattern of the nuclear power plant reactor is proposed. And a new encoding and translating method is given. Optimization results of minimizing core power peak and maximizing cycle length for both low-leakage and out-in loading pattern of AC-600 reactor are obtained
Kvitkovic, J.; Hatwar, R.; Pamidi, S. V.; Fleshler, S.; Thieme, C.
2015-12-01
The temperature dependence of the critical current and AC losses were measured on American Superconductor Corporation's (AMSC) second generation high temperature superconducting (2G HTS) wire produced by Rolling Assisted Biaxially Textured Substrate (RABiTS) and Metal Organic Deposition (MOD) process. Wires manufactured with two types of substrates were characterized. The magnetic substrate with composition Ni5a%W exhibits a magnetic signature and has non-negligible AC losses in AC power applications. A new nonmagnetic substrate with an alloy composition Ni9a%W has been developed by AMSC to address the AC losses in 2G HTS. The data presented show that the performance of the new conductor is identical to the conductor with magnetic substrate in terms of critical current density. The data on AC losses demonstrate the absence of ferromagnetic loss component in the new conductor and significantly reduced AC losses at low to moderate values of I/Ic. The reduced losses will translate into reduced capital costs and lower operating costs of superconducting electrical devices for AC applications.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Analysis of core damage frequency: Peach Bottom, Unit 2 internal events appendices
International Nuclear Information System (INIS)
Kolaczkowski, A.M.; Cramond, W.R.; Sype, T.T.; Maloney, K.J.; Wheeler, T.A.; Daniel, S.L.
1989-08-01
This document contains the appendices for the accident sequence analysis of internally initiated events for the Peach Bottom, Unit 2 Nuclear Power Plant. This is one of the five plant analyses conducted as part of the NUREG-1150 effort for the Nuclear Regulatory Commission. The work performed and described here is an extensive reanalysis of that published in October 1986 as NUREG/CR-4550, Volume 4. It addresses comments from numerous reviewers and significant changes to the plant systems and procedures made since the first report. The uncertainty analysis and presentation of results are also much improved, and considerable effort was expended on an improved analysis of loss of offsite power. The content and detail of this report is directed toward PRA practitioners who need to know how the work was done and the details for use in further studies. The mean core damage frequency is 4.5E-6 with 5% and 95% uncertainty bounds of 3.5E-7 and 1.3E-5, respectively. Station blackout type accidents (loss of all ac power) contributed about 46% of the core damage frequency with Anticipated Transient Without Scram (ATWS) accidents contributing another 42%. The numerical results are driven by loss of offsite power, transients with the power conversion system initially available operator errors, and mechanical failure to scram. 13 refs., 345 figs., 171 tabs
Dynamic response of cylindrical ACS support structures to core energy release
International Nuclear Information System (INIS)
Kennedy, J.M.; Belytschko, T.B.
1985-01-01
The code SAFE/RAS is applied to the analysis of a new design concept for the above-core structures when subjected to the loads of a core disruptive accident. The analysis involves the determination of the postbuckling response of a thin cylinder loaded both axially and vertically. The effects of variation of cylinder thickness and fluid-structure interaction are investigated
Evaluation of the gravity-injection capability for core cooling after a loss-of-SDC event
International Nuclear Information System (INIS)
Seul, Kwang Won; Bang, Young Seok; Kim, Hho Jung
1999-01-01
In order to evaluate the gravity-drain capability to maintain core cooling after a loss-of-shutdown-cooling event during shutdown operation, the plant conditions of the Young Gwang Units 3 and 4 were reviewed. The six cases of possible gravity-drain paths using the water of the refueling water storage tank (RWST) were identified and the thermal hydraulic analyses were performed using RELAP5/MOD3.2 code. The core cooling capability was dependent on the gravity-drain paths and the drain rate. In the cases with the injection path and opening on the different leg side, the system was well depressurized after gravity-injection and the core boiling was successfully prevented for a long-term transient. However, in the cases with the injection path and opening on the cold leg side, the core coolant continued boiling although the system pressure remains atmospheric after gravity-injection because the cold water injected from the RWST was bypassed the core region. In the cases with the higher pressurizer opening than the RWST water level, the system was also pressurized by the water-hold in the pressurizer and the core was uncovered because the gravity-injection from the RWST stopped due to the high system pressure. In addition, from the sensitivity study on the gravity-injection flow rates, it was found that about 54 kg/s of RWST drain rate was required to maintain the core cooling. Those analysis results would provide useful information to operators coping with the event
Study on interstrand coupling losses in Rutherford-type superconducting cables
International Nuclear Information System (INIS)
Lei, Y.Z.; Shintomi, T.; Terashima, A.; Hirabayashi, H.
1993-02-01
Two sets of experimental apparatus for measuring the AC losses in superconducting strands and Rutherford-type cable conductors have been constructed. A few strand samples and a number of compacted cable samples with and without a CuMn matrix have been measured. The hysteresis loss, loss from coupling within strands and loss from coupling between strands in cables have been distinguished from each other. The results show that, even for Rutherford cables without any soldering and coating, their AC losses may be quite different from each other due to the variation of the interstrand coupling loss. For cables without a CuMn matrix, interstrand coupling loss increases nearly according to a geometrical series with an increase of curing temperature simulating coil fabrication. However, cables with the CuMn matrix show a relatively small curing temperature dependence. For most of the samples, losses do not show any evident dependence on the mechanical pressure. Interstrand resistances in one of these cables have also been measured; the results indicate that the tendency for a decrease in the interstrand resistances is consistent with the results of AC loss measurements. (author)
Study of Power Flow Algorithm of AC/DC Distribution System including VSC-MTDC
Directory of Open Access Journals (Sweden)
Haifeng Liang
2015-08-01
Full Text Available In recent years, distributed generation and a large number of sensitive AC and DC loads have been connected to distribution networks, which introduce a series of challenges to distribution network operators (DNOs. In addition, the advantages of DC distribution networks, such as the energy conservation and emission reduction, mean that the voltage source converter based multi-terminal direct current (VSC-MTDC for AC/DC distribution systems demonstrates a great potential, hence drawing growing research interest. In this paper, considering losses of the reactor, the filter and the converter, a mathematical model of VSC-HVDC for the load flow analysis is derived. An AC/DC distribution network architecture has been built, based on which the differences in modified equations of the VSC-MTDC-based network under different control modes are analyzed. In addition, corresponding interface functions under five control modes are provided, and a back/forward iterative algorithm which is applied to power flow calculation of the AC/DC distribution system including VSC-MTDC is proposed. Finally, by calculating the power flow of the modified IEEE14 AC/DC distribution network, the efficiency and validity of the model and algorithm are evaluated. With various distributed generations connected to the network at appropriate locations, power flow results show that network losses and utilization of transmission networks are effectively reduced.
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
SNR 2 core dynamics and shut-down signals in a protected loss-of-flow incident
International Nuclear Information System (INIS)
Kleefeldt, K.
1982-01-01
The dynamic behavior of a 1300 MWe Core during a loss-of-flow incident has been analyzed by use of the SAS3D code for a given pump coast down characteristic and constant core inlet temperature. Emphasis was placed on the questions: How fast and via which monitored parameters can the incident be recognized by the reactor protection system. What is the tolerable time span for the shut-down action without exceeding safety limits. Key prameters and limit values as well as conceivable reactivity feed-back effects are discussed. The result is, that three out of four choosen monitored parameters are capable of initiating a shut-down action in time. In addition, the amount of shut-down reactivity required for a successful scram was briefly investigated
Electrohydrodynamics of a concentric compound drop in an AC electric field
Soni, Purushottam; Thaokar, Rochish M.; Juvekar, Vinay A.
2018-03-01
The dynamics of a compound drop suspended in another immiscible fluid in the presence of an AC electric field is investigated experimentally and using analytical theory. A closed-form analytical expression for the mean deformation and amplitude of deformation at cyclical steady state is derived in the small deformation limit. Experiments were performed with 0.1M NaCl/castor oil compound drops suspended in highly viscous silicone oil. In this case, both the core and the shell deform into prolate spheroids. The effect of two independent variables was investigated, namely, the ratio of the core radius to the shell radius and the frequency (ω) of the applied AC field. In the limit of ω → 0, the present analytical model reduces to the DC electric field model for the compound drop. It was observed that the size of the core significantly affects the dynamics of the compound drop. The mean and the amplitude of deformation of the shell increase considerably with an increase in the radius ratio. Since the present model is valid for a small deviation from a spherical shape, an excellent quantitative agreement is found between analytical and experimental results at low deformation, whereas, at large deformation, the match is only qualitative. It was also observed that the relative phase difference between the core and the shell decreases with an increase in the radius ratio and frequency of the applied electric field.
Energy Technology Data Exchange (ETDEWEB)
Takamatsu, Kuniyoshi, E-mail: takamatsu.kuniyoshi@jaea.go.jp; Yan, Xing L.; Nakagawa, Shigeaki; Sakaba, Nariaki; Kunitomi, Kazuhiko
2014-05-01
It is well known that a High-Temperature Gas-cooled Reactor (HTGR) has superior safety characteristics; for example, an HTGR has a self-control system that uses only physical phenomena against various accidents. Moreover, the large heat capacity and low power density of the core result in very slow temperature transients. Therefore, an HTGR serves inherently safety features against loss of core cooling accidents such as the Tokyo Electric Power Co., Inc. (TEPCO)’s Fukushima Daiichi Nuclear Power Station (NPS) disaster. Herein we would like to demonstrate the inherent safety features using the High-Temperature Engineering Test Reactor (HTTR). The HTTR is the first HTGR in Japan with a thermal power of 30 MW and a maximum reactor outlet coolant temperature of 950 °C; it was built at the Oarai Research and Development Center of Japan Atomic Energy Agency (JAEA). In this study, an all-gas-circulator trip test was analyzed as a loss of forced cooling (LOFC) test with an initial reactor power of 9 MW to demonstrate LOFC accidents. The analytical results indicate that reactor power decreases from 9 MW to 0 MW owing to the negative reactivity feedback effect of the core, even if the reactor shutdown system is not activated. The total reactivity decreases for 2–3 h and then gradually increases in proportion to xenon reactivity; therefore, the HTTR achieves recritical after an elapsed time of 6–7 h, which is different from the elapsed time at reactor power peak occurrence. After the reactor power peak occurs, the total reactivity oscillates several times because of the negative reactivity feedback effect and gradually decreases to zero. Moreover, the new conclusions are as follows: the greater the amount of residual heat removed from the reactor core, the larger the stable reactor power after recriticality owing to the heat balance of the reactor system. The minimum reactor power and the reactor power peak occurrence are affected by the neutron source. The greater the
Negative effect of the 5'-untranslated leader sequence on Ac transposon promoter expression.
Scortecci, K C; Raina, R; Fedoroff, N V; Van Sluys, M A
1999-08-01
Transposable elements are used in heterologous plant hosts to clone genes by insertional mutagenesis. The Activator (Ac) transposable element has been cloned from maize, and introduced into a variety of plants. However, differences in regulation and transposition frequency have been observed between different host plants. The cause of this variability is still unknown. To better understand the activity of the Ac element, we analyzed the Ac promoter region and its 5'-untranslated leader sequence (5' UTL). Transient assays in tobacco NT1 suspension cells showed that the Ac promoter is a weak promoter and its activity was localized by deletion analyses. The data presented here indicate that the core of the Ac promoter is contained within 153 bp fragment upstream to transcription start sites. An important inhibitory effect (80%) due to the presence of the 5' UTL was found on the expression of LUC reporter gene. Here we demonstrate that the presence of the 5' UTL in the constructs reduces the expression driven by either strong or weak promoters.
An active magnetic bearing with high Tc superconducting coils and ferromagnetic cores
International Nuclear Information System (INIS)
Brown, G.V.; DiRusso, E.; Provenza, A.J.
1996-01-01
A proof-of-feasibility demonstration showed that high-T c , superconductor (HTS) coils can be used in a high-load, active magnetic bearing in LN 2 . A homopolar radial bearing with commercially wound HTS (Bi 2223) bias and control coils produced over 890 N (200 lb) radial load capacity (measured nonrotating) and supported a shaft to 14000 rpm. The goal was to show that HTS coils can operate stably with ferromagnetic cores in a feedback controlled system at a current density similar to that for Cu in LN 2 . The bias coil, wound with nontwisted, multifilament HTS conductor, dissipated negligible power for its direct current. The control coils, wound with monofilament HTS sheathed in Ag, dissipated negligible power for direct current. AC losses increased rapidly with frequency and quadratically with AC amplitude. Above about 2 Hz, the effective resistance of the control coils exceeds that of the silver which is in electrical parallel with the oxide superconductor. These results show that twisted multifilament conductor is not needed for stable levitation but may be desired to reduce control power for sizable dynamic loads
Power Electronic Transformer based Three-Phase PWM AC Drives
Basu, Kaushik
A Transformer is used to provide galvanic isolation and to connect systems at different voltage levels. It is one of the largest and most expensive component in most of the high voltage and high power systems. Its size is inversely proportional to the operating frequency. The central idea behind a power electronic transformer (PET) also known as solid state transformer is to reduce the size of the transformer by increasing the frequency. Power electronic converters are used to change the frequency of operation. Steady reduction in the cost of the semiconductor switches and the advent of advanced magnetic materials with very low loss density and high saturation flux density implies economic viability and feasibility of a design with high power density. Application of PET is in generation of power from renewable energy sources, especially wind and solar. Other important application include grid tied inverters, UPS e.t.c. In this thesis non-resonant, single stage, bi-directional PET is considered. The main objective of this converter is to generate adjustable speed and magnitude pulse width modulated (PWM) ac waveforms from an ac or dc grid with a high frequency ac link. The windings of a high frequency transformer contains leakage inductance. Any switching transition of the power electronic converter connecting the inductive load and the transformer requires commutation of leakage energy. Commutation by passive means results in power loss, decrease in the frequency of operation, distortion in the output voltage waveform, reduction in reliability and power density. In this work a source based partially loss-less commutation of leakage energy has been proposed. This technique also results in partial soft-switching. A series of converters with novel PWM strategies have been proposed to minimize the frequency of leakage inductance commutation. These PETs achieve most of the important features of modern PWM ac drives including 1) Input power factor correction, 2) Common
International Nuclear Information System (INIS)
Chae, Hee Taek; Lee, Kye Hong
1999-06-01
MATRA-h, a HANARO subchannel analysis computer code, is used to evaluate thermal margin of the HANARO fuel. It's capability includes the assessments of CHF, ONB margin, and fuel temperature. In this report, basic input data and core design parameters required to perform the subchannel analysis with MATRA-h code are collected. These data include the subchannel geometric data, thermal-hydraulic correlations, empirical constants and material properties. The friction and form loss coefficients of the fuel assemblies were determined based on the results of the pressure drop test. At the same time, different form loss coefficients at the end plates and spacers are evaluated for various subchannels. The adequate correlations are applied to the evaluation of the form loss coefficients for various subchannels, which are corrected by measured values in order to have a same pressure drop at each flow channel. These basic input data and design parameters described in this report will be applied usefully to evaluate the thermal margin of the HANARO fuel. (author). 11 refs., 13 tabs., 11 figs
Cache Locality-Centric Parallel String Matching on Many-Core Accelerator Chips
Tran, Nhat-Phuong; Lee, Myungho; Choi, Dong Hoon
2015-01-01
Aho-Corasick (AC) algorithm is a multiple patterns string matching algorithm commonly used in computer and network security and bioinformatics, among many others. In order to meet the highly demanding computational requirements imposed on these applications, achieving high performance for the AC algorithm is crucial. In this paper, we present a high performance parallelization of the AC on the many-core accelerator chips such as the Graphic Processing Unit (GPU) from Nvidia and...
A Simplified Model to Calculate AC Losses in Large 2G HTS Coils
DEFF Research Database (Denmark)
Song, Xiaowei (Andy); Mijatovic, Nenad; Jensen, Bogi Bech
2015-01-01
. The model presented uses H formulation which directly solves magnetic fields, and the general partial differential equations (PDEs) module in Comsol Multiphysics is used to implement the model. Afterwards, the model is used to simulate the excitation stage of a racetrack HTS coil with 350 tapes. The AC...
Vertical load analysis of cylindrical ACS support structures
International Nuclear Information System (INIS)
Kennedy, J.M.; Belytschko, T.B.
1984-01-01
A new concept in LMFBR design ACS (above-core structures) supports which has generated some interest is to use a single large radius cylinder. The advantages of a single cylinder are reduced cost of fabrication, increased lateral stiffness, which enhances seismic resistance, and easier access to the fuel. However, the performance of these support structures when submitted to vertical loads from the core area may be substantially different, for the buckling and postbuckling behavior of a cylinder differs substantially from that of cylindrical beams. In this paper, a comparative analysis of an old prototypical support by 4 columns is compared with a cylindrical support. It is assumed that the single cylinder replaces the 4 columns in the original design. The dimensions of the two designs are compared
AC conductivity and dielectric properties of bulk tungsten trioxide (WO3)
El-Nahass, M. M.; Ali, H. A. M.; Saadeldin, M.; Zaghllol, M.
2012-11-01
AC conductivity and dielectric properties of tungsten trioxide (WO3) in a pellet form were studied in the frequency range from 42 Hz to 5 MHz with a variation of temperature in the range from 303 K to 463 K. AC conductivity, σac(ω) was found to be a function of ωs where ω is the angular frequency and s is the frequency exponent. The values of s were found to be less than unity and decrease with increasing temperature, which supports the correlated barrier hopping mechanism (CBH) as the dominant mechanism for the conduction in WO3. The dielectric constant (ε‧) and dielectric loss (ε″) were measured. The Cole-Cole diagram determined complex impedance for different temperatures.
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
International Nuclear Information System (INIS)
Remmer, Hilke; Dieckhoff, Jan; Schilling, Meinhard; Ludwig, Frank
2015-01-01
We investigated the binding of biotinylated proteins to various streptavidin functionalized magnetic nanoparticles with different dynamic magnetic measurement techniques to examine their potential for homogeneous bioassays. As particle systems, single-core nanoparticles with a nominal core diameter of 30 nm as well as multi-core nanoparticles with hydrodynamic sizes varying between nominally 60 nm and 100 nm were chosen. As experimental techniques, fluxgate magnetorelaxometry (MRX), complex ac susceptibility (ACS) and measurements of the phase lag between rotating field and sample magnetization are applied. MRX measurements are only suited for the detection of small analytes if the multivalency of functionalized nanoparticles and analytes causes cross-linking, thus forming larger aggregates. ACS measurements showed for all nanoparticle systems a shift of the imaginary part's maximum towards small frequencies. In rotating field measurements only the single-core nanoparticle systems with dominating Brownian mechanism exhibit an increase of the phase lag upon binding in the investigated frequency range. The coexistence of Brownian and Néel relaxation processes can cause a more complex phase lag change behavior, as demonstrated for multi-core nanoparticle systems. - Highlights: • Cealization of homogeneous magnetic bioassays using different magnetic techniques. • Comparison of single- and multi-core nanoparticle systems. • ac Susceptibility favorable for detection of small analytes. • Magnetorelaxometry favorable for detection of large analytes or cross-linking assays
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
Measurement of AC losses in different former materials
DEFF Research Database (Denmark)
Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa
1998-01-01
candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible...
International Nuclear Information System (INIS)
Baranowsky, P.W.
1985-05-01
''Station Blackout,'' which is the complete loss of alternating current (ac) electrical power in a nuclear power plant, has been designated as Unresolved Safety Issue A-44. Because many safety systems required for reactor core decay heat removal and containment heat removal depend on ac power, the consequences of a station blackout could be severe. This report documents the findings of technical studies performed as part of the program to resolve this issue. The important factors analyzed include: the frequency of loss of offsite power; the probability that emergency or onsite ac power supplies would be unavailable; the capability and reliability of decay heat removal systems independent of ac power; and the likelihood that offsite power would be restored before systems that cannot operate for extended periods without ac power fail, thus resulting in core damage. This report also addresses effects of different designs, locations, and operational features on the estimated frequency of core damage resulting from station blackout events
International Nuclear Information System (INIS)
Albrecht, H.; Malinauskas, A.P.
1978-01-01
A few years ago the Projekt Nukleare Sicherheit joined the United States Nuclear Regulatory Commission in the development of a research program which was designed to investigate fission product release from light water reactor fuel under conditions ranging from spent fuel shipping cask accidents to core meltdown accidents. Three laboratories have been involved in this cooperative effort. At Argonne National Laboratory (ANL), the research effort has focused on noble gas fission product release, whereas at Oak Ridge National Laboratory (ORNL) and at Kernforschungszentrum Karlsruhe (KfK), the studies have emphasized the release of species other than the noble gases. In addition, the ORNL program has been directed toward the development of fission product source terms applicable to analyses of spent fuel shipping cask accidents and controlled loss-of-coolant accidents, and the KfK program has been aimed at providing similar source terms which are characteristic of core meltdown accidents. The ORNL results are presented for fission product release from defected fuel rods into a steam atmosphere over the temperature range 500 to 1200 0 C, and the KfK results for release during core meltdown sequences
International Nuclear Information System (INIS)
Wichner, R.P.
1977-01-01
To perform the assessment, a series of eight tube-rupture events of varying severity and probability were postulated. Case 1 pertains to the situation where the moisture detection, loop isolation, and dump procedures function as planned; the remaining seven cases suppose various defects in the moisture detection system, the core auxiliary coolant system, and the integrity of the prestressed concrete reactor vessel. Core post burnoffs beneath three typical fuel zones were estimated for each postulated event from the determined impurity compositions and core post temperature history. Two separate corrosion rate expressions were assumed, as deemed most appropriate of those published for the high-oxidant level typical in tube rupture events. It was found that the nominal core post beneath the highest power factor fuel zone would lose from 0.02 to 2.5 percent of their strength, depending on an assumed corrosion rate equation and the severity of the event. The effect of hot streaking during cooldown was determined by using preliminary estimates of its magnitude. It was found that localized strength loss beneath the highest power factor zone ranges from 0.23 to 12 percent, assuming reasonably probable hot-streaking circumstances. The combined worst case, hot streaking typical for a load-following transient and most severe accident sequence, yields an estimated strength loss of from 25 to 33 percent for localized regions beneath the highest power factor zones
El-Nahass, M. M.; Attia, A. A.; Ali, H. A. M.; Salem, G. F.; Ismail, M. I.
2018-02-01
The structural characteristics of thermally deposited ZnIn2Se4 thin films were indexed utilizing x-ray diffraction as well as scanning electron microscopy techniques. Dielectric properties, electric modulus and AC electrical conductivity of ZnIn2Se4 thin films were examined in the frequency range from 42 Hz to 106 Hz. The capacitance, conductance and impedance were measured at different temperatures. The dielectric constant and dielectric loss decrease with an increase in frequency. The maximum barrier height was determined from the analysis of the dielectric loss depending on the Giuntini model. The real part of the electric modulus revealed a constant maximum value at higher frequencies and the imaginary part of the electric modulus was characterized by the appearance of dielectric relaxation peaks. The AC electrical conductivity obeyed the Jonscher universal power law. Correlated barrier hopping model was the appropriate mechanism for AC conduction in ZnIn2Se4 thin films. Estimation of the density of states at the Fermi level and activation energy, for AC conduction, was carried out based on the temperature dependence of AC electrical conductivity.
International Nuclear Information System (INIS)
Jung, Woo Sik; Yang, Joon Eun
2003-07-01
In order to evaluate accurately a Station BlackOut (SBO) event frequency of a multi-unit nuclear power plant that has a shared Alternate AC (AAC) power source, an approach has been developed which accommodates the complex inter-unit behavior of the shared AAC power source under multi-unit Loss Of Offsite Power (LOOP) conditions. The approach is illustrated for two cases, 2 units and 4 units at a single site, and generalized for a multi-unit site. Furthermore, the SBO frequency of the first unit of the 2-unit site is quantified. The SBO frequency at a target unit of Probabilistic Safety Assessment (PSA) could be underestimated if the inter-unit dependency of the shared AAC power source is not properly modeled. The effect of the inter-unit behavior of the shared AAC power source on the SBO frequency is not negligible depending on the Common Cause Failure (CCF) characteristics among AC power sources. The methodology suggested in the present report is believed to be very useful in evaluating the SBO frequency and the core damage frequency resulting from the SBO event. This approach is also applicable to the probabilistic evaluation of the other shared systems in a multi-unit nuclear power plant
Comparative evaluation of soft-switching, bidirectional, isolated AC/DC converter topologies
Everts, J.; Krismer, F.; Van den Keybus, J.; Driesen, Johan; Kolar, J.W.
2012-01-01
For realizing bidirectional and isolated AC/DC converters, soft-switching techniques/topologies seem to be a favourable choice as they enable a further loss and volume reduction of the system. Contrary to the traditional dual-stage approach, using a power factor corrector (PFC) stage in series with
A Multi-Functional Fully Distributed Control Framework for AC Microgrids
DEFF Research Database (Denmark)
Shafiee, Qobad; Nasirian, Vahidreza; Quintero, Juan Carlos Vasquez
2018-01-01
This paper proposes a fully distributed control methodology for secondary control of AC microgrids. The control framework includes three modules: voltage regulator, reactive power regulator, and active power/frequency regulator. The voltage regulator module maintains the average voltage of the mi......This paper proposes a fully distributed control methodology for secondary control of AC microgrids. The control framework includes three modules: voltage regulator, reactive power regulator, and active power/frequency regulator. The voltage regulator module maintains the average voltage...... of the microgrid distribution line at the rated value. The reactive power regulator compares the local normalized reactive power of an inverter with its neighbors’ powers on a communication graph and, accordingly, fine-tunes Q-V droop coefficients to mitigate any reactive power mismatch. Collectively, these two....../reactive power sharing. An AC microgrid is prototyped to experimentally validate the proposed control methodology against the load change, plug-and-play operation, and communication constraints such as delay, packet loss, and limited bandwidth....
Neural network based PWM AC chopper fed induction motor drive
Directory of Open Access Journals (Sweden)
Venkatesan Jamuna
2009-01-01
Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .
Directory of Open Access Journals (Sweden)
Dicky Tri Utama
2018-02-01
Full Text Available Objective This study observed the effects of cooking method and final core temperature on cooking loss, lipid oxidation, aroma volatiles, nucleotide-related compounds and aroma volatiles of Hanwoo brisket (deep pectoralis. Methods Deep pectoralis muscles (8.65% of crude fat were obtained from three Hanwoo steer carcasses with 1+ quality grade. Samples were either oven-roasted at 180°C (dry heat or cooked in boiling water (moist heat to final core temperature of 70°C (medium or 77°C (well-done. Results Boiling method reduced more fat but retained more moisture than did the oven roasting method (p<0.001, thus no significant differences were found on cooking loss. However, samples lost more weight as final core temperature increased (p<0.01. Further, total saturated fatty acid increased (p = 0.02 while total monounsaturated fatty acid decreased (p = 0.03 as final core temperature increased. Regardless the method used for cooking, malondialdehyde (p<0.01 and free iron contents (p<0.001 were observed higher in samples cooked to 77°C. Oven roasting retained more inosinic acid, inosine and hypoxanthine in samples than did the boiling method (p<0.001, of which the concentration decreased as final core temperature increased except for hypoxanthine. Samples cooked to 77°C using oven roasting method released more intense aroma than did the others and the aroma pattern was discriminated based on the intensity. Most of aldehydes and pyrazines were more abundant in oven-roasted samples than in boiled samples. Among identified volatiles, hexanal had the highest area unit in both boiled and oven-roasted samples, of which the abundance increased as the final core temperature increased. Conclusion The boiling method extracted inosinic acid and rendered fat from beef brisket, whereas oven roasting intensified aroma derived from aldehydes and pyrazines and prevented the extreme loss of inosinic acid.
Loss optimizing low power 50 Hz transformers intended for AC/DC standby power supplies
DEFF Research Database (Denmark)
Nielsen, Nils
2004-01-01
This paper presents the measured efficiency on selected low power conventional 50 Hz/230 V-AC transformers. The small transformers are intended for use in 1 W@5 V-DC series- or buck-regulated power supplies for standby purposes. The measured efficiency is compared for cheap off-the-self transformer...
International Nuclear Information System (INIS)
Fathabadi, Hassan
2014-01-01
Highlights: • Novel hybrid power source including AC feature for using in electric/hybrid vehicles. • Minimizing the energy loss in electric/hybrid vehicles by using the proposed system. • Suitable AC wave form for braking/accelerating purposes in electric/hybrid vehicles. • A novelty is that the harmonic generated by the added AC feature is really zero. • Another novelty is the capability of choosing arbitrary frequency for AC feature. - Abstract: This paper presents a novel hybrid power source, including a Li-ion battery together with an interface, which generates simultaneously electrical energy with the forms of both DC and AC for electric vehicles. A novel and high benefits approach is applied to convert the electrical energy of the Li-ion battery from DC form to single-phase symmetric pulse-width modulation (PWM)-AC form. Harmonic generation is one of the important problems when electrical energy is converted from DC to AC but there are not any generated harmonic during the DC/AC conversion using the proposed technique. The proposed system will be widely used in electric/hybrid vehicles because it has many benefits. Minimizing the energy loss (saving energy), no generated harmonic (it is really zero), the capability of arbitrary/necessary frequency selection for output AC voltage and the ability of long distance energy transmission are some novelties and advantages of the proposed system. The proposed hybrid power source including DC/AC PWM inverter is simulated in Proteus 6 software environment and a laboratory-based prototype of the hybrid power source is constructed to validate the theoretical and simulation results. Simulation and experimental results are presented to prove the superiority of the proposed hybrid power supply
DEFF Research Database (Denmark)
Ding, Yunhong; Ye, Feihong; Peucheret, Christophe
2014-01-01
We design and fabricate a compact multi-core fiber fan-in/fan-out using a fully-etched grating coupler array on the SOI platform. Lowest coupling loss of 6.8 dB with 3 dB bandwidth of 48 nm and crosstalk lower than ×32 dB are demonstrated.......We design and fabricate a compact multi-core fiber fan-in/fan-out using a fully-etched grating coupler array on the SOI platform. Lowest coupling loss of 6.8 dB with 3 dB bandwidth of 48 nm and crosstalk lower than ×32 dB are demonstrated....
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Nonmonotonic low frequency losses in HTSCs
International Nuclear Information System (INIS)
Castro, H; Gerber, A; Milner, A
2007-01-01
A calorimetric technique has been used in order to study ac-field dissipation in ceramic BSCCO samples at low frequencies between 0.05 and 250 Hz, at temperatures from 65 to 90 K. In contrast to previous studies, where ac losses have been reported with a linear dependence on magnetic field frequency, we find a nonmonotonic function presenting various maxima. Frequencies corresponding to local maxima of dissipation depend on the temperature and the amplitude of the ac magnetic field. Flux creep is argued to be responsible for this behaviour. A simple model connecting the characteristic vortex relaxation times (flux creep) and the location of dissipation maxima versus frequency is proposed
International Nuclear Information System (INIS)
Shikama, T.; Narui, M.; Sagawa, T.
1998-01-01
Pure, OH-doped and F-doped silica core optical fibers were irradiated in a fission reactor at 400±10 K using an electric heater at a reactor power greater than 10 MW (20% of the full power). The temperature was not controlled well at the early stage of the reactor startup, when the temperature was about 320-340 K. The optical fibers were irradiated with a fast neutron (E>1 MeV) flux of 3.2 x 10 17 n/cm 2 s and a gamma dose rate of 3 x 10 3 Gy/s for 527 h. Optical transmission loss at 850 nm was measured in situ during irradiation. A prompt increase in optical transmission loss was observed as irradiation started, which was probably due to dynamic irradiation effects caused by short-lived and transient defects and is probably recoverable when irradiation ceases. After the prompt increase in optical transmission loss, a so-called radiation hardening was observed in fibers containing OH. Radiation hardening was also observed in 900 ppm OH-doped fiber at the second startup. The optical transmission loss increased linearly with irradiation dose, denoted as the accumulated loss, which we believe is due to irradiation-induced long-lived defects. Accumulated loss dominates radiation-induced optical transmission loss in a fission reactor irradiation. (orig.)
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
Low AC Loss in a 3 kA HTS Cable of the Dutch Project
DEFF Research Database (Denmark)
Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan
2012-01-01
Requirements for a 6km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in th...
A nuclear reactor core fuel reload optimization using Artificial-Ant-Colony Connective Networks
International Nuclear Information System (INIS)
Lima, Alan M.M. de; Schirru, Roberto
2005-01-01
A Pressurized Water Reactor core must be reloaded every time the fuel burnup reaches a level when it is not possible to sustain nominal power operation. The nuclear core fuel reload optimization consists in finding a burned-up and fresh-fuel-assembly pattern that maximizes the number of full operational days. This problem is NP-hard, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Besides that, the problem is non-linear and its search space is highly discontinual and multimodal. In this work a parallel computational system based on Ant Colony System (ACS) called Artificial-Ant-Colony Networks is introduced to solve the nuclear reactor core fuel reload optimization problem. ACS is a system based on artificial agents that uses the reinforcement learning technique and was originally developed to solve the Traveling Salesman Problem, which is conceptually similar to the nuclear fuel reload problem. (author)
Physical aspects of magnetic hyperthermia: Low-frequency ac field absorption in a magnetic colloid
International Nuclear Information System (INIS)
Raikher, Yu. L.; Stepanov, V.I.
2014-01-01
A uniaxially anisotropic superparamagnetic particle suspended in a viscous fluid and subjected to an ac field is considered. Consistently taking into account both internal (Néel) and external (Brownian) magnetic relaxations, a simple expression for the dynamic susceptibility is obtained. This result, with regard to the ac field energy absorption, is compared to the common heuristic approach. This is done for a model polydisperse colloid containing maghemite nanoparticles, which are assumed to posses either bulk or surface magnetic anisotropy. It is shown that viscous losses caused by the particle motion in a fluid matrix make important contribution to the full magnetic response of a ferrocolloid and, thus, its ability to absorb the ac field energy. The obtained exact expression, which takes in both dissipation mechanisms, paves the way to correct optimization of the nanoparticle-mediated heating effect. - Highlights: • A uniaxially anisotropic superparamagnetic particle suspended in a viscous fluid and subjected to an ac field is considered. • Consistently taking into account both internal (Néel) and external (Brownian) magnetic relaxations, a simple expression for the dynamic susceptibility is obtained. • This result, with regard to the ac field energy absorption, is compared to the common heuristic approach using as a benchmark a model polydisperse colloid containing maghemite nanoparticles, which are assumed to posses either bulk or surface magnetic anisotropy. • It is shown that viscous losses caused by the particle motion in a fluid matrix make important contribution to the full magnetic response of a ferrocolloid and, thus, its ability to absorb the ac field energy. • The obtained exact expression, which takes in both dissipation mechanisms, paves the way to correct optimization of the nanoparticle-mediated heating effect
Analysis of core damage frequency from internal events: Peach Bottom, Unit 2
International Nuclear Information System (INIS)
Kolaczkowski, A.M.; Lambright, J.A.; Ferrell, W.L.; Cathey, N.G.; Najafi, B.; Harper, F.T.
1986-10-01
This document contains the internal event initiated accident sequence analyses for Peach Bottom, Unit 2; one of the reference plants being examined as part of the NUREG-1150 effort by the Nuclear Regulatory Commission. NUREG-1150 will document the risk of a selected group of nuclear power plants. As part of that work, this report contains the overall core damage frequency estimate for Peach Bottom, Unit 2, and the accompanying plant damage state frequencies. Sensitivity and uncertainty analyses provided additional insights regarding the dominant contributors to the Peach Bottom core damage frequency estimate. The mean core damage frequency at Peach Bottom was calculated to be 8.2E-6. Station blackout type accidents (loss of all ac power) were found to dominate the overall results. Anticipated Transient Without Scram accidents were also found to be non-negligible contributors. The numerical results are largely driven by common mode failure probability estimates and to some extent, human error. Because of significant data and analysis uncertainties in these two areas (important, for instance, to the most dominant scenario in this study), it is recommended that the results of the uncertainty and sensitivity analyses be considered before any actions are taken based on this analysis
Compensation methods applied in current control schemes for large AC drive systems
DEFF Research Database (Denmark)
Rus, D. C.; Preda, N. S.; Teodorescu, Remus
2012-01-01
The paper deals with modified PI current control structures for large AC drive systems which use surface mounted permanent magnet synchronous machines or squirrel-cage induction motors supplied with voltage source inverters. In order to reduce the power losses caused by high frequency switching...
International Nuclear Information System (INIS)
Noji, H; Haji, K; Hamada, T
2003-01-01
We have calculated the alternating current (ac) losses of a 114 MVA high-T C superconducting (HTS) transmission cable using an electric-circuit (EC) model. The HTS cable is fabricated by Tokyo Electric Power Company and Sumitomo Electric Industries, Ltd. The EC model is comprised of a resistive part and an inductive part. The resistive part is obtained by the approximated Norris equation for a HTS tape. The Norris equation indicates hysteresis losses due to self-fields. The inductive part has two components, i.e. inductances related to axial fields and those related to circumferential fields. The layer currents and applied fields of each layer were calculated by the EC model. By using both values, the ac losses of the one-phase HTS cable were obtained by calculation considering the self-field, the axial field and the circumferential field of the HTS tape. The measured ac loss transporting 1 kA rms is 0.7 W m -1 ph -1 , which is equal to the calculation. The distribution of each layer loss resembles in shape the distribution of the circumferential field in each layer, which indicates that the circumferential fields strongly influence the ac losses of the HTS cable
Energy Technology Data Exchange (ETDEWEB)
Lee, K.M.; Park, S.Y. [Department of Materials Science and Engineering, Korea University, 5-1, Anam-dong, Sungbuk-Gu, Seoul 136-701 (Korea, Republic of); Huh, M.Y., E-mail: myhuh@korea.ac.kr [Department of Materials Science and Engineering, Korea University, 5-1, Anam-dong, Sungbuk-Gu, Seoul 136-701 (Korea, Republic of); Kim, J.S. [Electrical Steel Sheet Research Group, Technical Research Laboratories, POSCO, Goedong-dong, Pohang (Korea, Republic of); Engler, O. [Hydro Aluminium Rolled Products GmbH, R and D Center Bonn, P.O. Box 2468, D-53014 Bonn (Germany)
2014-03-15
In an attempt to differentiate the impact of grain size and crystallographic texture on magnetic properties of non-oriented (NO) electrical steel sheets, samples with different grain sizes and textures were produced and analyzed regarding magnetic flux density B and core loss W. The textures of the NO electrical steel samples could be precisely quantified with the help of elliptical Gaussian distributions. In samples with identical textures, small grain sizes resulted in about 15% higher core loss W than larger grains, whereas grain size only moderately affected the magnetic flux density B. In samples having nearly the same grain size, a correlation of the magneto-crystalline anisotropic properties of B and W with texture was obtained via the anisotropy parameter A(h{sup →}). With increasing A(h{sup →}) a linear decrease of B and a linear increase of W were observed. - Highlights: • We produced electrical steel sheets having different grain size and texture. • Magnetic flux density B and core loss W were varied with grain size and texture. • Correlation of B and W with texture was established via anisotropy parameter A(h{sup →}). • With increasing A(h{sup →}) a linear decrease of B and a linear increase of W were observed. • Grain size mainly affected W with only minor impact on B.
International Nuclear Information System (INIS)
Yonomoto, Taisuke
1996-05-01
Objectives of the present study are to obtain a better understanding of entrainment at a break and in the core during small break loss-of-coolant-accidents (SBLOCAs) in PWRs, and to develop a means for the best evaluation of the phenomena. For the study of entrainment at a break, a theoretical model was developed, which was assessed by comparisons with several experimental data bases. By modifying a LOCA analysis code using the present model, experimental results obtained from SBLOCA experiments at a PWR large-scale simulator were reproduced very well. For the study of entrainment in the core, reflooding experiments were conducted at high pressure, from which the onset conditions were obtained. It was confirmed that the cooling behavior for a dry-out core is very simple under typical high pressure reflooding conditions for PWRs, because liquid entrainment does not occur in the core. (author)
International Nuclear Information System (INIS)
Höhne, Thomas; Grahn, Alexander; Kliem, Sören; Rohde, Ulrich; Weiss, Frank-Peter
2013-01-01
Highlights: ► Detailed results of a numerical simulation of the insulation material transport to a PWR core are shown. ► The spacer grid is modeled as a strainer which completely retains the insulation material carried by coolant. ► The CFD calculations showed that the fibers at the upper spacer grid plane are not uniformly distributed. ► Furthermore the pressure loss does not exceed a critical limit. ► The PWR core coolablity can be guaranteed all the time during the transient. -- Abstract: In 1992, strainers on the suction side of the ECCS pumps in Barsebäck NPP Unit 2 became partially clogged with mineral wool because after a safety valve opened the steam impinged on thermally insulated equipment and released mineral wool. This event pointed out that strainer clogging is an issue in the course of a loss-of-coolant accident. Modifications of the insulation material, the strainer area and mesh size were carried out in most of the German NPPs. Moreover, back flushing procedures to remove the mineral wool from the strainers and differential pressure measurements were implemented to assure the performance of emergency core cooling during the containment sump recirculation mode. Nevertheless, it cannot be completely ruled out, that a limited amount of small fractions of the insulation material is transported into the RPV. During a postulated cold leg LOCA with hot leg ECC injection, the fibers enter the upper plenum and can accumulate at the fuel element spacer grids, preferably at the uppermost grid level. This effect might affect the ECC flow into the core and could result in degradation of core cooling. It was the aim of the numerical simulations presented to study where and how many mineral wool fibers are deposited at the upper spacer grid. The 3D, time dependent, multi-phase flow problem was modeled applying the CFD code ANSYS CFX. The CFD calculation does not yet include steam production in the core and also does not include re-suspension of the
The complex ac susceptibility of superconducting Y-Ba-CuO thin film and bulk samples
International Nuclear Information System (INIS)
Lobotka, P.; Goemoery, F.
1988-01-01
Complex ac susceptibility measurements as function of temperature on Y-Ba-CuO superconductors are reported. A strong dependence of the susceptibility curves on the ac field magnitude and little influence of the superimposed dc field are observed on both, thin film and bulk samples. The susceptibilities of these materials are frequency independent in the range 30 to 7200 Hz what demonstrates the negligible role of eddy currents. A second peak in the imaginary part of susceptibility is observed in the bulk sample at higher levels of ac field. This implies the existence of another component in the sample with higher T c and lower losses. (author)
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
International Nuclear Information System (INIS)
Zhang Longcai; Wang Jiasu; Wang Suyu; He Qingyong
2007-01-01
Superconducting maglev vehicle system requires that the surface magnetic field of the guideway is uniform along the forward direction. But in practice the surface magnetic field of the NdFeB permanent magnet guideway is not always immutable. So the HTS bulks in this case are exposed to AC external magnetic field, which may induce the energy loss in the bulk and influence the guidance force between the HTS bulks and the NdFeB guideway. In this paper, we experimentally studied the influence of the AC external magnetic field perturbation on the guidance force of a HTS bulk over the NdFeB guideway. The experimental results showed that the guidance force was influenced by the application of the AC external magnetic. The guidance fore hysteresis became more evident with the amplitude of the AC field and was independent of the frequency in the range 90-400 Hz. We attributed the reason to magnetic hysteresis loss in the superconductor
Energy Technology Data Exchange (ETDEWEB)
Zhang Longcai [Applied Superconductivity Laboratory, Southwest Jiaotong University, P.O. Box 152, Chengdu, Sichuan 610031 (China)]. E-mail: zhlcai2000@163.com; Wang Jiasu [Applied Superconductivity Laboratory, Southwest Jiaotong University, P.O. Box 152, Chengdu, Sichuan 610031 (China); Wang Suyu [Applied Superconductivity Laboratory, Southwest Jiaotong University, P.O. Box 152, Chengdu, Sichuan 610031 (China); He Qingyong [Applied Superconductivity Laboratory, Southwest Jiaotong University, P.O. Box 152, Chengdu, Sichuan 610031 (China)
2007-08-01
Superconducting maglev vehicle system requires that the surface magnetic field of the guideway is uniform along the forward direction. But in practice the surface magnetic field of the NdFeB permanent magnet guideway is not always immutable. So the HTS bulks in this case are exposed to AC external magnetic field, which may induce the energy loss in the bulk and influence the guidance force between the HTS bulks and the NdFeB guideway. In this paper, we experimentally studied the influence of the AC external magnetic field perturbation on the guidance force of a HTS bulk over the NdFeB guideway. The experimental results showed that the guidance force was influenced by the application of the AC external magnetic. The guidance fore hysteresis became more evident with the amplitude of the AC field and was independent of the frequency in the range 90-400 Hz. We attributed the reason to magnetic hysteresis loss in the superconductor.
Suggested Methods for Preventing Core Saturation Instability in HVDC Transmission Systems
Energy Technology Data Exchange (ETDEWEB)
Norheim, Ian
2002-07-01
In this thesis a study of the HVDC related phenomenon core saturation instability and methods to prevent this phenomenon is performed. It is reason to believe that this phenomenon caused disconnection of the Skagerrak HVDC link 10 August 1993. Internationally, core saturation instability has been reported at several HVDC schemes and thorough complex studies of the phenomenon has been performed. This thesis gives a detailed description of the phenomenon and suggest some interesting methods to prevent the development of it. Core saturation instability and its consequences can be described in a simplified way as follows: It is now assumed that a fundamental harmonic component is present in the DC side current. Due to the coupling between the AC side and the DC side of the HVDC converter, a subsequent second harmonic positive-sequence current and DC currents will be generated on the AC side. The DC currents will cause saturation in the converter transformers. This will cause the magnetizing current to also have a second harmonic positive-sequence component. If a high second harmonic impedance is seen from the commutation bus, a high positive-sequence second harmonic component will be present in the commutation voltages. This will result in a relatively high fundamental frequency component in the DC side voltage. If the fundamental frequency impedance at the DC side is relatively low the fundamental component in the DC side current may become larger than it originally was. In addition the HVDC control system may contribute to the fundamental frequency component in the DC side voltage, and in this way cause a system even more sensitive to core saturation instability. The large magnetizing currents that eventually will flow on the AC side cause large zero-sequence currents in the neutral conductors of the AC transmission lines connected to the HVDC link. This may result in disconnection of the lines. Alternatively, the harmonics in the large magnetizing currents may cause
Development of Nb3Sn AC superconducting wire. Pt. 2
International Nuclear Information System (INIS)
Kasahara, Hobun; Torii, Shinji; Akita, Shirabe; Ueda, Kiyotaka; Kubota, Yoji; Yasohama, Kazuhiko; Kobayashi, Hisayasu; Ogasawara, Takeshi.
1993-01-01
For the realization of superconducting power apparatus, it is important that the development of highly stable superconducting cables. Nb 3 Sn wire has higher critical temperature than NbTi wire. Therefore, it is possible to make highly stable superconducting wires. In this report, we examine a manufacturing process of Ac Nb 3 Sn wire. This manufacturing process has four times higher critical current density than conventional processes. We have made a 400 kVA class AC coil with React and Wind method. The loss density of this coil was 20MW/m 3 at just before the quench. In this case, the temperature of cable increased about 3.8 K. This means that the Nb 3 Sn coil has a very high stability. (author)
Effect of alkali content on AC conductivity of borate glasses containing two transition metals
International Nuclear Information System (INIS)
Kashif, I.; Rahman, Samy A.; Soliman, A.A.; Ibrahim, E.M.; Abdel-Khalek, E.K.; Mostafa, A.G.; Sanad, A.M.
2009-01-01
Sodium borate glasses containing iron and molybdenum ions with the total concentration of transition ions constant and gradual substitution of sodium oxide (network modifier) by borate oxide (network former) was prepared. Densities, molar volume, DC and AC conductivities are measured. The trends of these properties are attributed to changes in the glass network structure. Their DC and AC conductivity increased with increasing NaO concentration. The increase of AC conductivity of sodium borate glasses is attributed to the chemical composition and the hopping mechanism of conduction. Measurements of the dielectric constant (ε) and dielectric loss (tan δ) as a function of frequency (50 Hz-100 kHz) and temperature (RT-600 K) indicate that the increase in dielectric constant and loss (ε and tan δ) values with increasing sodium ion content could be attributed to the assumption that Fe and Mo ions tend to assume network-forming position in the glass compositions studied. The variation of the value of frequency exponent s for all glass samples as the function of temperature at a definite frequency indicates that the value of s decreases with increasing the temperature which agrees with the correlated barrier-hopping (CBH) model.
Effective particle magnetic moment of multi-core particles
Energy Technology Data Exchange (ETDEWEB)
Ahrentorp, Fredrik; Astalan, Andrea; Blomgren, Jakob; Jonasson, Christian [Acreo Swedish ICT AB, Arvid Hedvalls backe 4, SE-411 33 Göteborg (Sweden); Wetterskog, Erik; Svedlindh, Peter [Department of Engineering Sciences, Uppsala University, Box 534, SE-751 21 Uppsala (Sweden); Lak, Aidin; Ludwig, Frank [Institute of Electrical Measurement and Fundamental Electrical Engineering, TU Braunschweig, D‐38106 Braunschweig Germany (Germany); IJzendoorn, Leo J. van [Department of Applied Physics, Eindhoven University of Technology, 5600 MB Eindhoven (Netherlands); Westphal, Fritz; Grüttner, Cordula [Micromod Partikeltechnologie GmbH, D ‐18119 Rostock (Germany); Gehrke, Nicole [nanoPET Pharma GmbH, D ‐10115 Berlin Germany (Germany); Gustafsson, Stefan; Olsson, Eva [Department of Applied Physics, Chalmers University of Technology, SE-412 96 Göteborg (Sweden); Johansson, Christer, E-mail: christer.johansson@acreo.se [Acreo Swedish ICT AB, Arvid Hedvalls backe 4, SE-411 33 Göteborg (Sweden)
2015-04-15
In this study we investigate the magnetic behavior of magnetic multi-core particles and the differences in the magnetic properties of multi-core and single-core nanoparticles and correlate the results with the nanostructure of the different particles as determined from transmission electron microscopy (TEM). We also investigate how the effective particle magnetic moment is coupled to the individual moments of the single-domain nanocrystals by using different measurement techniques: DC magnetometry, AC susceptometry, dynamic light scattering and TEM. We have studied two magnetic multi-core particle systems – BNF Starch from Micromod with a median particle diameter of 100 nm and FeraSpin R from nanoPET with a median particle diameter of 70 nm – and one single-core particle system – SHP25 from Ocean NanoTech with a median particle core diameter of 25 nm.
Effective particle magnetic moment of multi-core particles
International Nuclear Information System (INIS)
Ahrentorp, Fredrik; Astalan, Andrea; Blomgren, Jakob; Jonasson, Christian; Wetterskog, Erik; Svedlindh, Peter; Lak, Aidin; Ludwig, Frank; IJzendoorn, Leo J. van; Westphal, Fritz; Grüttner, Cordula; Gehrke, Nicole; Gustafsson, Stefan; Olsson, Eva; Johansson, Christer
2015-01-01
In this study we investigate the magnetic behavior of magnetic multi-core particles and the differences in the magnetic properties of multi-core and single-core nanoparticles and correlate the results with the nanostructure of the different particles as determined from transmission electron microscopy (TEM). We also investigate how the effective particle magnetic moment is coupled to the individual moments of the single-domain nanocrystals by using different measurement techniques: DC magnetometry, AC susceptometry, dynamic light scattering and TEM. We have studied two magnetic multi-core particle systems – BNF Starch from Micromod with a median particle diameter of 100 nm and FeraSpin R from nanoPET with a median particle diameter of 70 nm – and one single-core particle system – SHP25 from Ocean NanoTech with a median particle core diameter of 25 nm
Effective particle magnetic moment of multi-core particles
Ahrentorp, Fredrik; Astalan, Andrea; Blomgren, Jakob; Jonasson, Christian; Wetterskog, Erik; Svedlindh, Peter; Lak, Aidin; Ludwig, Frank; van IJzendoorn, Leo J.; Westphal, Fritz; Grüttner, Cordula; Gehrke, Nicole; Gustafsson, Stefan; Olsson, Eva; Johansson, Christer
2015-04-01
In this study we investigate the magnetic behavior of magnetic multi-core particles and the differences in the magnetic properties of multi-core and single-core nanoparticles and correlate the results with the nanostructure of the different particles as determined from transmission electron microscopy (TEM). We also investigate how the effective particle magnetic moment is coupled to the individual moments of the single-domain nanocrystals by using different measurement techniques: DC magnetometry, AC susceptometry, dynamic light scattering and TEM. We have studied two magnetic multi-core particle systems - BNF Starch from Micromod with a median particle diameter of 100 nm and FeraSpin R from nanoPET with a median particle diameter of 70 nm - and one single-core particle system - SHP25 from Ocean NanoTech with a median particle core diameter of 25 nm.
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
AC-DC integrated load flow calculation for variable speed offshore wind farms
DEFF Research Database (Denmark)
Zhao, Menghua; Chen, Zhe; Blaabjerg, Frede
2005-01-01
This paper proposes a sequential AC-DC integrated load flow algorithm for variable speed offshore wind farms. In this algorithm, the variable frequency and the control strategy of variable speed wind turbine systems are considered. In addition, the losses of wind turbine systems and the losses...... of converters are also integrated into the load flow algorithm. As a general algorithm, it can be applied to different types of wind farm configurations, and the load flow is related to the wind speed....
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
El-Shabaan, M. M.
2018-02-01
Impedance spectroscopy and alternating-current (AC) conductivity (σ AC) studies of bulk 3-amino-7-(dimethylamino)-2-methyl-hydrochloride (neutral red, NR) have been carried out over the temperature (T) range from 303 K to 383 K and frequency (f) range from 0.5 kHz to 5 MHz. Dielectric data were analyzed using the complex impedance (Z *) and complex electric modulus (M *) for bulk NR at various temperatures. The impedance loss peaks were found to shift towards high frequencies, indicating an increase in the relaxation time (τ 0) and loss in the material, with increasing temperature. For each temperature, a single depressed semicircle was observed at high frequencies, originating from the bulk transport, and a spike in the low-frequency region, resulting from the electrode effect. Fitting of these curves yielded an equivalent circuit containing a parallel combination of a resistance R and constant-phase element (CPE) Q. The carrier transport in bulk NR is governed by the correlated barrier hopping (CBH) mechanism, some parameters of which, such as the maximum barrier height (W M), charge density (N), and hopping distance (r), were determined as functions of both temperature and frequency. The frequency dependence of σ AC at different temperatures indicated that the conduction in bulk NR is a thermally activated process. The σ AC value at different frequencies increased linearly with temperature.
Accidents of loss of flow for the ETTR-2 reactor; deterministic analysis
International Nuclear Information System (INIS)
El-Messiry, A.M.
2000-01-01
The main objective for reactor safety is to keep the fuel in a thermally safe condition with adequate safety margins during all operational modes (normal-abnormal and accidental states). To achieve this purpose an accident analysis of different design base accident (DBA) as loss of flow accident (LOFA), is required assessing reactor safety. The present work concerns this transients applied to Egypt Test and Research Reactor ETRR-3 (new reactor). An accident analysis code FLOWTR is developed to investigate the thermal behaviour of the core during such flow transients. The active core is simulated by two channels: 1 - hot channel (HC), and 2 - average channel (AC) representing the remainder of the core. Each channel is divided into four axial sections. The external loop, core plenums, and core chimney are simulated by different dynamic loops. The code includes modules for pump cast down, flow regimes, decay heat, temperature distributions, and feedback coefficients. FLOWTR is verified against results from RETRAN code, THERMIC code and commissioning tests for null transient case. The comparison shows a good agreement. The study indicates that for LOFA transients, provided the scram system is available, the core is shutdown safely by low flow signal (496.6 kg/s) at 1.4 s were the HC temperature reaches the maximum value, 45.64 o C after shutdown. On the other hand, if the scram system is unavailable, and at t = 47.33 s, the core flow decreases to 67.41 kg/s, the HC temperature increases to 164.02 o C, and the HC clad surface heat flux exceeds its critical value of 400.00 W/cm 2 resulting of fuel burnout. (author)
Alternating magnetic field losses in ATLAS type aluminium stabilized NbTi superconductors
Boxman, E W; ten Kate, H H J
2002-01-01
During ramping up- and down of the current in large-scale magnets the ramp losses are an important factor affecting the thermal and electro-magnetic stability of the system. The calculation of the losses is not straightforward due to the large dimensions of the conductor (~600 mm/sup 2/) implying that diffusion effects have to be taken into account. The AC-losses of the Al stabilized NbTi cable conductors used in the ATLAS magnet system were measured in 0.5 m long samples, using an inductive method with pick-up coils as well as the calorimetric method. External varying magnetic fields up to 2 tesla amplitude were applied parallel and perpendicular to the conductor wide surface. The results are compared to theory. It is found that hysteresis loss, eddy current loss in the Aluminum cladding and cable-to-cladding coupling loss contribute most to the AC loss. (5 refs).
International Nuclear Information System (INIS)
Nilsson, Lars.
1993-01-01
In foregoing SIK-2.2 project two severe accident sequences for Forsmark 3 comprising loss of electric power (Total Blackout, TB) without recovery actions (e.g. emergency cooling) were analysed with SCDAP/RELAP5. Code version MOD2.5/V3f was applied and a single core channel input model was used. Present analysis was done with the same initiating events as in SIK-2.2, but assuming recovery of auxiliary feed water and/or emergency core cooling systems to take place after heat-up of the core, in compliance with the plans of the SIK-2.3 project. A new test version of the SCDAP/RELAP5 code, version MOD3/V7af, was used here. The geometrical input model was extended from having one, into five parallel core zones, still with ten axial core sub volumes. Calculations were performed for three TB cases, one without cooling recovery, and two with injection of cold water at a rate of 45 kg/s, beginning when the maximum cladding temperature has reached 1522 K. The results show that a considerably more efficient cooling was obtained spraying the water to the top of the core, compared to the case where the cooling water was introduced into the downcomer, leading to bottom reflooding
van Leeuwen, Lisette M; Merkus, Paul; Pronk, Marieke; van der Torn, Marein; Maré, Marcel; Goverts, S Theo; Kramer, Sophia E
The International Classification of Functioning Disability and Health (ICF) Core Sets for Hearing Loss (HL) were developed to serve as a standard for the assessment and reporting of the functioning and health of patients with HL. The aim of the present study was to compare the content of the intake documentation currently used in secondary and tertiary hearing care settings in the Netherlands with the content of the ICF Core Sets for HL. Research questions were (1) to what extent are the ICF Core Sets for HL represented in the Dutch Otology and Audiology intake documentation? (2) are there any extra ICF categories expressed in the intake documentation that are currently not part of the ICF Core Sets for HL, or constructs expressed that are not part of the ICF? Multicenter patient record study including 176 adult patients from two secondary, and two tertiary hearing care settings. The intake documentation was selected from anonymized patient records. The content was linked to the appropriate ICF category from the whole ICF classification using established linking rules. The extent to which the ICF Core Sets for HL were represented in the intake documentation was determined by assessing the overlap between the ICF categories in the Core Sets and the list of unique ICF categories extracted from the intake documentation. Any extra constructs that were expressed in the intake documentation but are not part of the Core Sets were described as well, differentiating between ICF categories that are not part of the Core Sets and constructs that are not part of the ICF classification. In total, otology and audiology intake documentation represented 24 of the 27 Brief ICF Core Set categories (i.e., 89%), and 60 of the 117 Comprehensive ICF Core Set categories (i.e., 51%). Various ICF Core Sets categories were not represented, including higher mental functions (Body Functions), civic life aspects (Activities and Participation), and support and attitudes of family (Environmental
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
A core performance study on an actinide recycling 'zero-sodium-void worth' core
International Nuclear Information System (INIS)
Kawashima, M.; Nakagawa, M.; Yamaoka, M.; Kasahara, F.
1994-01-01
A core performance study was made for an absorber-type parfait core (A-APC) as one of 'Zero-sodium-void-worth' core concepts. This evaluation study pursued different two aspects; one for transuranic (TRU) management strategy, and another for a loss-of-coolant anticipated transient behavior considering the unique core configuration. The results indicated that this core has a large flexibility for actinide recycling in terms of self-sufficiency and minor actinide burning. The result also showed that this core has kept a large mitigation potential for ULOF events as well as a simple flat core concept, reflecting detailed three dimensional core bowing behavior for the A-APC configuration. (author)
Core Characteristics Deterioration due to Plastic Deformation
Kaido, Chikara; Arai, Satoshi
This paper discusses the effect of plastic deformation at core manufacturing on the characteristics of cores where non-oriented electrical steel sheets are used as core material. Exciting field and iron loss increase proportionally to plastic deformation in the case of rPeddy currents increase because plastic deformations of crystalline grains are distributed and then the flux distribution is induced. In the case of rP>20, the deterioration tend to saturate, and the increases in magnetic field and iron loss are 1000 to 1500A/m and 2 to 4W/kg. They are related to grain size, and high grade with larger grain may have lager field increase and smaller iron loss increase. Anomalous eddy current losses scarcely increase in this region. In actual motors, the plastic deformation affects iron loss increase although exciting current increases a little.
DEFF Research Database (Denmark)
Kristensen, Jesper Toft; Houmann, Andreas; Liu, Xiaomin
2008-01-01
of the splicing process. We also demonstrate that the higher splice loss compromises the PM properties of the splice. Our splicing technique was successfully applied to the realization of a low-loss, environmentally stable monolithic PM fiber laser pulse compressor, enabling direct end-of-the-fiber femtosecond......We report on highly reproducible low-loss fusion splicing of polarization-maintaining single-mode fibers (PM-SMFs) and hollow-core photonic crystal fibers (HC-PCFs). The PM-SMF-to-HC-PCF splices are characterized by the loss of 0.62 ± 0.24 dB, and polarization extinction ratio of 19 ± 0.68 d...... pulse delivery...
Hooghe, An; Neimeyer, Robert A; Rober, Peter
2012-09-01
In contrast to the traditional view of working through grief by confronting it, recent theories have emphasized an oscillating process of confronting and avoiding the pain of loss. In this qualitative study, we sought a better understanding of this process by conducting a detailed case study of a bereaved couple after the loss of their infant daughter. We employed multiple data collection methods (using interviews and written feedback) and an intensive auditing process in our thematic analysis, with special attention to a recurrent metaphor used by this bereaved couple in describing their personal and relational experience. The findings suggest the presence of a dialectic tension between the need to be close to the deceased child and the need for distance from the pain of the loss, which was evidenced on both individual and relational levels. For this couple, the image of "cycling around an emotional core of sadness" captured their dynamic way of dealing with this dialectic of closeness and distance.
Nanoporous polymer liquid core waveguides
DEFF Research Database (Denmark)
Gopalakrishnan, Nimi; Christiansen, Mads Brøkner; Ndoni, Sokol
2010-01-01
We demonstrate liquid core waveguides defined by UV to enable selective water infiltration in nanoporous polymers, creating an effective refractive index shift Δn=0.13. The mode confinement and propagation loss in these waveguides are presented.......We demonstrate liquid core waveguides defined by UV to enable selective water infiltration in nanoporous polymers, creating an effective refractive index shift Δn=0.13. The mode confinement and propagation loss in these waveguides are presented....
Mesoporous activated carbon from corn stalk core for lithium ion batteries
Li, Yi; Li, Chun; Qi, Hui; Yu, Kaifeng; Liang, Ce
2018-04-01
A novel mesoporous activated carbon (AC) derived from corn stalk core is prepared via a facile and effective method which including the decomposition and carbonization of corn stalk core under an inert gas atmosphere and further activation process with KOH solution. The mesoporous activated carbon (AC) is characterized by X-ray diffraction (XRD), Raman spectroscopy, scanning electron microscopy (SEM), transmission electron microscopy (TEM) and Brunauer-Emmett-Teller (BET) measurements. These biomass waste derived from activated carbon is proved to be promising anode materials for high specific capacity lithium ion batteries. The activated carbon anode possesses excellent reversible capacity of 504 mAh g-1 after 100 cycles at 0.2C. Compared with the unactivated carbon (UAC), the electrochemical performance of activated carbon is significantly improved due to its mesoporous structure.
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
DNA-binding properties of the Bacillus subtilis and Aeribacillus pallidus AC6 σ(D) proteins.
Sevim, Elif; Gaballa, Ahmed; Beldüz, A Osman; Helmann, John D
2011-01-01
σ(D) proteins from Aeribacillus pallidus AC6 and Bacillus subtilis bound specifically, albeit weakly, to promoter DNA even in the absence of core RNA polymerase. Binding required a conserved CG motif within the -10 element, and this motif is known to be recognized by σ region 2.4 and critical for promoter activity.
DNA-Binding Properties of the Bacillus subtilis and Aeribacillus pallidus AC6 σD Proteins▿
Sevim, Elif; Gaballa, Ahmed; Beldüz, A. Osman; Helmann, John D.
2010-01-01
σD proteins from Aeribacillus pallidus AC6 and Bacillus subtilis bound specifically, albeit weakly, to promoter DNA even in the absence of core RNA polymerase. Binding required a conserved CG motif within the −10 element, and this motif is known to be recognized by σ region 2.4 and critical for promoter activity.
Frequency Dependent Losses in Transmission Cable Conductors
DEFF Research Database (Denmark)
Olsen, Rasmus Schmidt; Holbøll, Joachim; Guðmundsdóttir, Unnur Stella
2011-01-01
, such as thermal conditions in and around the cable, as well as the heat generated in conductors, screens, armours etc., taking into account proximity and skin effects. The work performed and presented in this paper is concerned with an improved determination of the losses generated in the conductor, by means...... of better calculation of the AC resistance of transmission cable conductors, in particular regarding higher frequencies. In this way, also losses under harmonics can be covered. Furthermore, the model is suitable for modelling of transient attenuation in high voltage cables. The AC resistance is calculated...... based on the current density distribution in different conductor designs by means of the Finite Element Method (FEM). The obtained results and methods are compared to available standards (IEC publication 60287-1-1)....
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
International Nuclear Information System (INIS)
Gregory, Eric
2009-01-01
Final report of SBIR to develop an economical process that can produce the best material for high field magnets to be used in the next generation of accelerators. The overall objective is to develop an economical process that can produce the best material for high field magnets to be used in future particle accelerators. The internal-tin process has shown by others to produce high J c Nb 3 Sn material and the work here is primarily directed to lowering the AC losses, increasing piece lengths and lowering costs. In the previous reports on this Phase II work we have explored the finned restack approach. We have however encountered ductility problems when we have attempted to produce material without fins but with large numbers of subelements in the restacks. The work reported has concentrated on the scale up of the internal-tin materials without fins and we have finally made internal tin material with 40 (micro)m subelements which exhibited a J c at 12 T of 2757 A/mm 2 in the non-Cu and a J c at 14 T of 1985 A/mm 2 in the non-Cu. These results are the best we have achieved to date and are approaching those that Oxford has achieved for sometime.
Effect of conducting core on the dynamics of a compound drop in an AC electric field
Soni, Purushottam; Dixit, Divya; Juvekar, Vinay A.
2017-11-01
Dynamics of 0.1M NaCl/castor oil/silicone oil compound drop in an alternating electric field of frequency 1 Hz was investigated experimentally in a parallel plate electrode cell. A novel yet simple method was used for producing the compound drop with different ratios of the core radius to shell radius. Deformation dynamics under both transient and cyclical steady states were recorded using high-speed imaging. We observed that with an increase in the radius ratio, deformation of the shell increases and that of the core decreases. The temporal deformation of the core always leads that of the shell. The phase lead between the core and the shell is independent of electric field strength and salt concentration in the core but strongly depends on the viscosity of the medium and radius ratio. At a small radius ratio, the breakup of the core is similar to the disintegration of the isolated drop in an infinite fluid; whereas the core attends a diamond-like shape at a high radius ratio before ejecting the small droplets from the tips.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Energy Technology Data Exchange (ETDEWEB)
Fredin, Lisa A.; Li, Zhong; Ratner, Mark A.; Marks, Tobin J. [Department of Chemistry Northwestern University, 2145 Sheridan Road, Evanston, IL 60208 (United States); Lanagan, Michael T. [Center for Dielectric Studies, Materials Research Institute, The Pennsylvania State University, University Park, PA 16802-4800 (United States)
2012-11-20
Dielectric loss in metal oxide core/Al{sub 2}O{sub 3} shell polypropylene nanocomposites scales with the particle surface area. By moderating the interfacial surface area between the phases and using increasing shell thicknesses, dielectric loss is significantly reduced, and thus the energy stored within, and recoverable from, capacitors fabricated from these materials is significantly increased, to as high as 2.05 J/cm{sup 3}. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Synthesis and properties MFe2O4 (M = Fe, Co) nanoparticles and core-shell structures
Yelenich, O. V.; Solopan, S. O.; Greneche, J. M.; Belous, A. G.
2015-08-01
Individual Fe3-xO4 and CoFe2O4 nanoparticles, as well as Fe3-xO4/CoFe2O4 core/shell structures were synthesized by the method of co-precipitation from diethylene glycol solutions. Core/shell structure were synthesized with CoFe2O4-shell thickness of 1.0, 2.5 and 3.5 nm. X-ray diffraction patterns of individual nanoparticles and core/shell are similar and indicate that all synthesized samples have a cubic spinel structure. Compares Mössbauer studies of CoFe2O4, Fe3-xO4 nanoparticles indicate superparamagnetic properties at 300 K. It was shown that individual magnetite nanoparticles are transformed into maghemite through oxidation during the synthesis procedure, wherein the smallest nanoparticles are completely oxidized while a magnetite core does occur in the case of the largest nanoparticles. The Mössbauer spectra of core/shell nanoparticles with increasing CoFe2O4-shell thickness show a gradual decrease in the relative intensity of the quadrupole doublet and significant decrease of the mean isomer shift value at both RT and 77 K indicating a decrease of the superparamagnetic relaxation phenomena. Specific loss power for the prepared ferrofluids was experimentally calculated and it was determined that under influence of ac-magnetic field magnetic fluid based on individual CoFe2O4 and Fe3-xO4 particles are characterized by very low heating temperature, when magnetic fluids based on core/shell nanoparticles demonstrate higher heating effect.
Directory of Open Access Journals (Sweden)
Tang Xiao-Qing
2011-08-01
Full Text Available Abstract Background The hydrogen sulfide-releasing sildenafil, ACS6, has been demonstrated to inhibit superoxide formation through donating hydrogen sulfide (H2S. We have found that H2S antagonizes homocysteine-induced oxidative stress and neurotoxicity. The aim of the present study is to explore the protection of ACS6 against homocysteine-triggered cytotoxicity and apoptosis and the molecular mechanisms underlying in PC12 cells. Methods Cell viability was determined by Cell Counting Kit-8 assay. Cell apoptosis was observed using the chromatin dye Hoechst 33258 and analyzed by Flow Cytometry after propidium iodide staining. Mitochondrial membrane potential was monitored using the fluorescent dye Rh123. Intracellular reactive oxygen species were determined by oxidative conversion of cell permeable 2',7'-dichlorfluorescein-diacetate to fluorescent 2',7'-dichlorfluorescein. The expression of cleaved caspase-3 and bcl-2 and the accumulation of cytosolic cytochrome c were analyzed by Western blot. Results We show that ACS6 protects PC12 cells against cytotoxicity and apoptosis induced by homocysteine and blocks homocysteine-triggered cytochrome c release and caspase-3 activation. ACS6 treatment results in not only prevention of homocysteine-caused mitochondrial membrane potential (Δψ loss and reactive oxygen species (ROS overproduction but also reversal of Bcl-2 down-expression. Conclusions These results indicate that ACS6 protects PC12 cells against homocysteine-induced cytotoxicity and apoptosis by preservation of mitochondrial function though inhibiting both loss of Δψ and accumulation of ROS as well as modulating the expression of Bcl-2. Our study provides evidence both for a neuroprotective effect of ACS6 and for further evaluation of ACS6 as novel neuroprotectants for Alzheimer's disease associated with homocysteine.
Flame spread over inclined electrical wires with AC electric fields
Lim, Seung J.
2017-07-21
Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.
DNA-Binding Properties of the Bacillus subtilis and Aeribacillus pallidus AC6 σD Proteins▿
Sevim, Elif; Gaballa, Ahmed; Beldüz, A. Osman; Helmann, John D.
2011-01-01
σD proteins from Aeribacillus pallidus AC6 and Bacillus subtilis bound specifically, albeit weakly, to promoter DNA even in the absence of core RNA polymerase. Binding required a conserved CG motif within the −10 element, and this motif is known to be recognized by σ region 2.4 and critical for promoter activity. PMID:21097624
International Nuclear Information System (INIS)
Titantah, J.T.; Lamoen, D.; Jorissen, K.
2004-01-01
We perform density functional theory calculations on a series of armchair and zigzag nanotubes of diameters less than 1 nm using the all-electron full-potential(-linearized)-augmented-plane-wave method. Emphasis is laid on the effects of curvature, the electron-beam orientation, and the inclusion of the core hole on the carbon electron-energy-loss K edge. The electron-energy-loss near-edge spectra of all the studied tubes show strong curvature effects compared to that of flat graphene. The curvature-induced π-σ hybridization is shown to have a more drastic effect on the electronic properties of zigzag tubes than on those of armchair tubes. We show that the core-hole effect must be accounted for in order to correctly reproduce electron-energy-loss measurements. We also find that the energy-loss near-edge spectra of these carbon systems are dominantly dipole selected and that they can be expressed simply as a proportionality with the local momentum projected density of states, thus portraying the weak energy dependence of the transition matrix elements. Compared to graphite, we report a reduction in the anisotropy as seen on the energy-loss near-edge spectra of carbon nanotubes
Spectroscopic AC susceptibility imaging (sASI) of magnetic nanoparticles
International Nuclear Information System (INIS)
Ficko, Bradley W.; Nadar, Priyanka M.; Diamond, Solomon G.
2015-01-01
This study demonstrates a method for alternating current (AC) susceptibility imaging (ASI) of magnetic nanoparticles (mNPs) using low cost instrumentation. The ASI method uses AC magnetic susceptibility measurements to create tomographic images using an array of drive coils, compensation coils and fluxgate magnetometers. Using a spectroscopic approach in conjunction with ASI, a series of tomographic images can be created for each frequency measurement set and is termed sASI. The advantage of sASI is that mNPs can be simultaneously characterized and imaged in a biological medium. System calibration was performed by fitting the in-phase and out-of-phase susceptibility measurements of an mNP sample with a hydrodynamic diameter of 100 nm to a Brownian relaxation model (R 2 =0.96). Samples of mNPs with core diameters of 10 and 40 nm and a sample of 100 nm hydrodynamic diameter were prepared in 0.5 ml tubes. Three mNP samples were arranged in a randomized array and then scanned using sASI with six frequencies between 425 and 925 Hz. The sASI scans showed the location and quantity of the mNP samples (R 2 =0.97). Biological compatibility of the sASI method was demonstrated by scanning mNPs that were injected into a pork sausage. The mNP response in the biological medium was found to correlate with a calibration sample (R 2 =0.97, p<0.001). These results demonstrate the concept of ASI and advantages of sASI. - Highlights: • Development of an AC susceptibility imaging model. • Comparison of AC susceptibility imaging (ASI) and susceptibility magnitude imaging (SMI). • Demonstration of ASI and spectroscopic ASI (sASI) using three different magnetic nanoparticle types. • SASI scan separation of three different magnetic nanoparticles samples using 5 spectroscopic frequencies. • Demonstration of biological feasibility of sASI
Directory of Open Access Journals (Sweden)
Linda J Gahan
2010-12-01
Full Text Available Transgenic crops producing insecticidal toxins from Bacillus thuringiensis (Bt are commercially successful in reducing pest damage, yet knowledge of resistance mechanisms that threaten their sustainability is incomplete. Insect resistance to the pore-forming Cry1Ac toxin is correlated with the loss of high-affinity, irreversible binding to the mid-gut membrane, but the genetic factors responsible for this change have been elusive. Mutations in a 12-cadherin-domain protein confer some Cry1Ac resistance but do not block this toxin binding in in vitro assays. We sought to identify mutations in other genes that might be responsible for the loss of binding. We employed a map-based cloning approach using a series of backcrosses with 1,060 progeny to identify a resistance gene in the cotton pest Heliothis virescens that segregated independently from the cadherin mutation. We found an inactivating mutation of the ABC transporter ABCC2 that is genetically linked to Cry1Ac resistance and is correlated with loss of Cry1Ac binding to membrane vesicles. ABC proteins are integral membrane proteins with many functions, including export of toxic molecules from the cell, but have not been implicated in the mode of action of Bt toxins before. The reduction in toxin binding due to the inactivating mutation suggests that ABCC2 is involved in membrane integration of the toxin pore. Our findings suggest that ABC proteins may play a key role in the mode of action of Bt toxins and that ABC protein mutations can confer high levels of resistance that could threaten the continued utilization of Bt-expressing crops. However, such mutations may impose a physiological cost on resistant insects, by reducing export of other toxins such as plant secondary compounds from the cell. This weakness could be exploited to manage this mechanism of Bt resistance in the field.
Gahan, Linda J; Pauchet, Yannick; Vogel, Heiko; Heckel, David G
2010-12-16
Transgenic crops producing insecticidal toxins from Bacillus thuringiensis (Bt) are commercially successful in reducing pest damage, yet knowledge of resistance mechanisms that threaten their sustainability is incomplete. Insect resistance to the pore-forming Cry1Ac toxin is correlated with the loss of high-affinity, irreversible binding to the mid-gut membrane, but the genetic factors responsible for this change have been elusive. Mutations in a 12-cadherin-domain protein confer some Cry1Ac resistance but do not block this toxin binding in in vitro assays. We sought to identify mutations in other genes that might be responsible for the loss of binding. We employed a map-based cloning approach using a series of backcrosses with 1,060 progeny to identify a resistance gene in the cotton pest Heliothis virescens that segregated independently from the cadherin mutation. We found an inactivating mutation of the ABC transporter ABCC2 that is genetically linked to Cry1Ac resistance and is correlated with loss of Cry1Ac binding to membrane vesicles. ABC proteins are integral membrane proteins with many functions, including export of toxic molecules from the cell, but have not been implicated in the mode of action of Bt toxins before. The reduction in toxin binding due to the inactivating mutation suggests that ABCC2 is involved in membrane integration of the toxin pore. Our findings suggest that ABC proteins may play a key role in the mode of action of Bt toxins and that ABC protein mutations can confer high levels of resistance that could threaten the continued utilization of Bt-expressing crops. However, such mutations may impose a physiological cost on resistant insects, by reducing export of other toxins such as plant secondary compounds from the cell. This weakness could be exploited to manage this mechanism of Bt resistance in the field.
International Nuclear Information System (INIS)
Iben, I. Jr.
1978-01-01
In the hope of uncovering additional Urca-active nuclei that might appear during carbon burning in the electron-degenerate carbon-oxygen core of an asymptotic-branch star and avert a thermonuclear runaway, a nuclear-reaction matrix connecting 244 nuclear species has been constructed. Analytic expressions for rates of all relevant β-transitions are also presented and used. It is shown that in matter which is composed initially of elements in a solar-system distribution and which has undergone first complete hydrogen burning and then complete helium burning, neutrino-loss rates due to 11 Urca pairs either rival or exceed neutrino losses predicted by the charge- and neutral-current theories of weak interactions. Most remarkably, no new Urca pairs of any consequence appear as a result of several thousand reactions that are allowed to occur during carbon burning. The dominant Urca-loss rates are still due to the pairs 21 F- 21 Ne, 23 Ne- 23 Na, 25 Na- 25 Mg, and 25 Ne- 25 Na, as in matter containing a solar-system distribution of elements that has undergone prior processing during hydrogen- and helium-burning phases. The abundances of these Urca-active pairs are enhanced by one to three orders of magnitude as a consequence of carbon-burning reactions
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Energy Technology Data Exchange (ETDEWEB)
Szilard, Ronaldo Henriques [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2016-09-01
A Risk Informed Safety Margin Characterization (RISMC) toolkit and methodology are proposed for investigating nuclear power plant core, fuels design and safety analysis, including postulated Loss-of-Coolant Accident (LOCA) analysis. This toolkit, under an integrated evaluation model framework, is name LOCA toolkit for the US (LOTUS). This demonstration includes coupled analysis of core design, fuel design, thermal hydraulics and systems analysis, using advanced risk analysis tools and methods to investigate a wide range of results.
THE HST/ACS COMA CLUSTER SURVEY. II. DATA DESCRIPTION AND SOURCE CATALOGS
International Nuclear Information System (INIS)
Hammer, Derek; Verdoes Kleijn, Gijs; Den Brok, Mark; Peletier, Reynier F.; Hoyos, Carlos; Balcells, Marc; Aguerri, Alfonso L.; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Smith, Russell J.; Lucey, John R.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Jogee, Shardha; Batcheldor, Dan; Bridges, Terry J.
2010-01-01
The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ∼50% of the core high-density region in Coma. Observations were performed for 25 fields that extend over a wide range of cluster-centric radii (∼1.75 Mpc or 1 0 ) with a total coverage area of 274 arcmin 2 . The majority of the fields are located near the core region of Coma (19/25 pointings) with six additional fields in the southwest region of the cluster. In this paper, we present reprocessed images and SEXTRACTOR source catalogs for our survey fields, including a detailed description of the methodology used for object detection and photometry, the subtraction of bright galaxies to measure faint underlying objects, and the use of simulations to assess the photometric accuracy and completeness of our catalogs. We also use simulations to perform aperture corrections for the SEXTRACTOR Kron magnitudes based only on the measured source flux and its half-light radius. We have performed photometry for ∼73,000 unique objects; approximately one-half of our detections are brighter than the 10σ point-source detection limit at F814W = 25.8 mag (AB). The slight majority of objects (60%) are unresolved or only marginally resolved by ACS. We estimate that Coma members are 5%-10% of all source detections, which consist of a large population of unresolved compact sources (primarily globular clusters but also ultra-compact dwarf galaxies) and a wide variety of extended galaxies from a cD galaxy to dwarf low surface brightness galaxies. The red sequence of Coma member galaxies has a color-magnitude relation with a constant slope and dispersion over 9 mag (-21 F814W < -13). The initial data release for the HST-ACS Coma Treasury program was made available to the public in 2008 August. The images and catalogs described
International Nuclear Information System (INIS)
Park, Jong Woon; Park, Byung Gi; Kim, Chang Hyun
2009-01-01
Integral tests of head loss through an emergency core cooling filter screen are conducted, simulating reactor building environmental conditions for 30 days after a loss of coolant accident. A test rig with five individual loops each of whose chamber is established to test chemical product formation and measure the head loss through a sample filter. The screen area at each chamber and the amounts of reactor building materials are scaled down according to specific plant condition. A series of tests have been performed to investigate the effects of calcium-silicate, reactor building spray, existence of calcium-silicate with tri-sodium phosphate (TSP), and composition of materials. The results showed that head loss across the chemical bed with even a small amount of calcium-silicate insulation instantaneously increased as soon as TSP was added to the test solution. Also, the head loss across the filter screen is strongly affected by spray duration and the head loss increase is rapid at the early stage, because of high dissolution and precipitation of aluminum and zinc. After passivation of aluminum and zinc by corrosion, the head loss increase is much slowed down and is mainly induced by materials such as calcium, silicon, and magnesium leached from NUKON TM and concrete. Furthermore, it is newly found that the spay buffer agent, tri-sodium phosphate, to form protective coating on the aluminum surface and reduce aluminum leaching is not effective for a large amount of aluminum and a long spray.
The first high resolution image of coronal gas in a starbursting cool core cluster
Johnson, Sean
2017-08-01
Galaxy clusters represent a unique laboratory for directly observing gas cooling and feedback due to their high masses and correspondingly high gas densities and temperatures. Cooling of X-ray gas observed in 1/3 of clusters, known as cool-core clusters, should fuel star formation at prodigious rates, but such high levels of star formation are rarely observed. Feedback from active galactic nuclei (AGN) is a leading explanation for the lack of star formation in most cool clusters, and AGN power is sufficient to offset gas cooling on average. Nevertheless, some cool core clusters exhibit massive starbursts indicating that our understanding of cooling and feedback is incomplete. Observations of 10^5 K coronal gas in cool core clusters through OVI emission offers a sensitive means of testing our understanding of cooling and feedback because OVI emission is a dominant coolant and sensitive tracer of shocked gas. Recently, Hayes et al. 2016 demonstrated that synthetic narrow-band imaging of OVI emission is possible through subtraction of long-pass filters with the ACS+SBC for targets at z=0.23-0.29. Here, we propose to use this exciting new technique to directly image coronal OVI emitting gas at high resolution in Abell 1835, a prototypical starbursting cool-core cluster at z=0.252. Abell 1835 hosts a strong cooling core, massive starburst, radio AGN, and at z=0.252, it offers a unique opportunity to directly image OVI at hi-res in the UV with ACS+SBC. With just 15 orbits of ACS+SBC imaging, the proposed observations will complete the existing rich multi-wavelength dataset available for Abell 1835 to provide new insights into cooling and feedback in clusters.
Status of Core Products of the International GNSS Service
Choi, K. K.
2014-12-01
The International GNSS Service (IGS) has been providing high accuracy GNSS orbits, clocks and Earth Rotation Parameters (ERP) in three different time intervals. The quality of the IGS core products are regularly monitored since 2010, and the level of accuracies has not been changed noticeably. The Final and Rapid orbit's accuracies are known to be about ~2.5 cm and the near-real time (observed) Ultra-rapid orbit is about 3 cm. The real-time orbits obtained by propagating the Ultra-rapid orbits shows an accuracy of about 5 cm. The most significant error source of the real-time orbit is the sub-daily variation of the Earth orientation. Number of IGS08 core sites has been decreasing with the rate of ~0.13 stations per week due to equipment changes and natural disasters such as Earthquakes. This paper summarizes the quality state of the IGS core products for 2014, and the upcoming new official product IGV, Glonass Ultra-rapid orbit product which have been experimental for last 4 years. Eight IGS Analysis Centers (ACs) have completed their efforts to participate in the second reprocessing campaign (repro2). Based on their input, this paper summarizes the models and methodologies each AC have adopted for this campaign.
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Directory of Open Access Journals (Sweden)
Atsushi Yao
2018-05-01
Full Text Available This paper focuses on an evaluation of core losses in laminated magnetic block cores assembled with a high Bs nanocrystalline alloy in high magnetic flux density region. To discuss the soft magnetic properties of the high Bs block cores, the comparison with amorphous (SA1 block cores is also performed. In the high Bs block core, both low core losses and high saturation flux densities Bs are satisfied in the low frequency region. Furthermore, in the laminated block core made of the high Bs alloy, the rate of increase of iron losses as a function of the magnetic flux density remains small up to around 1.6 T, which cannot be realized in conventional laminated block cores based on amorphous alloy. The block core made of the high Bs alloy exhibits comparable core loss with that of amorphous alloy core in the high-frequency region. Thus, it is expected that this laminated high Bs block core can achieve low core losses and high saturation flux densities in the high-frequency region.
Nonlinear Model of Tape Wound Core Transformers
Directory of Open Access Journals (Sweden)
A. Vahedi
2015-03-01
Full Text Available Recently, tape wound cores due to their excellent magnetic properties, are widely used in different types of transformers. Performance prediction of these transformers needs an accurate model with ability to determine flux distribution within the core and magnetic loss. Spiral structure of tape wound cores affects the flux distribution and always cause complication of analysis. In this paper, a model based on reluctance networks method is presented for analysis of magnetic flux in wound cores. Using this model, distribution of longitudinal and transverse fluxes within the core can be determined. To consider the nonlinearity of the core, a dynamic hysteresis model is included in the presented model. Having flux density in different points of the core, magnetic losses can be calculated. To evaluate the validity of the model, results are compared with 2-D FEM simulations. In addition, a transformer designed for series-resonant converter and simulation results are compared with experimental measurements. Comparisons show accuracy of the model besides simplicity and fast convergence
The influence of select losses components on induction squirrel-cage motor efficiency
Energy Technology Data Exchange (ETDEWEB)
Dabala, K. [Electrical Machines Dept., Electrotechnical Inst., Warsaw (Poland)
2000-07-01
There is taken into consideration the influence of measured core and friction and windage losses on induction squirrel-cage motor in this paper. This paper presents a way of exact core losses determination in full-load motor. There are also compared efficiencies obtained for three core losses values: from no-load test (IEC 34-2); from draft IEC 2G/102/CDV; from presented in this paper method. This paper presents the influence of the friction and windage losses determined from no-load test and the mechanical losses appeared under the rated speed on the efficiency, too. There is compared the influence of the core and mechanical losses sum on the efficiency dependently on the way of this losses components determination. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Bitoh, T; Ishikawa, T; Okumura, H, E-mail: teruo_bitoh@akita-pu.ac.jp [Department of Machine Intelligence and Systems Engineering, Faculty of Systems Science and Technology, Akita Prefectural University, Yurihonjo, 015-0055 (Japan)
2011-01-01
The soft magnetic properties of ring-shaped (Fe{sub 0.75}B{sub 0.20}Si{sub 0.05}){sub 96}Nb{sub 4} cast bulk metallic glass (BMG) with thickness of 0.3-1.0 mm have been investigated. The BMG specimens exhibit high relative permeability of (9-29)x10{sup 3} at 0.40 A/m and 50 Hz and low coercivity of 4.0 A/m. The core losses of the 0.3 mm thick BMG specimen are lower than those of commercial Fe-6.5 mass% Si steel (6.5Si) with the same thickness, and are comparable to those of the 0.10 mm thick 6.5Si. The low core losses of the BMG originate from the low coercivity and high electrical resistivity.
Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer
Directory of Open Access Journals (Sweden)
Phuc Thinh Doan
2013-06-01
Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Comparison of facility characteristics between SCTF Core-I and Core-II
International Nuclear Information System (INIS)
Adachi, Hiromichi; Iwamura, Takamichi; Sobajima, Makoto; Ohnuki, Akira; Abe, Yutaka; Murao, Yoshio.
1990-08-01
The Slab Core Test Facility (SCTF) was constructed to investigate two-dimensional thermal-hydraulics in the core and fluid behavior of carryover water out of the core including its feed-back effect to the core behavior mainly during the reflood phase of a large break loss-of-coolant accident (LOCA) of a pressurized water reactor (PWR). Since three simulated cores are used in the SCTF Test Program and the design of these three cores are slightly different one by one, repeatability test is required to justify a direct comparison of data obtained with different cores. In the present report, data of Test S2-13 (Run 618) obtained with SCTF Core-II were compared with those of Test S1-05 (Run 511) obtained with the Core-I, which were performed under the forced-flooding condition. Thermal-hydraulic behaviors in these two tests showed quite similar characteristics of both system behavior and two-dimensional core behaviors. Therefore, the test data obtained from the two cores can be compared directly with each other. After the turnaround of clad temperatures, however, some differences were found in upper plenum water accumulation and resultant two-dimensional core cooling behaviors such as quench front propagation from bottom to top of the core. (author)
Realization of low loss and polarization maintaining hollow core photonic crystal fibers
DEFF Research Database (Denmark)
Mangan, Brian Joseph; Lyngsøe, Jens Kristian; Roberts, John
2008-01-01
Antiresonant core wals in 7-cell hollow core fibers are used to reduce the attenuation to 9.3dB/km and create an intentionally hightly birefringent fiber with a beatlength as low as 0.2mm......Antiresonant core wals in 7-cell hollow core fibers are used to reduce the attenuation to 9.3dB/km and create an intentionally hightly birefringent fiber with a beatlength as low as 0.2mm...
Ac conductivity and dielectric properties of bulk tin phthalocyanine dichloride (SnPcCl 2)
El-Nahass, M. M.; Farid, A. M.; Abd El-Rahman, K. F.; Ali, H. A. M.
2008-07-01
The ac conductivity, σac( ω), has been measured for bulk tin phthalocyanine dichloride (SnPcCl 2) in the form of compressed pellet with evaporated ohmic Au electrodes in a temperature range 303-403 K. Ac conductivity, σac( ω), is found to vary as ωs in the frequency range 42 Hz-5×10 6 Hz. At low range of frequency, s<1 and it decreases with the increase in temperature indicating a dominant hopping process. At high range of frequency, s is found to be equal to ≈1.09 and is temperature independent. The dielectric constant, ε1, and dialectic loss, ε2, have been determined for bulk SnPcCl 2. Both ε1 and ε2 decrease with the increase in frequency and increase with the increase in temperature. The Cole-Cole types have been used to determine some parameters such as; the macroscopic relaxation time ( τo), the molecular relaxation time ( τ), the activation energy for relaxation ( Eo) and the distribution parameter ( α). The temperature dependence of τ is expressed by a thermally activated process with the activation energy of 0.299 eV.
Fault current limiter with shield and adjacent cores
Darmann, Francis Anthony; Moriconi, Franco; Hodge, Eoin Patrick
2013-10-22
In a fault current limiter (FCL) of a saturated core type having at least one coil wound around a high permeability material, a method of suppressing the time derivative of the fault current at the zero current point includes the following step: utilizing an electromagnetic screen or shield around the AC coil to suppress the time derivative current levels during zero current conditions.
Loss and Inductance Investigation in Superconducting Cable Conductors
DEFF Research Database (Denmark)
Olsen, Søren Krüger; Tønnesen, Ole; Træholt, Chresten
1999-01-01
An important parameter in the design and optimization of a superconducting cable conductor is the control of the current distribution among single tapes and layers. This distribution is to a large degree determined by inductances, since the resistances are low. The self and mutual inductances...... of transport current and current distribution.This presentation is based on a number of experiments performed on prototype superconducting cable conductors. The critical current (1uV/cm) of the conductor at 77K was 1590 A (cable #1) and 3240 A (cable #2) respectively.At an rms current of 2 kA (50 Hz) the AC......-loss was measured on cable #2 to 0.6W/mxphase. This is, to our knowledge, the lowest AC-loss (at 2kA and 77K) of a high temperature superconducting cable conductor reported so far....
Interior point algorithm-based power flow optimisation of a combined AC and DC multi-terminal grid
Directory of Open Access Journals (Sweden)
Farhan Beg
2015-01-01
Full Text Available The high cost of power electronic equipment, lower reliability and poor power handling capacity of the semiconductor devices had stalled the deployment of systems based on DC (multi-terminal direct current system (MTDC networks. The introduction of voltage source converters (VSCs for transmission has renewed the interest in the development of large interconnected grids based on both alternate current (AC and DC transmission networks. Such a grid platform also realises the added advantage of integrating the renewable energy sources into the grid. Thus a grid based on DC MTDC network is a possible solution to improve energy security and check the increasing supply demand gap. An optimal power solution for combined AC and DC grids obtained by the solution of the interior point algorithm is proposed in this study. Multi-terminal HVDC grids lie at the heart of various suggested transmission capacity increases. A significant difference is observed when MTDC grids are solved for power flows in place of conventional AC grids. This study deals with the power flow problem of a combined MTDC and an AC grid. The AC side is modelled with the full power flow equations and the VSCs are modelled using a connecting line, two generators and an AC node. The VSC and the DC losses are also considered. The optimisation focuses on several different goals. Three different scenarios are presented in an arbitrary grid network with ten AC nodes and five converter stations.
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Directory of Open Access Journals (Sweden)
Liwen Pan
2016-06-01
Full Text Available This paper presents an on-board vehicular battery charger that integrates bidirectional AC/DC converter and DC/DC converter to achieve high power density for application in electric vehicles (EVs. The integrated charger is able to transfer electrical energy between the battery pack and the electric traction system and to function as an AC/DC battery charger. The integrated charger topology is presented and the design of passive components is discussed. The control schemes are developed for motor drive system and battery-charging system with a power pulsation reduction circuit. Simulation results in MATLAB/Simulink and experiments on a 30-kW motor drive and 3.3-kW AC/DC charging prototype validate the performance of the proposed technology. In addition, power losses, efficiency comparison and thermal stress for the integrated charger are illustrated. The results of the analyses show the validity of the advanced integrated charger for electric vehicles.
KSI's Cross Insulated Core Transformer Technology
International Nuclear Information System (INIS)
Uhmeyer, Uwe
2009-01-01
Cross Insulated Core Transformer (CCT) technology improves on Insulated Core Transformer (ICT) implementations. ICT systems are widely used in very high voltage, high power, power supply systems. In an ICT transformer ferrite core sections are insulated from their neighboring ferrite cores. Flux leakage is present at each of these insulated gaps. The flux loss is raised to the power of stages in the ICT design causing output voltage efficiency to taper off with increasing stages. KSI's CCT technology utilizes a patented technique to compensate the flux loss at each stage of an ICT system. Design equations to calculate the flux compensation capacitor value are presented. CCT provides corona free operation of the HV stack. KSI's CCT based High Voltage power supply systems offer high efficiency operation, high frequency switching, low stored energy and smaller size over comparable ICT systems.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Energy Technology Data Exchange (ETDEWEB)
Bencik, V [Elektrotehnichki Inst. Rade Koncar, Zagreb (Yugoslavia); Kozaric, M [Zagreb Univ. (Yugoslavia). Elektrotehnicki Fakultet
1990-07-01
In 1986 the US NRC published a proposed rule making to tighten the requirements on nuclear plants with regard to their ability to deal safely with a total loss of all a-c electric power, both from external and internal sources of supply. The proposed rule would require all licensees and applicants to: 1. Assess the capability of their plants to cope with a total loss all a-c power(that is, determine the amount of time the plant could maintain core cooling and containment integrity with a-c power unavailable); 2. Have procedures and training to cope with such an event; 3. Make modification, if necessary, to cope with an acceptable minimum duration loss of all a-c power. A total loss of all a-c electric power has been identified as an 'unresolved safety issue' and subjected to considerably study. The article presents an idea to resolve this issue. (author)
International Nuclear Information System (INIS)
Wieserman, W.R.; Schwarze, G.E.; Niedra, J.M.
1994-01-01
The availability of experimental data that characterizes the performance of soft magnetic materials for the combined conditions of high temperature and high frequency is almost non-existent. An experimental investigation was conducted over the temperature range of 23 to 300 C and frequency range of 1 to 50 kHz to determine the effects of temperature and frequency on the core loss and dynamic B-H loops of three different soft magnetic materials; an oriented-grain 50Ni-50Fe alloy, a nonoriented-grain 50Ni-50Fe alloy, and an iron-based amorphous material (Metglas 2605SC). A comparison of these materials show that the nonoriented-grain 50Ni-50Fe alloy tends to have either the lowest or next lowest core loss for all temperatures and frequencies investigated
Dielectric relaxation and AC conductivity studies of Se90Cd10−xInx glassy alloys
Directory of Open Access Journals (Sweden)
Nitesh Shukla
2016-06-01
Full Text Available Chalcogenide glassy alloys of Se90Cd10−xInx (x = 2, 4, 6, 8 are synthesized by melt quench technique. The prepared glassy alloys have been characterized by techniques such as differential scanning calorimetry (DSC, scanning electron microscopy (SEM and energy dispersive X-ray (EDAX. Dielectric properties of Se90Cd10−xInx (x = 2, 4, 6, 8 chalcogenide glassy system have been studied using impedance spectroscopic technique in the frequency range 42 Hz to 5 MHz at room temperature. It is found that the dielectric constants ɛ′, dielectric loss factor ɛ″ and loss angle Tan δ depend on frequency. ɛ′, ɛ″ and loss angle Tan δ are found to be decreasing with the In content in Se90Cd10−xInx glassy system. AC conductivity of the prepared sample has also been studied. It is found that AC conductivity increases with frequency where as it has decreasing trend with increasing In content in Se–Cd matrix. The semicircles observed in the Cole–Cole plots indicate a single relaxation process.
International Nuclear Information System (INIS)
Huang Xueqing; Zhang Senru
1999-01-01
Based on Qinshan II Nuclear Power Plant that is designed and constructed by way of self-reliance, China has developed advanced passive PWR AC-600. The design concept of AC-600 not only takes the real situation of China into consideration, but also follows the developing trend of nuclear power in the world. The design of AC-600 has the following technical characteristics: Advanced reactor: 18-24 month fuel cycle, low neutron leakage, low power density of the core, no any penetration in the RPV below the level of the reactor coolant nozzles; Passive safety systems: passive emergency residual heat removal system, passive-active safety injection system, passive containment cooling system and main control room habitability system; System simplified and the number of components reduced; Digital I and C; Modular construction. AC-600 inherits the proven technology China has mastered and used in Qirtshan 11, and absorbs advanced international design concepts, but it also has a distinctive characteristic of bringing forth new ideas independently. It is suited to Chinese conditions and therefore is expected to become an orientation of nuclear power development by self-reliance in China for the next century. (author)
Fast-ion losses induced by ACs and TAEs in the ASDEX Upgrade tokamak
M. García-Muñoz,; Hicks, N.; van Voornveld, R.; Classen, I.G.J.; Bilato, R.; Bobkov, V.; Brambilla, M.; Bruedgam, M.; Fahrbach, H. U.; Igochine, V.; Jaemsae, S.; Maraschek, M.; Sassenberg, K.
2010-01-01
The phase-space of convective and diffusive fast-ion losses induced by shear Alfven eigenmodes has been characterized in the ASDEX Upgrade tokamak. Time-resolved energy and pitch-angle measurements of fast-ion losses correlated in frequency and phase with toroidal Alfven eigenmodes (TAEs) and Alfven
Sensitive magnetic biodetection using magnetic multi-core nanoparticles and RCA coils
Energy Technology Data Exchange (ETDEWEB)
Ahrentorp, Fredrik; Blomgren, Jakob; Jonasson, Christian; Sarwe, Anna [Acreo Swedish ICT AB, Arvid Hedvalls Backe 4, Göteborg (Sweden); Sepehri, Sobhan; Eriksson, Emil; Kalaboukhov, Alexei; Jesorka, Aldo; Winkler, Dag [Department of Microtechnology and Nanoscience – MC2, Chalmers University of Technology, Göteborg (Sweden); Schneiderman, Justin F. [Institute of Neuroscience and Physiology, University of Gothenburg and MedTech West, Göteborg (Sweden); Nilsson, Mats [Science for Life Laboratory, Department of Biochemistry and Biophysics, Stockholm University, Stockholm (Sweden); Albert, Jan [Department of Microbiology, Tumor and Cell Biology, Karolinska Institutet, Stockholm (Sweden); Department of Clinical Microbiology, Karolinska University Hospital, Stockholm (Sweden); Zardán Gómez de la Torre, Teresa; Strømme, Maria [Uppsala University, Uppsala (Sweden); Johansson, Christer, E-mail: christer.johansson@acreo.se [Acreo Swedish ICT AB, Arvid Hedvalls Backe 4, Göteborg (Sweden)
2017-04-01
We use functionalized iron oxide magnetic multi-core particles of 100 nm in size (hydrodynamic particle diameter) and AC susceptometry (ACS) methods to measure the binding reactions between the magnetic nanoparticles (MNPs) and bio-analyte products produced from DNA segments using the rolling circle amplification (RCA) method. We use sensitive induction detection techniques in order to measure the ACS response. The DNA is amplified via RCA to generate RCA coils with a specific size that is dependent on the amplification time. After about 75 min of amplification we obtain an average RCA coil diameter of about 1 µm. We determine a theoretical limit of detection (LOD) in the range of 11 attomole (corresponding to an analyte concentration of 55 fM for a sample volume of 200 µL) from the ACS dynamic response after the MNPs have bound to the RCA coils and the measured ACS readout noise. We also discuss further possible improvements of the LOD. - Highlights: • Biosensing using Brownian relaxation of functionalized magnetic nanoparticles. • Rolling circle amplification and magnetic nanoparticles enables biosensing. • Theoretical limit of detection estimated from the signal noise gives about 55 fM.
Station blackout core damage frequency in an advanced nuclear reactor
International Nuclear Information System (INIS)
Carvalho, Luiz Sergio de
2004-01-01
Even though nuclear reactors are provided with protection systems so that they can be automatically shut down in the event of a station blackout, the consequences of this event can be severe. This is because many safety systems that are needed for removing residual heat from the core and for maintaining containment integrity, in the majority of the nuclear power plants, are AC dependent. In order to minimize core damage frequency, advanced reactor concepts are being developed with safety systems that use natural forces. This work shows an improvement in the safety of a small nuclear power reactor provided by a passive core residual heat removal system. Station blackout core melt frequencies, with and without this system, are both calculated. The results are also compared with available data in the literature. (author)
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Measurement of AC electrical characteristics of SSC superconducting dipole magnets
International Nuclear Information System (INIS)
Smedley, K.M.; Shafer, R.E.
1992-01-01
Experiments were conducted to measure the AC electrical characteristics of SSC superconducting dipole magnets over the frequency range of 0.1 Hz to 10 kHz. A magnet equivalent circuit representing the magnet DC inductance, eddy current losses, coil-to-ground and turn-to-turn capacitance, was synthesized from the experimental data. This magnet equivalent circuit can be used to predict the current ripple distribution along the superconducting magnet string and can provide dynamic information for the design of the collider current regulation loop
Tidal disruption of fuzzy dark matter subhalo cores
Du, Xiaolong; Schwabe, Bodo; Niemeyer, Jens C.; Bürger, David
2018-03-01
We study tidal stripping of fuzzy dark matter (FDM) subhalo cores using simulations of the Schrödinger-Poisson equations and analyze the dynamics of tidal disruption, highlighting the differences with standard cold dark matter. Mass loss outside of the tidal radius forces the core to relax into a less compact configuration, lowering the tidal radius. As the characteristic radius of a solitonic core scales inversely with its mass, tidal stripping results in a runaway effect and rapid tidal disruption of the core once its central density drops below 4.5 times the average density of the host within the orbital radius. Additionally, we find that the core is deformed into a tidally locked ellipsoid with increasing eccentricities until it is completely disrupted. Using the core mass loss rate, we compute the minimum mass of cores that can survive several orbits for different FDM particle masses and compare it with observed masses of satellite galaxies in the Milky Way.
Fuel assembly for pressure loss variable PWR type reactor
International Nuclear Information System (INIS)
Yoshikuni, Masaaki.
1993-01-01
In a PWR type reactor, a pressure loss control plate is attached detachably to a securing screw holes on the lower surface of a lower nozzle to reduce a water channel cross section and increase a pressure loss. If a fuel assembly attached with the pressure loss control plate is disposed at a periphery of the reactor core where the power is low and heat removal causes no significant problem, a flowrate at the periphery of the reactor core is reduced. Since this flowrate is utilized for removal of heat from fuel assemblies of high powder at the center of the reactor core where a pressure loss control plate is not attached, a thermal limit margin of the whole reactor core is increased. Thus, a limit of power peaking can be moderated, to obtain a fuel loading pattern improved with neutron economy. (N.H.)
Fast-ion losses induced by ACs and TAEs in the ASDEX Upgrade tokamak
García-Munoz, M.; Hicks, N.; Voornveld, van R.; Classen, I.G.J.; Bilato, R.; Bobkov, V.; Brambilla, M.; Bruedgam, M.; Fahrbach, H. -U.; Igochine, V.; Jaemsae, S.; Maraschek, M.; Sassenberg, K.
2010-01-01
The phase-space of convective and diffusive fast-ion losses induced by shear Alfv´en eigenmodes has been characterized in the ASDEX Upgrade tokamak. Time-resolved energy and pitch-angle measurements of fast-ion losses correlated in frequency and phase with toroidal Alfv´en eigenmodes (TAEs) and
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
International Nuclear Information System (INIS)
Sun, K.; Chenu, A.; Mikityuk, K.; Krepel, J.; Chawla, R.
2012-01-01
The core behaviour of a large (3600 MWth) sodium-cooled fast reactor (SFR) is investigated in this paper with the use of a coupled TRACE/PARCS model. The SFR neutron spectrum is characterized by several performance advantages, but also leads to one dominating neutronics drawback - a positive sodium void reactivity. This implies a positive reactivity effect when sodium coolant is removed from the core. In order to evaluate such feedback in terms of the dynamics, a representative unprotected loss-of-flow (ULOF) transient, i.e. flow run-down without SCRAM in which sodium boiling occurs, is analyzed. Although analysis of a single transient cannot allow general conclusions to be drawn, it does allow better understanding of the underlying physics and can lead to proposals for improving the core response during such an accident. The starting point of this study is the reference core design considered in the framework of the Collaborative Project on the European Sodium Fast Reactor (CP-ESFR). To reduce the void effect, the core has been modified by introducing an upper sodium plenum (along with a boron layer) and by reducing the core height-to-diameter ratio. For the ULOF considered, a sharp increase in core power results in melting of the fuel in the case of the reference core. In the modified core, a large dryout leads to melting of the clad. It seems that, for the hypothetical event considered, fuel failure cannot be avoided with just improvement of the neutronics design; therefore, thermal-hydraulics optimization has been considered. An innovative assembly design is proposed to prevent sodium vapour blocking the fuel channel. This results in preventing a downward propagation of the sodium boiling to the core center, thus limiting it to the upper region. Such a void map introduces a negative coolant density reactivity feedback, which dominates the total reactivity change. As a result, the power level and the fuel temperature are effectively reduced, and a large dryout
Energy Technology Data Exchange (ETDEWEB)
Sun, K. [Paul Scherrer Institut PSI, 5232 Villigen PSI (Switzerland); Ecole Polytechnique Federale de Lausanne EPFL, 1015 Lausanne (Switzerland); Chenu, A. [Ecole Polytechnique Federale de Lausanne EPFL, 1015 Lausanne (Switzerland); Mikityuk, K.; Krepel, J. [Paul Scherrer Institut PSI, 5232 Villigen PSI (Switzerland); Chawla, R. [Paul Scherrer Institut PSI, 5232 Villigen PSI (Switzerland); Ecole Polytechnique Federale de Lausanne EPFL, 1015 Lausanne (Switzerland)
2012-07-01
The core behaviour of a large (3600 MWth) sodium-cooled fast reactor (SFR) is investigated in this paper with the use of a coupled TRACE/PARCS model. The SFR neutron spectrum is characterized by several performance advantages, but also leads to one dominating neutronics drawback - a positive sodium void reactivity. This implies a positive reactivity effect when sodium coolant is removed from the core. In order to evaluate such feedback in terms of the dynamics, a representative unprotected loss-of-flow (ULOF) transient, i.e. flow run-down without SCRAM in which sodium boiling occurs, is analyzed. Although analysis of a single transient cannot allow general conclusions to be drawn, it does allow better understanding of the underlying physics and can lead to proposals for improving the core response during such an accident. The starting point of this study is the reference core design considered in the framework of the Collaborative Project on the European Sodium Fast Reactor (CP-ESFR). To reduce the void effect, the core has been modified by introducing an upper sodium plenum (along with a boron layer) and by reducing the core height-to-diameter ratio. For the ULOF considered, a sharp increase in core power results in melting of the fuel in the case of the reference core. In the modified core, a large dryout leads to melting of the clad. It seems that, for the hypothetical event considered, fuel failure cannot be avoided with just improvement of the neutronics design; therefore, thermal-hydraulics optimization has been considered. An innovative assembly design is proposed to prevent sodium vapour blocking the fuel channel. This results in preventing a downward propagation of the sodium boiling to the core center, thus limiting it to the upper region. Such a void map introduces a negative coolant density reactivity feedback, which dominates the total reactivity change. As a result, the power level and the fuel temperature are effectively reduced, and a large dryout
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Energy Technology Data Exchange (ETDEWEB)
Hamalainen, H.
2013-11-01
done by dividing the conductor into transposed subconductors. However, this comes with the expense of an increase in the DC resistance. In the doctoral thesis, a new method is presented to minimize the winding losses by applying a litz wire with noninsulated strands. The construction is the same as in a normal litz wire but the insulation between the subconductors has been left out. The idea is that the connection is kept weak to prevent harmful eddy currents from flowing. Moreover, the analytical solution for calculating the AC resistance factor of the litz-wire is supplemented by including an end-winding resistance in the analytical solution. A simple measurement device is developed to measure the AC resistance in the windings. In the case of a litz-wire with originally noninsulated strands, vacuum pressure impregnation (VPI) is used to insulate the subconductors. In one of the two cases studied, the VPI affected the AC resistance factor, but in the other case, it did not have any effect. However, more research is needed to determine the effect of the VPI on litz-wire with noninsulated strands. An empirical model is developed to calculate the AC resistance factor of a single-layer formwound winding. The model includes the end-winding length and the number of strands and turns. The end winding includes the circulating current (eddy currents that are traveling through the whole winding between parallel strands) and the main current. The end-winding length also affects the total AC resistance factor. (orig.)
The HST/ACS Coma Cluster Survey. II. Data Description and Source Catalogs
Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; Den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.;
2010-01-01
The Coma cluster, Abell 1656, was the target of a HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially-completed survey still covers approximately 50% of the core high density region in Coma. Observations were performed for twenty-five fields with a total coverage area of 274 aremin(sup 2), and extend over a wide range of cluster-centric radii (approximately 1.75 Mpe or 1 deg). The majority of the fields are located near the core region of Coma (19/25 pointings) with six additional fields in the south-west region of the cluster. In this paper we present SEXTRACTOR source catalogs generated from the processed images, including a detailed description of the methodology used for object detection and photometry, the subtraction of bright galaxies to measure faint underlying objects, and the use of simulations to assess the photometric accuracy and completeness of our catalogs. We also use simulations to perform aperture corrections for the SEXTRACTOR Kron magnitudes based only on the measured source flux and its half-light radius. We have performed photometry for 76,000 objects that consist of roughly equal numbers of extended galaxies and unresolved objects. Approximately two-thirds of all detections are brighter than F814W=26.5 mag (AB), which corresponds to the 10sigma, point-source detection limit. We estimate that Coma members are 5-10% of the source detections, including a large population of compact objects (primarily GCs, but also cEs and UCDs), and a wide variety of extended galaxies from cD galaxies to dwarf low surface brightness galaxies. The initial data release for the HST-ACS Coma Treasury program was made available to the public in August 2008. The images and catalogs described in this study relate to our second data release.
Directory of Open Access Journals (Sweden)
Wenhui Yang
Full Text Available Crystal proteins synthesized by Bacillus thuringiensis (Bt have been used as biopesticides because of their toxicity to the insect larval hosts. To protect the proteins from environmental stress to extend their activity, we have developed a new microcapsule formulation. Poly (acrylic acid (PAH and poly (styrene sulfonate (PSS were fabricated through layer-by-layer self-assembly based on a CaCO(3 core. Cry1Ac protoxins were loaded into microcapsules through layer-by-layer self-assembly at low pH, and the encapsulated product was stored in water at 4°C. Scanning electron microscopy (SEM was used to observe the morphology of the capsules. To confirm the successful encapsulation, the loading results were observed with a confocal laser scattering microscope (CLSM, using fluorescein-labeled Cry1Ac protoxin (FITC-Cry1Ac. The protoxins were released from the capsule under the alkaline condition corresponding to the midgut of certain insects, a condition which seldom exists elsewhere in the environment. The following bioassay experiment demonstrated that the microcapsules with Cry1Ac protoxins displayed approximately equivalent insecticidal activity to the Asian corn borer compared with free Cry1Ac protoxins, and empty capsules proved to have no effect on insects. Further result also indicated that the formulation could keep stable under the condition of heat and desiccation. These results suggest that this formulation provides a promising methodology that protects protoxins from the environment and releases them specifically in the target insects' midgut, which has shown potential as biopesticide in the field.
International Nuclear Information System (INIS)
Gittus, J.H.
1982-04-01
A review is presented of the various phenomena involved in degraded core accidents and the ensuing transport of fission products from the fuel to the primary circuit and the containment. The dominant accident sequences found in the PWR risk studies published to date are briefly described. Then chapters deal with the following topics: the condition and behaviour of water reactor fuel during normal operation and at the commencement of degraded core accidents; the generation of hydrogen from the Zircaloy-steam and the steel-steam reactions; the way in which the core deforms and finally melts following loss of coolant; debris relocation analysis; containment integrity; fission product behaviour during a degraded core accident. (U.K.)
Alternating-current transport losses of melt-cast processed Bi-2212 bulk superconductor bars
International Nuclear Information System (INIS)
Tsukamoto, T; Inada, R; Inagaki, N; Andoh, H; Sugiura, T; Oota, A
2003-01-01
Using a melt-casting method, we have fabricated two pieces of Bi-2212 bulk superconductor bar with square and rectangular cross-sections, and we have investigated the alternating-current (ac) transport self-field losses at 77 K. Despite the main contribution of hysteresis loss of the superconductor, there is some difference in the loss behaviour between these two samples. To elucidate the origin, we make numerical calculations on the ac transport self-field losses as a function of current amplitude I 0 below the critical current I c . At a fixed I 0 , the calculated values using the uniform J c distribution and the actual cross-sectional geometry are much higher than the experimental data for the sample with a square cross-section 7.5 x 7.5 mm 2 , while there is good agreement between the calculation and the experiment for the sample with a rectangular cross-section 4.5 x 13.6 mm 2 . The discrepancy appearing in the sample with a square cross-section is ascribed to the actual J c distribution, which is confirmed by critical current measurements when scraping off the sample. The local J c value decreases significantly in going from the surface to the interior of the sample. This suppresses the extension of the flux-penetration region to the interior under ac current transmission and lowers the loss generation compared with the calculated results obtained by the uniform J c distribution
International Nuclear Information System (INIS)
Long, C.M.; Rohrmann, G.F.; Merrill, G.F.
2009-01-01
Open reading frame 92 of the Autographa californica baculovirus (Ac92) is one of about 30 core genes present in all sequenced baculovirus genomes. Computer analyses predicted that the Ac92 encoded protein (called p33) and several of its baculovirus orthologs were related to a family of flavin adenine dinucleotide (FAD)-linked sulfhydryl oxidases. Alignment of these proteins indicated that, although they were highly diverse, a number of amino acids in common with the Erv1p/Alrp family of sulfhydryl oxidases are present. Some of these conserved amino acids are predicted to stack against the isoalloxazine and adenine components of FAD, whereas others are involved in electron transfer. To investigate this relationship, Ac92 was expressed in bacteria as a His-tagged fusion protein, purified, and characterized both spectrophotometrically and for its enzymatic activity. The purified protein was found to have the color (yellow) and absorption spectrum consistent with it being a FAD-containing protein. Furthermore, it was demonstrated to have sulfhydryl oxidase activity using dithiothreitol and thioredoxin as substrates.
Energy Technology Data Exchange (ETDEWEB)
Jouanne, A. von [Power Electronics Lab. - Elect. and Compt. Engineering Dept. - Oregon State Univ., Corvallis, OR (United States); Ben Banerjee, B. [Electric Power Research Inst. - Power Electronics, Energy Delivery, Palo Alto, CA (United States)
2000-07-01
Adjustable speed drive (ASD) compatibility and ride-through issues have caused increased concerns due to the susceptibility of AC and DC drives to power disturbances, and the costly results of process disruptions. These losses can be avoided for critical production processes by using ASDs with ride-through capabilities. This paper assesses industrial ride-through requirements and application issues for AC and DC drives, including medium voltage (2300/4160 V) multi-level inverter topologies. Ride-through alternatives are evaluated based on design, implementation and cost considerations in order to determine the most suitable solutions for various kVA ratings and time duration requirements. (orig.)
Optimizing efficiency on conventional transformer based low power AC/DC standby power supplies
DEFF Research Database (Denmark)
Nielsen, Nils
2004-01-01
This article describes the research results for simple and cheap methods to reduce the idle- and load-losses in very low power conventional transformer based power supplies intended for standby usage. In this case "very low power" means 50 Hz/230 V-AC to 5 V-DC@1 W. The efficiency is measured...... on two common power supply topologies designed for this power level. The two described topologies uses either a series (or linear) or a buck regulation approach. Common to the test power supplies is they either are using a standard cheap off-the-shelf transformer, or one, which are loss optimized by very...
Review of the SCDAP/RELAP5/MOD3.1 code structure and core T/H model before core damage
International Nuclear Information System (INIS)
Kim, See Darl; Kim, Dong Ha
1998-04-01
The SCDAP/RELAP5 code has been developed for best estimate transient simulation of light water reactor coolant systems during a severe accident. The code is being developed at the INEL under the primary sponsorship of the Office of Nuclear Regulatory Research of the U.S. NRC. As The current time, the SCDAP/RELAP5/MOD3.1 code is the result of merging the RELAP5/MOD3 and SCDAP models. The code models the coupled behavior of the reactor coolant system, core, fission product released during a severe accident transient as well as large and small break loss of coolant accidents, operational transients such as anticipated transient without SCRAM, loss of offsite power, loss of feedwater, and loss of flow. Major purpose of the report is to provide information about the characteristics of SCDAP/RELAP5/MOD3.1 core T/H models for an integrated severe accident computer code being developed under the mid/long-term project. This report analyzes the overall code structure which consists of the input processor, transient controller, and plot file handler. The basic governing equations to simulate the thermohydraulics of the primary system are also described. As the focus is currently concentrated in the core, core nodalization parameters of the intact geometry and the phenomenological subroutines for the damaged core are summarized for the future usage. In addition, the numerical approach for the heat conduction model is investigated along with heat convection model. These studies could provide a foundation for input preparation and model improvement. (author). 6 refs., 3 tabs., 4 figs
International Nuclear Information System (INIS)
Royl, P.; Frizonnet, J.M.; Moran, J.
1993-02-01
A comparative analysis of the unprotected loss of flow (ULOF) accident has been performed for the LVC core (Lower Void Core) of the European Fast Reactor EFR with the FRAX5B and FRAX5C codes from the AEA-T, the PHYSURAC code from CEA and the SAS4A REF92 code system developed jointly between KfK, CEA and PNC. The accident is triggered by the run down of the coolant pumps with failure to trip the reactor by the primary and/or secondary shutdown system. Only a limited amount of mitigating reactivity from the third shutdown line was considered so that the accident can progress into boiling and core disruption. This code outlines the important modelling differences and compares the different simulations. The discussion of the rather wide spectrum of calculated accident progressions identifies the generic differences, relates them to the applied models, and summarizes the key points that are responsible for the different progressions. A comparison of the consequence spectrum from all simulations indicates zero work energies for the majority of the calculations. All simulations show up the need for a continued accident analysis into the early and late transition phase
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
THz Tube Waveguides With Low Loss, Low Dispersion, and High Bandwidth
DEFF Research Database (Denmark)
Bao, Hualong; Nielsen, Kristian; Bang, Ole
2014-01-01
We propose, model and experimentally characterize a novel class of terahertz hollow-core tube waveguides with high-loss cladding material, resulting in propagation with low loss, low dispersion, and high useful bandwidth.......We propose, model and experimentally characterize a novel class of terahertz hollow-core tube waveguides with high-loss cladding material, resulting in propagation with low loss, low dispersion, and high useful bandwidth....
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
International Nuclear Information System (INIS)
Garaio, E.; Collantes, J.M.; Garcia, J.A.; Plazaola, F.; Mornet, S.; Couillaud, F.; Sandre, O.
2014-01-01
Measurement of specific absorption rate (SAR) of magnetic nanoparticles is crucial to assert their potential for magnetic hyperthermia. To perform this task, calorimetric methods are widely used. However, those methods are not very accurate and are difficult to standardize. In this paper, we present AC magnetometry results performed with a lab-made magnetometer that is able to obtain dynamic hysteresis-loops in the AC magnetic field frequency range from 50 kHz to 1 MHz and intensities up to 24 kA m −1 . In this work, SAR values of maghemite nanoparticles dispersed in water are measured by AC magnetometry. The so-obtained values are compared with the SAR measured by calorimetric methods. Both measurements, by calorimetry and magnetometry, are in good agreement. Therefore, the presented AC magnetometer is a suitable way to obtain SAR values of magnetic nanoparticles. - Highlights: • We propose AC magnetometry as a method to measure the specific absorption rate (SAR) of magnetic nanoparticles suitable for magnetic hyperthermia therapy. • We have built a lab-made AC magnetometer, which is able to measure magnetic dynamic hysteresis-loops of nanoparticle dispersions. • The device works with AC magnetic field intensities up to 24 kA m −1 in a frequency range from 75 kHz to 1 MHz. • The SAR values of maghemite nanoparticles around 12 nm in magnetic diameter dispersed in water are measured by the lab-made magnetometer and different calorimetric methods. • Although all methods are in good agreement, several factors (probe location, thermal inertia, losses, etc.) make calorimetric method less accurate than AC magnetometry
Radiation resistivity of pure-silica core image guide
International Nuclear Information System (INIS)
Hayami, H.; Ishitani, T.; Kishihara, O.; Suzuki, K.
1988-01-01
Radiation resistivity of pure-silica core image guides were investigated in terms of incremental spectral loss and quality of pictures transmitted through the image guides. Radiation-induced spectral losses were measured so as to clarify the dependences of radiation resistivity on such parameters as core materials (OH and Cl contents), picture element dimensions, (core packing density and cladding thickness), number of picture elements and drawing conditions. As the results, an image guide with OH-and Cl-free pure-silica core, 30-45% in core packing density, and 1.8 ∼ 2.2 μm in cladding thickness showed the lowest loss. The parameters to design this image guide were almost the same as those to obtain a image guide with good picture quality. Radiation resistivity of the image guide was not dependent on drawing conditions and number of picture elements, indicating that the image guide has large allowable in production conditions and that reliable quality is constantly obtained in production. Radiation resistivity under high total doses was evaluated using the image guide with the lowest radiation-induced loss. Maximum usable lengths of the image guide for practical use under specific high total doses and maximum allowable total doses for the image guide in specific lengths were extrapolated. Picture quality in terms of radiation-induced degradation in color fidelity in the pictures transmitted through image guides was quantitatively evaluated in the chromaticity diagram based on the CIE standard colorimetric system and in the color specification charts according to three attributes of colors. The image guide with the least spectral incremental loss gives the least radiation-induced degradation in color fidelity in the pictures as well. (author)
Dielectric behavior and ac electrical conductivity of nanocrystalline nickel aluminate
International Nuclear Information System (INIS)
Kurien, Siby; Mathew, Jose; Sebastian, Shajo; Potty, S.N.; George, K.C.
2006-01-01
Nanocrystalline nickel aluminate was prepared by chemical co-precipitation, and nanoparticles having different particle size were obtained by annealing the precursor at different temperatures. The TG/DTA measurements showed thermal decomposition was a three-step process with crystallisation of the spinel phase started at a temperature 420 deg. C. The X-ray diffraction analysis confirmed that the specimen began to crystallise on annealing above 420 deg. C and became almost crystalline at about 900 deg. C. The particle sizes were calculated from XRD. Dielectric properties of nickel aluminate were studied as a function of the frequency of the applied ac signal at different temperatures. It was seen the real dielectric constant ε', and dielectric loss tan δ decreased with frequency of applied field while the ac conductivity increased as the frequency of the applied field increased. The dielectric relaxation mechanism is explained by considering nanostructured NiAl 2 O 4 as a carrier-dominated dielectric with high density of hopping charge carriers. The variation of ε' with different particle size depends on several interfacial region parameters, which change with the average particle size
International Nuclear Information System (INIS)
Peng, Eric W.; Ferguson, Henry C.; Goudfrooij, Paul; Hammer, Derek; Lucey, John R.; Marzke, Ronald O.; Puzia, Thomas H.; Carter, David; Balcells, Marc; Bridges, Terry; Chiboucas, Kristin; Del Burgo, Carlos; Graham, Alister W.; Guzman, Rafael; Hudson, Michael J.; Matkovic, Ana
2011-01-01
Intracluster stellar populations are a natural result of tidal interactions in galaxy clusters. Measuring these populations is difficult, but important for understanding the assembly of the most massive galaxies. The Coma cluster of galaxies is one of the nearest truly massive galaxy clusters and is host to a correspondingly large system of globular clusters (GCs). We use imaging from the HST/ACS Coma Cluster Survey to present the first definitive detection of a large population of intracluster GCs (IGCs) that fills the Coma cluster core and is not associated with individual galaxies. The GC surface density profile around the central massive elliptical galaxy, NGC 4874, is dominated at large radii by a population of IGCs that extend to the limit of our data (R +4000 -5000 (systematic) IGCs out to this radius, and that they make up ∼70% of the central GC system, making this the largest GC system in the nearby universe. Even including the GC systems of other cluster galaxies, the IGCs still make up ∼30%-45% of the GCs in the cluster core. Observational limits from previous studies of the intracluster light (ICL) suggest that the IGC population has a high specific frequency. If the IGC population has a specific frequency similar to high-S N dwarf galaxies, then the ICL has a mean surface brightness of μ V ∼ 27 mag arcsec -2 and a total stellar mass of roughly 10 12 M sun within the cluster core. The ICL makes up approximately half of the stellar luminosity and one-third of the stellar mass of the central (NGC 4874+ICL) system. The color distribution of the IGC population is bimodal, with blue, metal-poor GCs outnumbering red, metal-rich GCs by a ratio of 4:1. The inner GCs associated with NGC 4874 also have a bimodal distribution in color, but with a redder metal-poor population. The fraction of red IGCs (20%), and the red color of those GCs, implies that IGCs can originate from the halos of relatively massive, L* galaxies, and not solely from the disruption of
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
Hollow-core fibers for high power pulse delivery
DEFF Research Database (Denmark)
Michieletto, Mattia; Lyngsø, Jens K.; Jakobsen, Christian
2016-01-01
We investigate hollow-core fibers for fiber delivery of high power ultrashort laser pulses. We use numerical techniques to design an anti-resonant hollow-core fiber having one layer of non-touching tubes to determine which structures offer the best optical properties for the delivery of high power...... picosecond pulses. A novel fiber with 7 tubes and a core of 30 mu m was fabricated and it is here described and characterized, showing remarkable low loss, low bend loss, and good mode quality. Its optical properties are compared to both a 10 mu m and a 18 mu m core diameter photonic band gap hollow......-core fiber. The three fibers are characterized experimentally for the delivery of 22 picosecond pulses at 1032nm. We demonstrate flexible, diffraction limited beam delivery with output average powers in excess of 70W. (C) 2016 Optical Society of America...
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Ice core carbonyl sulfide measurements from a new South Pole ice core (SPICECORE)
Aydin, M.; Nicewonger, M. R.; Saltzman, E. S.
2017-12-01
Carbonyl sulfide (COS) is the most abundant sulfur gas in the troposphere with a present-day mixing ratio of about 500 ppt. Direct and indirect emissions from the oceans are the predominant sources of atmospheric COS. The primary removal mechanism is uptake by terrestrial plants during photosynthesis. Because plants do not respire COS, atmospheric COS levels are linked to terrestrial gross primary productivity (GPP). Ancient air trapped in polar ice cores has been used to reconstruct COS records of the past atmosphere, which can be used to infer past GPP variability and potential changes in oceanic COS emission. We are currently analyzing samples from a newly drilled intermediate depth ice core from South Pole, Antarctica (SPICECORE). This core is advantageous for studying COS because the cold temperatures of South Pole ice lead to very slow rates of in situ loss due to hydrolysis. One hundred and eighty-four bubbly ice core samples have been analyzed to date with gas ages ranging from about 9.2 thousand (733 m depth) to 75 years (126 m depth) before present. After a 2% correction for gravitational enrichment in the firn, the mean COS mixing ratio for the data set is 312±15 ppt (±1s), with the data set median also equal to 312 ppt. The only significant long-term trend in the record is a 5-10% increase in COS during the last 2-3 thousand years of the Holocene. The SPICECORE data agree with previously published ice core COS records from other Antarctic sites during times of overlap, confirming earlier estimates of COS loss rates to in situ hydrolysis in ice cores. Antarctic ice core data place strict constraints on the COS mixing ratio and its range of variability in the southern hemisphere atmosphere during the last several millennia. Implications for the atmospheric COS budget will be discussed.
Hollow-core revolver fibre with a double-capillary reflective cladding
Energy Technology Data Exchange (ETDEWEB)
Kosolapov, A F; Alagashev, G K; Kolyadin, A N; Pryamikov, A D; Dianov, E M [Fiber Optics Research Center, Russian Academy of Sciences, Moscow (Russian Federation); Biryukov, A S; Bufetov, I A [Moscow Institute of Physics and Technology (State University), Dolgoprudnyi, Moscow Region (Russian Federation)
2016-03-31
We report the fabrication of the first hollow-core revolver fibre with a core diameter as small as 25 μm and an optical loss no higher than 75 dB km{sup -1} at a wavelength of 1850 nm. The decrease in core diameter, with no significant increase in optical loss, is due to the use of double nested capillaries in the reflective cladding design. A number of technical problems pertaining to the fabrication of such fibres are resolved. (fiber optics)
Stress-based Variable-inductor for Electronic Ballasts
DEFF Research Database (Denmark)
Zhang, Lihui; Xia, Yongming; Lu, Kaiyuan
2015-01-01
Current-controlled variable inductors adjust the inductance of an alternating current (ac) coil by applying a controlled dc current to saturate the iron cores of the ac coil. The controlled dc current has to be maintained during operation, which results in increased power losses. This paper prese......-based variable inductor concept is validated using a 3-D finite-element analysis. A prototype was manufactured, and the experimental results are presented. A linear relationship between inductance and applied stress can be achieved.......Current-controlled variable inductors adjust the inductance of an alternating current (ac) coil by applying a controlled dc current to saturate the iron cores of the ac coil. The controlled dc current has to be maintained during operation, which results in increased power losses. This paper...... presents a new stress-based variable inductor to control inductance using the inverse magnetostrictive effect of a magnetostrictive material. The stress can be applied by a piezoelectrical material, and thus a voltage-controlled variable inductor can be realized with zero-power consumption. The new stress...
International Nuclear Information System (INIS)
Adachi, Hiromichi; Sudo, Yukio; Iwamura, Takamichi; Osakabe, Masahiro; Ohnuki, Akira; Hirano, Kemmei
1982-07-01
The Slab Core Test Facility (SCTF) of Japan Atomic Energy Research Institute (JAERI) was constructed to investigate two-dimensional thermohydrodynamics in the core and the communication in fluid behavior between the core and the upper plenum during the last part of blowdown, refill and reflood phases of a posturated loss-of-coolant accident (LOCA) of a pressurized water reactor (PWR). In the present report, effects of system pressure on reflooding phenomena shall be discussed based on the data of Tests S1-SH2, S1-01 and S1-02 which are the parameteris tests for system pressure effects belonging to the SCTF Core-I forced flooding test series. Major items discussed in this report are (1) hydrodynamic behavior in the system, (2) core thermal behavior, (3) core heat transfer and (4) two-dimensional hydrodynamic behavior in the pressure vessel including the core. (author)
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Vinay, K.; Shivakumar, K.; Ravikiran, Y. T.; Revanasiddappa, M.
2018-05-01
The present work is an investigation of ac conduction behaviour and dielectric response of Polyaniline/Ag/Graphene/SrTiO3 (PAGS) composite prepared by in-situ chemical oxidative interfacial polymerization using (NH4)2S2O8 as an oxidising agent at 0-5°C. The structural characterization of the samples was examined using FT-IR and XRD techniques. The ac conductivity and dielectric response of synthesized polymer composites were investigated at room temperature in the frequency range varying from 5 × 101 - 5 × 106 Hz using HIOKI make 3532-50 LCR Hi-tester. The ac conductivity increases with increase in frequency and follows the regular trend, the real dielectric constant (ɛ') and imaginary dielectric constant (ɛ'') decreases with increase in frequency and exhibits almost zero dielectric loss at higher frequencies, which suggests that the composite is a lossless material at frequencies beyond 3Hz.
International Nuclear Information System (INIS)
Maschek, W.; Royl, P.
1988-09-01
Flowing and freezing of mobile core materials change the fissile material distribution and core-inventory under hypothetical accident conditions and determine the path to permanent shutdown of the neutronic events and the energetic potentials. The report classifies the bondary conditions for such flowing and freezing processes by going through the different situations under which these processes can occur in the scenario of the unprotected loss of flow (ULOF) accident. The classification is based on ULOF-accident simulations for a homogeneous reactor core concept of a 300 MWe LMFBR (e. g. SNR-300), but many boundary conditions are also characteristic for other core designs. A review of the relevant experiments is then made to correlate the available experimental information with these classified boundary conditions and to look at the resulting flowing and freezing processes. Boundary conditions that have been experimentally shown to be important are assigned high priorities. The data are specifically valued in relation to these boundary conditions of high priorities. The review includes the major experimental programs with published results. The discussion shows that the results from most clean condition tests for melt relocations are valuable for a better understanding of basic phenomena and analytical model development, but are not directly applicable to real accident conditions. The database for relevant boundary conditions from the ULOF scenario is limited and largely included in integral sequence tests from which quantitative information for modelling is difficult to obtain. Needs for additional investigations are identified. The suggestions are mainly restricted to investigations of the early phase of fuel removal. They are given with reference to candidate facilities and include relocations in the subassemblies and in the inter-subassembly gaps. Particular emphasis is put on the leading edge properties and possible driving forces to which more attention
Ac conductivity and relaxation mechanism in Ba0.9Sr0.1TiO3
International Nuclear Information System (INIS)
Singh, A.K.; Barik, Subrat K.; Choudhary, R.N.P.; Mahapatra, P.K.
2009-01-01
The ac conductivity and relaxation mechanism in Ba 0.9 Sr 0.1 TiO 3 ceramics have been investigated systematically. A high-temperature solid-state reaction technique was used to synthesize the compound. The formation of the compound was checked by an X-ray diffraction (XRD) technique. The dielectric permittivity and the loss tangent of the sample were measured in a frequency range from 1 kHz to 1 MHz at different temperatures (30-500 deg. C). A study on dielectric properties reveals the electrical relaxation phenomenon occurs in the material. The activation energy was calculated from the temperature variation of dc conductivity. Studies of frequency and temperature dependence of ac conductivity of the compound suggest that conduction process in the material is thermally activated.
Core loss during a severe accident (COLOSS)
International Nuclear Information System (INIS)
Adroguer, B.; Bertrand, F.; Chatelard, P.; Cocuaud, N.; Van Dorsselaere, J.P.; Bellenfant, L.; Knocke, D.; Bottomley, D.; Vrtilkova, V.; Belovsky, L.; Mueller, K.; Hering, W.; Homann, C.; Krauss, W.; Miassoedov, A.; Schanz, G.; Steinbrueck, M.; Stuckert, J.; Hozer, Z.; Bandini, G.; Birchley, J.; Berlepsch, T. von; Kleinhietpass, I.; Buck, M.; Benitez, J.A.F.; Virtanen, E.; Marguet, S.; Azarian, G.; Caillaux, A.; Plank, H.; Boldyrev, A.; Veshchunov, M.; Kobzar, V.; Zvonarev, Y.; Goryachev, A.
2005-01-01
The COLOSS project was a 3-year shared-cost action, which started in February 2000. The work-programme performed by 19 partners was shaped around complementary activities aimed at improving severe accident codes. Unresolved risk-relevant issues regarding H 2 production, melt generation and the source term were studied through a large number of experiments such as (a) dissolution of fresh and high burn-up UO 2 and MOX by molten Zircaloy (b) simultaneous dissolution of UO 2 and ZrO 2 (c) oxidation of U-O-Zr mixtures (d) degradation-oxidation of B 4 C control rods. Corresponding models were developed and implemented in severe accident computer codes. Upgraded codes were then used to apply results in plant calculations and evaluate their consequences on key severe accident sequences in different plants involving B 4 C control rods and in the TMI-2 accident. Significant results have been produced from separate-effects, semi-global and large-scale tests on COLOSS topics enabling the development and validation of models and the improvement of some severe accident codes. Breakthroughs were achieved on some issues for which more data are needed for consolidation of the modelling in particular on burn-up effects on UO 2 and MOX dissolution and oxidation of U-O-Zr and B 4 C-metal mixtures. There was experimental evidence that the oxidation of these mixtures can contribute significantly to the large H 2 production observed during the reflooding of degraded cores under severe accident conditions. The plant calculation activity enabled (a) the assessment of codes to calculate core degradation with the identification of main uncertainties and needs for short-term developments and (b) the identification of safety implications of new results. Main results and recommendations for future R and D activities are summarized in this paper
Modularized Functions of the Fanconi Anemia Core Complex
Directory of Open Access Journals (Sweden)
Yaling Huang
2014-06-01
Full Text Available The Fanconi anemia (FA core complex provides the essential E3 ligase function for spatially defined FANCD2 ubiquitination and FA pathway activation. Of the seven FA gene products forming the core complex, FANCL possesses a RING domain with demonstrated E3 ligase activity. The other six components do not have clearly defined roles. Through epistasis analyses, we identify three functional modules in the FA core complex: a catalytic module consisting of FANCL, FANCB, and FAAP100 is absolutely required for the E3 ligase function, and the FANCA-FANCG-FAAP20 and the FANCC-FANCE-FANCF modules provide nonredundant and ancillary functions that help the catalytic module bind chromatin or sites of DNA damage. Disruption of the catalytic module causes complete loss of the core complex function, whereas loss of any ancillary module component does not. Our work reveals the roles of several FA gene products with previously undefined functions and a modularized assembly of the FA core complex.
Modal analysis and acoustic transmission through offset-core honeycomb sandwich panels
Mathias, Adam Dustin
The work presented in this thesis is motivated by an earlier research that showed that double, offset-core honeycomb sandwich panels increased thermal resistance and, hence, decreased heat transfer through the panels. This result lead to the hypothesis that these panels could be used for acoustic insulation. Using commercial finite element modeling software, COMSOL Multiphysics, the acoustical properties, specifically the transmission loss across a variety of offset-core honeycomb sandwich panels, is studied for the case of a plane acoustic wave impacting the panel at normal incidence. The transmission loss results are compared with those of single-core honeycomb panels with the same cell sizes. The fundamental frequencies of the panels are also computed in an attempt to better understand the vibrational modes of these particular sandwich-structured panels. To ensure that the finite element analysis software is adequate for the task at hand, two relevant benchmark problems are solved and compared with theory. Results from these benchmark results compared well to those obtained from theory. Transmission loss results from the offset-core honeycomb sandwich panels show increased transmission loss, especially for large cell honeycombs when compared to single-core honeycomb panels.
Sensitivity analysis of thermal hydraulic response in containment at core meltdown accident
International Nuclear Information System (INIS)
Kobayashi, Kensuke; Ishigami, Tsutomu; Horii, Hideo; Chiba, Takemi.
1985-01-01
A sensitivity analysis of thermal hydraulic response in a containment during a 'station blackout' (the loss of all AC power) accident at Browns Ferry unit one plant was performed with the computer code MARCH 1.0. In the analysis, the plant station batteries were assumed to be available for 4h after the initiation of the accident. The thermal hydraulic response in the containment was calculated by varying several input data for MARCH 1.0 independently and the deviation among calculated results were investigated. The sensitivity analysis showed that (a) the containment would fail due to the overtemperature without any operator actions for plant recovery, which would be strongly dependent on the model of the debris-concrete interaction and the input parameters for specifying the containment failure modes in MARCH 1.0, (b) a core melting temperature and an amount of water left in a primary system at the end of the meltdown were identified as important parameters which influenced the time of the containment failure, and (c) experimental works regarding the parameters mentioned above could be recommended. (author)
Osinalde, M.; Infante, P.; Domínguez, L.; Blanco, J. M.; del Val, J. J.; Chizhik, A.; González, J.
2017-12-01
We report changes of coercivity, induced magnetic anisotropy, magneto-optical domain structure and frequency dependencies of coercivity and energy loss (up to 10 MHz) associated with the structural modifications produced by thermal treatments under applied magnetic field (field annealing) in toroidal wound cores of Fe73.5Cu1Nb3Si15.5B7 amorphous alloy. The thermal treatment (535 °C, 1 h) leads to the typical nanocrystalline structure of α-Fe(Si) nanograins (60-65% relative volume, 10-20 nm average grain size embedded in a residual amorphous matrix, while the magnetic field with the possibility to be applied in two directions to the toroidal core axis, that is in transverse (which is equivalent to the transverse direction of the ribbon) or longitudinal (equivalent to the longitudinal direction of the ribbon), develops a macroscopic uniaxial magnetic anisotropy in the transverse (around 245 J/m3) or longitudinal (around 85 J/m3) direction of the ribbon, respectively. It is remarkable the quasi-unhysteretic character of the cores with these two kinds of field annealing as comparing with that of the as-quenched one. Magneto-optical study by Kerr-effect of the ribbons provides useful information on the domain structure of the surface in agreement with the direction and intensity of the induced magnetic anisotropy. This induced uniaxial magnetic anisotropy plays a very important role on the Hc(f) and EL(f) curves, (f: frequency), being drastic the presence and direction of the induced magnetic anisotropy. In addition, these frequency dependencies show a significant change at the frequency around 100 Hz.
Zhao, Tongtong; Lou, Shuqin; Wang, Xin; Zhou, Min; Lian, Zhenggang
2016-08-10
We design an ultrabroadband polarization splitter based on three-core photonic crystal fiber (PCF). A modulation core and two fluorine-doped cores are introduced to achieve an ultrawide bandwidth. The properties of three-core PCF are modeled by using the full-vector finite element method along with the full-vector beam propagation method. Numerical results demonstrate that an ultrabroadband splitter with 320 nm bandwidth with an extinction ratio as low as -20 dB can be achieved by using 52.8 mm long three-core PCF. This splitter also has high compatibility with standard single-mode fibers as the input and output ports due to low splicing loss of 0.02 dB. All the air holes in the proposed structure are circular holes and arranged in a triangular lattice that makes it easy to fabricate.
International Nuclear Information System (INIS)
Ando, Masaki.
1987-01-01
Purpose: To actuate an automatic pressure down system (ADS) and a low pressure emergency core cooling system (ECCS) upon water level reduction of a nuclear reactor other than loss of coolant accidents (LOCA). Constitution: ADS in a BWR type reactor is disposed for reducing the pressure in a reactor container thereby enabling coolant injection from a low pressure ECCS upon LOCA. That is, ADS has been actuated by AND signal for a reactor water level low signal and a dry well pressure high signal. In the present invention, ADS can be actuated further also by AND signal of the reactor water level low signal, the high pressure ECCS and not-operation signal of reactor isolation cooling system. In such an emergency core cooling system thus constituted, ADS operates in the same manner as usual upon LOCA and, further, ADS is operated also upon loss of feedwater accident in the reactor pressure vessel in the case where there is a necessity for actuating the low pressure ECCS, although other high pressure ECCS and reactor isolation cooling system are not operated. Accordingly, it is possible to improve the reliability upon reactor core accident and mitigate the operator burden. (Horiuchi, T.)
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Radiation resistance of quartz core fibers, (6)
International Nuclear Information System (INIS)
Suzuki, Toshiya; Morisawa, Masaaki; Gozen, Toshikazu; Tanaka, Yukihiro; Shintani, Takeshi; Okamoto, Shin-ichi.
1988-01-01
Quatz optical fibers have been used for the communication channels for long distance and large capacity, in addition, their application to the communication system in radiation environment such as nuclear power plants and artificial statellites has been positively examined. In the case of the application to aircrafts and communication satellites, optical fibers are exposed to the temperature variation of wider range than the system on the ground. Particularly, the radiation resistance of optical fibers depends largely on temperature, and at low temperature, the increase of loss is remarkable, therefore, it is important to know the characteristics in low temperature radiation environment. This time, five kinds of the core materials were prepared, and gamma-ray was irradiated at -80degC to evaluate the characteristics of increasing loss and restoration. In this report, based on the results of these evaluation, the wavelength dependence, the effect of impurities in the cores and so on are described. The absorption loss increased remarkably in short wavelength. The increase of loss in high OH fibers became high particularly in the case of low optical power. The effect of Cl was especially conspicuous in the restoration characteristics. Chlorine-free core fibers have the excellent restoration characteristics independent of wavelength and optical power. (K.I.)
Evaluation of Required Water Sources during Extended Loss of All AC Power for CANDU NPPs
Energy Technology Data Exchange (ETDEWEB)
Jeon, Woo Jae; Lee, Kyung Jin; Kim, Min Ki; Kim, Keon Yeop; Park, Da Hee; Oh, Seo Bin [FNC Technology Co., Yongin (Korea, Republic of); Chang, Young Jin; Byun, Choong Seop [KHNP, Daejeon (Korea, Republic of)
2016-10-15
Fukushima accident was caused by lasting long hours of Station Black-Out (SBO) triggered from natural disaster. This accident had resulted in the reactor core damage. The purpose of this study is to evaluate the required water sources to maintain hot standby conditions until 72 hours during ELAP situation. The analysis was performed with CATHENA code. CATHENA code has been developed for the best-estimated transient simulation of CANDU plants. This study was carried out to evaluate the strategy to maintain hot standby conditions during ELAP situation in CANDU reactors. In this analysis, water was supplied to SG by MSSV open and by the gravity feed. It can cool the core without damage until the dousing tank depletion. Before dousing tank depletion, the emergency water supply pump was available by emergency power restoration. The pump continuously fed water to SG. So it is expected that the reactor core can be cooled down without damage for 72 hours if water source is enough to feed. This result is useful to make a strategy against SBO including ELAP situation.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Large core plastic planar optical splitter fabricated by 3D printing technology
Prajzler, Václav; Kulha, Pavel; Knietel, Marian; Enser, Herbert
2017-10-01
We report on the design, fabrication and optical properties of large core multimode optical polymer splitter fabricated using fill up core polymer in substrate that was made by 3D printing technology. The splitter was designed by the beam propagation method intended for assembling large core waveguide fibers with 735 μm diameter. Waveguide core layers were made of optically clear liquid adhesive, and Veroclear polymer was used as substrate and cover layers. Measurement of optical losses proved that the insertion optical loss was lower than 6.8 dB in the visible spectrum.
Topologically protected loop flows in high voltage AC power grids
International Nuclear Information System (INIS)
Coletta, T; Delabays, R; Jacquod, Ph; Adagideli, I
2016-01-01
Geographical features such as mountain ranges or big lakes and inland seas often result in large closed loops in high voltage AC power grids. Sizable circulating power flows have been recorded around such loops, which take up transmission line capacity and dissipate but do not deliver electric power. Power flows in high voltage AC transmission grids are dominantly governed by voltage angle differences between connected buses, much in the same way as Josephson currents depend on phase differences between tunnel-coupled superconductors. From this previously overlooked similarity we argue here that circulating power flows in AC power grids are analogous to supercurrents flowing in superconducting rings and in rings of Josephson junctions. We investigate how circulating power flows can be created and how they behave in the presence of ohmic dissipation. We show how changing operating conditions may generate them, how significantly more power is ohmically dissipated in their presence and how they are topologically protected, even in the presence of dissipation, so that they persist when operating conditions are returned to their original values. We identify three mechanisms for creating circulating power flows, (i) by loss of stability of the equilibrium state carrying no circulating loop flow, (ii) by tripping of a line traversing a large loop in the network and (iii) by reclosing a loop that tripped or was open earlier. Because voltages are uniquely defined, circulating power flows can take on only discrete values, much in the same way as circulation around vortices is quantized in superfluids. (paper)
The Effect of Adding Antimony Trioxide (Sb2O3 On A.C Electrical Properties of (PVA-PEG Films
Directory of Open Access Journals (Sweden)
Akeel Shakir Alkelaby
2017-12-01
Full Text Available In this work, many samples have been prepared by adding Antimony Trioxide (Sb2O3 to the polyvinyl alcohol-poly ethylene glycol (PVA-PEG. The effect of the Sb2O3 added as a filler with different weight percentages on the A.C electrical properties have been investigated. The samples were prepared as films by solution cast technique. The experimental results of the A.C electrical properties show that the dielectric constant increase with the increasing frequency of applied electrical field and concentration of the Antimony Trioxide. Dielectric loss decrease with the increasing the frequency, while it increases with the increase of the concentration of the Antimony Trioxide. The A.C electrical conductivity increase with increasing the Antimony Trioxide contain and frequency for the composition.
A perpendicular AC biased ferrite tuned cavity for the TRIUMF KAON factory booster synchrotron
International Nuclear Information System (INIS)
Poirier, R.L.; Enegren, T.A.; Haddock, C.; Enchevich, I.
1990-06-01
The rf cavity for the booster synchrotron requires a frequency swing of 46 MHz at a repetition rate of 50 Hz. This will be accomplished using a tuner containing yttrium garnet ferrite where the bias field is perpendicular to the rf magnetic field. Conventional methods use parallel biased NiZn ferrite. Yttrium garnet ferrite possess a high electric quality factor. However the ac magnetizing circuit is much more complicated and special care must be taken to minimize the induced eddy current losses when designing the tuner. A dc biased prototype cavity was constructed and tested at Los Alamos. As part of the project definition study for the proposed KAON factory, this cavity has now been almost entirely rebuilt at TRIUMF with a completely redesigned tuner for ac bias operation. Measurements and test results will be reported. (Author) 2 refs., 8 figs
Low-loss rotated porous core hexagonal single-mode fiber in THz regime
DEFF Research Database (Denmark)
Islam, Raonaqul; Hasanuzzaman, G.K.M.; Habib, Selim
2015-01-01
A kind of porous core photonic crystal fiber (PCF) for terahertz (THz) wave propagation is proposed in thispaper. By intentionally rotating the porous core lattice structure, a dispersion of 1.06 ± 0.12 ps/THz/cm ina frequency range of 0.5–1.08 THz is observed. Also, a very low material absorptio...
Risk Assessment Method of UHV AC/DC Power System under Serious Disasters
Directory of Open Access Journals (Sweden)
Rishang Long
2016-12-01
Full Text Available Based on the theory of risk assessment, the risk assessment method for an ultra-high voltage (UHV AC/DC hybrid power system under severe disaster is studied. Firstly, considering the whole process of cascading failure, a fast failure probability calculation method is proposed, and the whole process risk assessment model is established considering the loss of both fault stage and recovery stage based on Monte Carlo method and BPA software. Secondly, the comprehensive evaluation index system is proposed from the aspects of power system structure, fault state and economic loss, and the quantitative assessment of system risk is carried out by an entropy weight model. Finally, the risk assessment of two UHV planning schemes are carried out and compared, which proves the effectiveness of the research work.
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Filter Influence on Rotor Losses in Coreless Axial Flux Permanent Magnet Machines
Directory of Open Access Journals (Sweden)
SANTIAGO, J.
2013-02-01
Full Text Available This paper investigates the eddy current losses induced in the rotor of coreless Axial-Flux machines. The calculation of eddy currents in the magnets requires the simulation of the inverter and the filter to obtain the harmonic content of the stator currents and FEM analysis of the magnets in the rotor. Due to the low inductance in coreless machines, the induced eddy current losses in the rotor remain lower than in traditional slotted machines. If only machine losses are considered, filters in DC/AC converters are not required in machines with wide airgaps as time harmonic losses in the rotor are very low.The harmonic content both from simulations and experimental results of a DC/AC converter are used to calculate the eddy currents in the rotor magnets. The properties of coreless machine topologies are investigated and some simplifications are proposed for time efficient 3D-FEM analysis. The time varying magnetic field can be considered constant over the magnets when the pole is divided in several magnets.The simplified FEM method to calculate eddy current losses is applicable to coreless machines with poles split into several magnets, although the conclusions are applicable to all coreless and slotless motors and generators.
Capacitance measurements and AC conductivity of Nickel Phthalocyanine films
International Nuclear Information System (INIS)
Darwish, S.
2005-01-01
A C dark Current measurements of nickel phthalocyanine thin films using ohmic gold electrodes are investigated in the frequency range 30-10 Hz and within the temperature range 295-385 K. The A C conductivity as D Ac is found to vary as within the index s < 1, indicating a dominant hopping process at low temperatures. From the temperature dependence of A C conductivity, free carrier conduction with mean activation energy of 0.31 eV is observed at higher temperatures. Capacitance and loss tangent are found to be decreased with increasing frequency and increase with increasing temperature. Such characteristics are found to be in good qualitative agreement with existing equivalent circuit model assuming ohmic contacts
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Jian, Yu-Tao; Tang, Tian-Yu; Swain, Michael V; Wang, Xiao-Dong; Zhao, Ke
2016-12-01
The aim of this in vitro study was to evaluate the effect of core ceramic grinding on the fracture behaviour of bilayered zirconia under two loading schemes. Interfacial surfaces of sandblasted zirconia disks (A) were ground with 80 (B), 120 (C) and 220 (D) grit diamond discs, respectively. Surface roughness and topographic analysis were performed using a confocal scanning laser microscope (CSLM) and a scanning electron microscopy (SEM). Relative monoclinic content was evaluated using X-ray diffraction analysis (XRD) then reevaluated after simulated veneer firing. Biaxial fracture strength (σ) and Weibull modulus (m) were calculated either with core in compression (subgroup Ac-Dc) or in tension (subgroup At-Dt). Facture surfaces were examined by SEM and energy dispersive X-ray spectroscopy (EDS). Maximum tensile stress at fracture was estimated by finite element analysis. Statistical data analysis was performed using Kruskal-Wallis and one-way ANOVA at a significance level of 0.05. As grit size of the diamond disc increased, zirconia surface roughness decreased (pgrinding. No difference in initial (p=0.519 for subgroups Ac-Dc) and final fracture strength (p=0.699 for subgroups Ac-Dc; p=0.328 for subgroups At-Dt) was found among the four groups for both loading schemes. While coarse grinding slightly increased final fracture strength reliability (m) for subgroups Ac-Dc. Two different modes of fracture were observed according to which material was on the bottom surface. Components of the liner porcelain remained on the zirconia surface after fracture for all groups. Technician grinding changed surface topography of zirconia ceramic material, but was not detrimental to the bilayered system strength after veneer application. Coarse grinding slightly improved the fracture strength reliability of the bilayered system tested with core in compression. It is recommended that veneering porcelain be applied directly after routine lab grinding of zirconia ceramic, and its
Ghanem, Eman; Long, S. Reid; Rodenbusch, Stacia E.; Shear, Ruth I.; Beckham, Josh T.; Procko, Kristen; DePue, Lauren; Stevenson, Keith J.; Robertus, Jon D.; Martin, Stephen; Holliday, Bradley; Jones, Richard A.; Anslyn, Eric V.; Simmons, Sarah L.
2018-01-01
Innovative models of teaching through research have broken the long-held paradigm that core chemistry competencies must be taught with predictable, scripted experiments. We describe here five fundamentally different, course-based undergraduate research experiences that integrate faculty research projects, accomplish ACS accreditation objectives,…
Directory of Open Access Journals (Sweden)
Ngondi Judith L
2010-02-01
Full Text Available Abstract Background LeptiCore® is a proprietary combination of various ingredients which have been shown to have properties which could be beneficial to weight loss in obese and overweight human subjects. This study evaluates the effect of Lepticore® on bodyweight as well as parameters associated with obesity and metabolic syndrome. Methods The study was an 8 week randomized, double-blind, placebo-controlled design involving 92 obese (mean BMI > 30 kg/m2 participants (37 males; 55 females; ages 19-52; mean age = 30.7. The participants were randomly divided into three groups: placebo (n = 30, LeptiCore® formula A (low dose (n = 31 and LeptiCore® formula B (high dose (n = 31. Capsules containing the placebo or active formulations were administered twice daily before meals with 300 ml of water. None of the participants followed any specific diet nor took any weight-reducing medications for the duration of the study. A total of 12 anthropomorphic and serological measurements were taken at the beginning of the study and after 2, 4, 6, and 8 weeks of treatment. Results Compared to the placebo group, the two active groups showed statistically significant differences on all 12 variables by week 8. These included four anthropomorphic variables (body weight, body fat, waist and hip size and eight measures of serological levels (plasma total cholesterol, LDL, HDL, triglycerides, blood glucose, serotonin, leptin, C-reactive protein. The two active groups also showed significant intra-group differences on all 12 variables between study onset and week 8. Conclusion The LeptiCore® formulation at both the low and high dosages appears to be helpful in the management of fat gain and its related complications. The higher dosage resulted in significantly greater reductions in body weight and triglyceride, blood glucose, and C-reactive protein levels, as well as increased serotonin levels.
Fire resistance of extruded hollow-core slabs
DEFF Research Database (Denmark)
Hertz, Kristian Dahl; Sørensen, Lars Schiøtt; Giuliani, Luisa
2017-01-01
to the structural codes with data derived from a standard fire test and from a thorough examination of the comprehensive test documentation available on fire exposed hollow-core slabs. Findings – Mechanisms for loss of load-bearing capacity are clarified, and evidence of the fire resistance is found. Originality......Purpose – Prefabricated extruded hollow-core slabs are preferred building components for floor structures in several countries. It is therefore important to be able to document the fire resistance of these slabs proving fulfilment of standard fire resistance requirements of 60 and 120 min found...... in most national building regulations. The paper aims to present a detailed analysis of the mechanisms responsible for the loss of loadbearing capacity of hollow-core slabs when exposed to fire. Design/methodology/approach – Furthermore, it compares theoretica calculation and assessment according...
Energy Technology Data Exchange (ETDEWEB)
Lima, Alan M.M. de; Schirru, Roberto [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia. Programa de Engenharia Nuclear]. E-mail: alan@lmp.ufrj.br; schirru@lmp.ufrj.br
2005-07-01
A Pressurized Water Reactor core must be reloaded every time the fuel burnup reaches a level when it is not possible to sustain nominal power operation. The nuclear core fuel reload optimization consists in finding a burned-up and fresh-fuel-assembly pattern that maximizes the number of full operational days. This problem is NP-hard, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Besides that, the problem is non-linear and its search space is highly discontinual and multimodal. In this work a parallel computational system based on Ant Colony System (ACS) called Artificial-Ant-Colony Networks is introduced to solve the nuclear reactor core fuel reload optimization problem. ACS is a system based on artificial agents that uses the reinforcement learning technique and was originally developed to solve the Traveling Salesman Problem, which is conceptually similar to the nuclear fuel reload problem. (author)
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
Compounding Of Ac Compressor Using Waste Heat Recovery From Exhaust Gas
Directory of Open Access Journals (Sweden)
Bheshma Yogendra Kiran
2015-08-01
Full Text Available This project works on the theme of turbocharger in which a low pressure high speed turbine is placed in the exhaust gas manifold. The exhaust gas from the engine is made to rotate the turbine where the thermal power of exhaust gas is converted into rotary motion through turbine. This rotary motion from turbine is given to the turbocharger compressor which compresses the refrigerant vapor. So through this air conditioning effect is obtained without loss of any crankshaft. The kinetic energy extracted from the turbine is used to run the AC compressor by planetary gear train.
Core design of a high breeding fast reactor cooled by supercritical pressure light water
Energy Technology Data Exchange (ETDEWEB)
Someya, Takayuki, E-mail: russell@ruri.waseda.jp; Yamaji, Akifumi
2016-01-15
Highlights: • Core design concept of supercritical light water cooled fast breeding reactor is developed. • Compound system doubling time (CSDT) is applied for considering an appropriate target of breeding performance. • Breeding performance is improved by reducing fuel rod diameter of the seed assembly. • Core pressure loss is reduced by enlarging the coolant channel area of the seed assembly. - Abstract: A high breeding fast reactor core concept, cooled by supercritical pressure light water has been developed with fully-coupled neutronics and thermal-hydraulics core calculations, which takes into account the influence of core pressure loss to the core neutronics characteristics. Design target of the breeding performance has been determined to be compound system doubling time (CSDT) of less than 50 years, by referring to the relationship of energy consumption and economic growth rate of advanced countries such as the G7 member countries. Based on the past design study of supercritical water cooled fast breeder reactor (Super FBR) with the concept of tightly packed fuel assembly (TPFA), further improvement of breeding performance and reduction of core pressure loss are investigated by considering different fuel rod diameters and coolant channel geometries. The sensitivities of CSDT and the core pressure loss with respect to major core design parameters have been clarified. The developed Super FBR design concept achieves fissile plutonium surviving ratio (FPSR) of 1.028, compound system doubling time (CSDT) of 38 years and pressure loss of 1.02 MPa with positive density reactivity (negative void reactivity). The short CSDT indicates high breeding performance, which may enable installation of the reactors at a rate comparable to energy growth rate of developed countries such as G7 member countries.
Design of Multi-core Fiber Patch Panel for Space Division Multiplexing Implementations
DEFF Research Database (Denmark)
Gonzalez, Luz E.; Morales, Alvaro; Rommel, Simon
2018-01-01
A multi-core fiber (MCF) patch panel was designed, allowing easy coupling of individual signals to and from a 7-core MCF. The device was characterized, measuring insertion loss and cross talk, finding highest insertion loss and lowest crosstalk at 1300 nm with values of 9.7 dB and -36.5 d...
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
International Nuclear Information System (INIS)
Kim, S.B.; Uwani, Y.; Joo, J.H.; Kawamoto, R.; Jo, Y.S.
2011-01-01
The electric device applications of a high temperature superconducting (HTS) bulk magnet, having stable levitation and suspension properties according to their strong flux pinning force, have been proposed and developed. We have been investigating a three-dimensional (3-D) superconducting actuator using HTS bulks to develop a non-contract transportation device which moves freely in space. It is certain for our proposed 3-D superconducting actuator to be useful as a transporter used in a clean room where silicon wafers, which do not like mechanical contact and dust, are manufactured. The proposed actuator consists of the trapped HTS bulk as a mover and two-dimensionally arranged electromagnets as a stator. Up to now, the electromagnets consisted with iron core and copper coil were used as a stator, and each electromagnet was individually controlled using DC power supplies. In our previous work, the unstable movement characteristics of HTS bulk were observed under the DC operation, and the AC electromagnets driven with AC controlled current was proposed to solve these problems. In general, the trapped magnetic field in HTS bulk was decayed by a time-varying external magnetic field. Thus, it needs to optimize the shapes of AC electromagnets and operating patterns, the decay properties of the trapped magnetic field in the HTS bulk mover by the AC magnetic field should be cleared. In this paper, the influences of the frequency, the overall operating time, the strength of magnetization field and drive current against the decay of trapped magnetic field were experimentally studied using the fabricated AC electromagnets.
Evaluation report on CCTF Core-II reflood tests C2-AC1 (run 51) and C2-4 (run 62)
International Nuclear Information System (INIS)
Sugimoto, Jun; Iguchi, Tadashi; Murao, Yoshio
1984-02-01
A reflood test program has been conducted at Japan Atomic Energy Research Institute (JAERI) using large scale test facilities named Cylindrical Core Test Facility (CCTF) and Slab Core Test Facility (SCTF). The present report describes the effect of the initial clad temperature i.e., the initial stored energy on reflood phenomena observed in CCTF Core-II tests C2-ACl and C2-4. The peak clad temperatures of tests C2-ACl and C2-4 were 863 K and 1069 K, respectively at reflood initiation. With higher initial clad temperature, obtained were lower water accumulation in the core and upper plenum, and higher loop mass flow rate in an early reflood transient due to larger heat release of the stored energy in the core. Core inlet flow conditions were only affected shortly after the reflood initiation, causing the suppressed flooding rate and the larger U-tube flow oscillation between the core and the downcomer. In the core, with higher initial clad temperature, slower quench front propagation and higher turnaround temperature were observed. Responses to a higher initial clad temperature were similar to those observed in CCTF Core-I and FLECHT tests. Thus, the lower temperature rise with higher initial clad temperature was experimentally confirmed. The importance of higher flooding rate at initial period was analytically shown for further decreasing the temperature rise. (author)
Pandey, R. S.; Singh, Vikrant; Rani, Anju; Varughese, George; Singh, K. M.
2018-05-01
In the present paper Oblique propagating electromagnetic ion-cyclotron wave has been analyzed for anisotropic multi ion plasma (H+, He+, O+ ions) in earth magnetosphere for the Dione shell of L=7 i.e., the outer radiation belt of the magnetosphere for Loss-cone distribution function with a spectral index j in the presence of A.C. electric field. Detail for particle trajectories and dispersion relation has been derived by using the method of characteristic solution on the basis of wave particle interaction and transformation of energy. Results for the growth rate have been calculated numerically for various parameters and have been compared for different ions present in magnetosphere. It has been found that for studying the wave over wider spectrum, anisotropy for different values of j should be taken. The effect of frequency of A.C. electric field and angle which propagation vector make with magnetic field, on growth rate has been explained.
Energy Technology Data Exchange (ETDEWEB)
Neamtu, B.V., E-mail: bogdan.neamtu@stm.utcluj.ro [Materials Science and Engineering Department, Technical University of Cluj-Napoca, 400614 Cluj-Napoca (Romania); Institut Neel, CNRS/Universite J. Fourier, BP166, 38042 Grenoble, Cedex 9 (France); Geoffroy, O. [Institut Neel, CNRS/Universite J. Fourier, BP166, 38042 Grenoble, Cedex 9 (France); Grenoble Electrical Engineering, University J. Fourier, BP 46, F-38402 Saint-Martin d' Heres Cedex (France); Chicinas, I. [Materials Science and Engineering Department, Technical University of Cluj-Napoca, 400614 Cluj-Napoca (Romania); Isnard, O. [Institut Neel, CNRS/Universite J. Fourier, BP166, 38042 Grenoble, Cedex 9 (France)
2012-05-25
Highlights: Black-Right-Pointing-Pointer Nanocrystalline soft magnetic composites were obtained. Black-Right-Pointing-Pointer The cutting frequency of the produced nanocrystalline SMC exceeds 100 kHz. Black-Right-Pointing-Pointer A long annealing at low temperature leads to an improvement of the permeability (12%). - Abstract: The preparation and characterization of the nanocrystalline soft magnetic composite core based on Supermalloy powder obtained via mechanical alloying route are presented. The AC magnetic properties of the compacts were determined in frequency range from 100 Hz to 100 kHz for flux densities of 0.05 and 0.1 T. Composite materials were obtained by covering the Supermalloy particles with a polymer binder, then compacted into toroidal shape and finally polymerized. It is found that an increase of the compacting pressure from 600 MPa to 800 MPa leads to an increase of the compacts permeability by more than 8%. Also, reducing the polymer content from 2 wt.% to 0.5 wt.% leads to an increase of the magnetic losses (at 100 kHz and 0.1 T) by 380%. The removal of the stresses induced during compaction has been accomplished by a heat treatment at 170 Degree-Sign C for 120 h. This leads to a significant increase (12%) of the relative initial permeability of the compacts.
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Martelli, C.; Canning, J.; Lyytikainen, K.; Groothoff, N.
2005-01-01
A water core photonic crystal Fresnel fiber exploiting a hole distribution on zone plates of a cylindrical waveguide was developed and characterized. This fiber has similar guiding properties as the pristine air-hole guiding fiber although a large loss edge ~900nm is observed indicating that the
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Design of multi-core fiber patch panel for space division multiplexing implementations
González, Luz E.; Morales, Alvaro; Rommel, Simon; Jørgensen, Bo F.; Porras-Montenegro, N.; Tafur Monroy, Idelfonso
2018-01-01
A multi-core fiber (MCF) patch panel was designed, allowing easy coupling of individual signals to and from a 7-core MCF. The device was characterized, measuring insertion loss and cross talk, finding highest insertion loss and lowest crosstalk at 1300 nm with values of 9.7 dB and -36.5 dB
An improved iron loss estimation for permanent magnet brushless machines
Fang, D
1999-01-01
This paper presents an improved approach for predicting iron losses in permanent magnet brushless machines. The new approach is based on the fundamental concept that eddy current losses are proportional to the square of the time rate of change of flux density. Expressions are derived for predicting hysteresis and eddy current losses in the stator teeth and yoke. The so-called anomalous or excess losses, caused by the induced eddy current concentration around moving magnetic domain walls and neglected in the conventional core loss calculation, are also included in the proposed approach. In addition, the model is also capable of accounting for the stator skewing, if present. The core losses obtained from the proposed approach are compared with those measured on an existing PM motor at several operating speeds, showing very good agreement. (14 refs).
Zhang, Qin; Rao, Xiuwen; Zhang, Lubin; He, Congcong; Yang, Fang; Zhu, Shijiang
2016-01-01
Internal browning (IB), a physiological disorder (PD) that causes severe losses in harvested pineapple, can be induced by exogenous gibberellins (GAs). Over the years, studies have focused on roles of Gibberellin 2-oxidase (GA2oxs), the major GAs catabolic enzyme in plants, in the regulation of changes in morphology or biomass. However, whether GA2oxs could regulate PD has not been reported. Here, a full-length AcGA2ox cDNA was isolated from pineapple, with the putative protein sharing 23.59% to 72.92% identity with GA2oxs from five other plants. Pineapples stored at 5 °C stayed intact, while those stored at 20 °C showed severe IB. Storage at 5 °C enhanced AcGA2ox expression and decreased levels of a GAs (GA4) ‘compared with storage at 20 °C. However, at 20 °C, exogenous application of abscisic acid (ABA) significantly suppressed IB. ABA simultaneously upregulated AcGA2ox and reduced GA4. Ectopic expression of AcGA2ox in Arabidopsis resulted in reduced GA4, lower seed germination, and shorter hypocotyls and roots, all of which were restored by exogenous GA4/7. Moreover, in pineapple, GA4/7 upregulated polyphenol oxidase, while storage at 5 °C and ABA downregulated it. These results strongly suggest the involvement of AcGA2ox in regulation of GAs levels and a role of AcGA2ox in regulating IB. PMID:27982026
New finite element-based modeling of reactor core support plate failure
Energy Technology Data Exchange (ETDEWEB)
Pandazis, Peter; Lovasz, Liviusz [Gesellschaft fuer Anlagen- und Reaktorsicherheit gGmbH, Garching (Germany). Forschungszentrum; Babcsany, Boglarka [Budapest Univ. of Technology and Economics, Budapest (Hungary). Inst. of Nuclear Techniques; Hajas, Tamas
2017-12-15
ATHLET-CD is the severe accident module of the code system AC{sup 2} that is designed to simulate the core degradation phenomena including fission product release and transport in the reactor circuit, as well as the late phase processes in the lower plenum. In case of a severe accident degradation of the reactor core occurs, the fuel assemblies start to melt. The evolution of such processes is usually accompanied with the failure of the core support plate and relocation of the molten core to the lower plenum. Currently, the criterion for the failure of the support plate applied by ATHLET-CD is a user-defined signal which can be a specific time or process variable like mass, temperature, etc. A new method, based on FEM approach, was developed that could lead in the future to a more realistic criterion for the failure of the core support plate. This paper presents the basic idea and theory of this new method as well as preliminary verification calculations and an outlook on the planned future development.
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Adapting AC Lines to DC Grids for Large-Scale Renewable Power Transmission
Directory of Open Access Journals (Sweden)
D. Marene Larruskain
2014-10-01
Full Text Available All over the world, governments of different countries are nowadays promoting the use of clean energies in order to achieve sustainable energy systems. In this scenario, since the installed capacity is continuously increasing, renewable sources can play an important role. Notwithstanding that, some important problems may appear when connecting these sources to the grid, being the overload of distribution lines one of the most relevant. In fact, renewable generation is usually connected to the nearest AC grid, although this HV system may not have been designed considering distributed generation. In the particular case of large wind farms, the electrical grid has to transmit all the power generated by wind energy and, as a consequence, the AC system may get overloaded. It is therefore necessary to determine the impact of wind power transmission so that appropriate measures can be taken. Not only are these measures influenced by the amount of power transmitted, but also by the quality of the transmitted power, due to the output voltage fluctuation caused by the highly variable nature of wind. When designing a power grid, although AC systems are usually the most economical solution because of its highly proven technology, HVDC may arise in some cases (e.g. offshore wind farms as an interesting alternative, offering some added values such as lower losses and better controllability. This way, HVDC technology can solve most of the aforementioned problems and has a good potential for future use. Additionally, the fast development of power electronics based on new and powerful semiconductor devices allow the spread of innovative technologies, such as VSC-HVDC, which can be applied to create DC grids. This paper focuses on the main aspects involved in adapting the existing overhead AC lines to DC grids, with the objective of improving the transmission of distributed renewable energy to the centers of consumption.
Study of a Modified AC Bridge Technique for Loss Angle Measurement of a Dielectric Material
Directory of Open Access Journals (Sweden)
S. C. BERA
2008-09-01
Full Text Available A Wheatstone’s bridge network like Schering Bridge, DeSauty Bridge etc measures the loss angle or tangent of loss angle (tanδ of a dielectric material. In high voltage application this loss angle is generally measured by high voltage Schering Bridge. But continuous measurement of tan δ is not possible by these techniques. In the present paper a modified operational amplifiers based Schering Bridge network has been proposed for continuous measurement of tanδ in the form of a bridge network output voltage. Mathematical analysis of the proposed bridge network has been discussed in the paper and experimental work has been performed assuming the lossy dielectric material as a series combination of loss less capacitor and a resistor. Experimental results are reported in the paper. From the mathematical analysis and experimental results it is found that the output of the proposed bridge network is almost linearly related with tanδ.
International Nuclear Information System (INIS)
1990-06-01
On March 20, 1990, the Vogtle Electric Generating Plant Unit 1, located in Burke County, Georgia, about 25 miles southeast of Augusta, experienced a loss of all safety (vital) ac power. The plant was in cold shutdown with reactor coolant level lowered to ''mid-loop'' for various maintenance tasks. Both the containment building personnel hatch and equipment hatch were open. One emergency diesel generator and one reserve auxiliary transformer were out of service for maintenance, with the remaining reserve auxiliary transformer supplying both Unit 1 safety buses. A truck in the low voltage switchyard backed into the support column for an offsite power feed to the reserve auxiliary transformer which was supplying safety power. The insulator broke, a phase-to-ground fault occurred, and the feeder circuit breakers for the safety buses opened. The operable emergency diesel generator started automatically because of the undervoltage condition on the safety bus, but tripped off after about 1 minute. About 20 minutes later the diesel generator load sequencer was reset, causing the diesel generator to start a second time. The diesel generator operated for about 1 minute, and tripped off. The diesel generator was restarted in the manual emergency mode 36 minutes after the loss of power. The generator remained on line and provided power to its safety bus. During the 36 minutes without safety bus power, the reactor coolant system temperature rose from about 90 degree F to 136 degree F. This report documents the results of an Incident Investigation Team sent to Vogtle by the Executive Director for Operations of the US Nuclear Regulatory Commission to determine what happened, identify the probable causes, and make appropriate findings and conclusions. 79 figs., 16 tabs
Design, processing, and properties of Bi 2212\\/Ag Rutherford cables
Collings, E W; Scanlan, R M; Dietderich, D R; Motowidlo, L R; Sokolowski, R S; Aoki, Y; Hasegawa, T
1999-01-01
In a program intended to explore the use of high temperature superconducting (HTSC) cables in high field synchrotron dipole magnets model Bi:2212/Ag Rutherford cables were designed bearing in mind the needs for mechanical integrity, relatively high tensile strength, and low coupling losses. To satisfy these needs a core-type cable design was selected and a readily available heat-resistant core material acquired. Cables were wound for critical current- and AC loss measurement. Both winding-induced (mechanical) and core-induced (chemical) critical current degradation was examined. Interstrand coupling loss was measured calorimetrically on model cable samples with bare- and oxide-coated cores. From the results it was predicted that the losses of full-scale Bi:2212/Ag-wound LHC-type Rutherford cables would fall close to the acceptability range for the windings of high-field accelerator dipoles. (10 refs).
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
Johnson, Earl E
2013-06-01
Hearing aid prescriptive recommendations for hearing losses having a conductive component have received less clinical and research interest than for losses of a sensorineural nature; as a result, much variation remains among current prescriptive methods in their recommendations for conductive and mixed hearing losses (Johnson and Dillon, 2011). The primary intent of this brief clinical note is to demonstrate differences between two algebraically equivalent expressions of hearing loss, which have been approaches used historically to generate a prescription for hearing losses with a conductive component. When air and bone conduction thresholds are entered into hearing aid prescriptions designed for nonlinear hearing aids, it was hypothesized that that two expressions would not yield equivalent amounts of prescribed insertion gain and output. These differences are examined for their impact on the maximum power output (MPO) requirements of the hearing aid. Subsequently, the MPO capabilities of two common behind-the-ear (BTE) receiver placement alternatives, receiver-in-aid (RIA) and receiver-in-canal (RIC), are examined. The two expressions of hearing losses examined were the 25% ABG + AC approach and the 75% ABG + BC approach, where ABG refers to air-bone gap, AC refers to air-conduction threshold, and BC refers to bone-conduction threshold. Example hearing loss cases with a conductive component are sampled for calculations. The MPO capabilities of the BTE receiver placements in commercially-available products were obtained from hearing aids on the U.S. federal purchasing contract. Prescribed gain and the required MPO differs markedly between the two approaches. The 75% ABG + BC approach prescribes a compression ratio that is reflective of the amount of sensorineural hearing loss. Not all hearing aids will have the MPO capabilities to support the output requirements for fitting hearing losses with a large conductive component particularly when combined with
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
A Novel Low-Loss Diamond-Core Porous Fiber for Polarization Maintaining Terahertz Transmission
DEFF Research Database (Denmark)
Islam, Raonaqul; Habib, Selim; Hasanuzzaman, G. K. M.
2016-01-01
We report on the numerical design optimization of a new kind of relatively simple porous-core photonic crystal fiber (PCF) for terahertz (THz) waveguiding. A novel twist is introduced in the regular hexagonal PCF by including a diamond-shaped porous-core inside the hexagonal cladding. The numeric...
International Nuclear Information System (INIS)
Hegab, N.A.; Afifi, M.A.; Atyia, H.E.; Farid, A.S.
2009-01-01
Thin films of the prepared Se 80 Te 20-x Ge x (x = 5, 7 and 10 at.%) were prepared by thermal evaporation technique. X-ray diffraction patterns showed that the films were in amorphous state. The ac conductivity and dielectric properties of the investigated film compositions were studied in the frequency range 0.1-100 kHz and in temperature range (303-373 K). The experimental results indicated that the ac conductivity and the dielectric properties depended on the temperature and frequency. The ac conductivity is found to obey the ω s law, in accordance with the hopping model, s is found to be temperature dependent (s 1 and dielectric loss ε 2 were found to decrease with frequency and increase with temperature. The maximum barrier height W m , calculated from dielectric measurements according to Guintini equation, agrees with that proposed by the theory of hopping over potential barrier as suggested by Elliott in case of chalcogenide glasses. The density of localized states was estimated for the studied film compositions. The variation of the studied properties with Ge content was also investigated.
Ion peak narrowing by applying additional AC voltage (ripple voltage) to FAIMS extractor electrode.
Pervukhin, Viktor V; Sheven, Dmitriy G
2010-01-01
The use of a non-uniform electric field in a high-field asymmetric waveform ion mobility spectrometry (FAIMS) analyzer increases sensitivity but decreases resolution. The application of an additional AC voltage to the extractor electrode ("ripple" voltage, U(ripple)) can overcome this effect, which decreases the FAIMS peak width. In this approach, the diffusion ion loss remains minimal in the non-uniform electric field in the cylindrical part of the device, and all ion losses under U(ripple) occur in a short portion of their path. Application of the ripple voltage to the extractor electrode is twice as efficient as the applying of U(ripple) along the total length of the device. 2010 American Society for Mass Spectrometry. Published by Elsevier Inc. All rights reserved.
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
International Electrotechnical Commission. Geneva
1972-01-01
Applies to d.c. machines and to a.c. synchronous and induction machines. The principles can be applied to other types of machines such as rotary converters, a.c. commutator motors and single-phase induction motors for which other methods of determining losses are used.
Professionalism: A Core Competency, but What Does it Mean? A Survey of Surgery Residents.
Dilday, Joshua C; Miller, Elizabeth A; Schmitt, Kyle; Davis, Brian; Davis, Kurt G
2017-10-27
Professionalism is 1 of the 6 core competencies of the Accreditation Council of Graduate Medical Education. Despite its obvious importance, it is poorly defined in the literature and an understanding of its meaning has not been evaluated on surgical trainees. The American College of Surgeons (ACS) has previously published tenets of surgical professionalism. However, surgery residents may not share similar views on professionalism as those of the ACS. Surgical residents of all levels at 2 surgery residencies located in the same city were interviewed regarding their personal definitions, thoughts, and experiences regarding professionalism during their training. They were then queried regarding 20 points of professionalism as outlined by the ACS tenets of professionalism. The study utilized the surgery residencies at William Beaumont Army Medical Center and Texas Tech University Health Science Center in El Paso, Texas. All general surgery residents at each program were invited to participate in the study. Eighteen residents volunteered to take the survey and be interviewed. The definitions of professionalism centered on clinical competence. Surgery residents conveyed experiences with both professional and unprofessional behavior. Seven of the 20 ACS tenets of professionalism were unanimously agreed upon. There were key differences between resident definitions and those as outlined by the ACS. The least agreed upon ACS tenets of professionalism include professionalism education, public education, and public health. Surgical trainees express personal experiences in both professional and unprofessional behavior. Their definitions of professionalism are not as expansive as those of the ACS and seem to focus on patient and colleague interaction. Due to the lack of congruency, a tailored curriculum for professionalism based upon ACS tenets appears warranted. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Tobío, J. M.
1970-07-01
Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.
Design and analysis of three-layer-core optical fiber
Zheng, Siwen; Liu, Yazhuo; Chang, Guangjian
2018-03-01
A three-layer-core single-mode large-mode-area fiber is investigated. The three-layer structure in the core, which is composed of a core-index layer, a cladding-index layer, and a depression-index layer, could achieve a large effective area Aeff while maintaining an ultralow bending loss without deteriorating cutoff behaviors. The single-mode large mode area of 100 to 330 μm2 could be achieved in the fiber. The effective area Aeff can be further enlarged by adjusting the layer parameters. Furthermore, the bending property could be improved in this three-layer-core structure. The bending loss could decrease by 2 to 4 orders of magnitude compared with the conventional step-index fiber with the same Aeff. These characteristics of three-layer-core fiber suggest that it can be used in large-mode-area wide-bandwidth high-capacity transmission or high-power optical fiber laser and amplifier in optical communications, which could be used for the basic physical layer structure of big data storage, reading, calculation, and transmission applications.
Experimental core electron density of cubic boron nitride
DEFF Research Database (Denmark)
Wahlberg, Nanna; Bindzus, Niels; Bjerg, Lasse
as well as experimental result. The redistribution of electron density will, if not accounted for, result in increased thermal parameters. It is estimated that 1.7-2 electrons is transferred from boron to nitrogen. [1]: N. Bindzus, T. Straasø, N. Wahlberg, J. Becker, L. Bjerg, N. Lock, A.-C. Dippel, and B......Experimental core electron density of cubic boron nitride Nanna Wahlberg*, Niels Bindzus*, Lasse Bjerg*, Jacob Becker*, and Bo B. Iversen* *Aarhus University, Department of Chemistry, CMC, Langelandsgade 140, 8000 Århus, Denmark The resent progress in powder diffraction provides data of quality...... obtained. The displacement parameters reported here are significantly lower than those previously reported, stressing the importance of an adequate description of the core density. The charge transfer from boron to nitrogen clearly affects the inner electron density, which is evident from theoretical...
Energy Technology Data Exchange (ETDEWEB)
Tajima, K; Anazawa, Y; Kaga, A [Akita University, Akita (Japan). Mining College; Ichinokura, O [Tohoku University, Sendai (Japan). Faculty of Engineering
1991-04-30
This paper reports on a precise numerical analysis of operating characteristics of the push-pull parametric transformer of orthogonal-core type (proposed by the authors in the preceding papers) made in consideration of both the iron loss of its magnetic core and the copper loss of its windings. A model of magnetic circuit in the core is presented, which involves magnetic reluctances representing saturation characteristics of the core and magnetic inductances representing effects produced by hysteresis. Use is made of the function that expresses the saturation characteristics by a twenty-first power series of magnetic flux, the coefficient of each term being determined by use of experimental data on a specified sample of the magnetic core. Furthermore, recourse is had to the circuit simulator SPICE in order to analyze the operating characteristics of the transformer. Comparing results of the present analysis with experimental results, the following are noted: first, both output voltages and currents of windings of the transformer under the condition of parametric oscillation are calculated with sufficient accuracy; second, the present analysis is capable of evaluating the conversion efficiency of electric power and input power factor of the transformer, and of providing more accurate values of both voltage and current in the case of the maximum output under loading conditions as compared with the analyses so far presented. 8 refs., 11 figs., 2 tabs.
Characteristics of core sampling from crumbing Paleozoic rock
Energy Technology Data Exchange (ETDEWEB)
Barabashkin, I I; Edelman, Y A; Filippov, V N; Lychev, V N
1981-01-01
The results of analysis of core sampling using standard core sampling tools with small and medium inside diameter are cited. It is demonstrated that when using these tools loss of core in Paleozoic deposits promising with regard to oil and gas content does not exceed 25 - 30%. The use of a new core sampling tool with a large inside diameter which includes drill bits of different types and a core lifter ''Krembriy'' SKU-172/100 made it possible to increase core removal approximately 52%. A representative core from a highly crumbling and vesicular rock belinging to groups III - IV in terms of difficulty of core sampling was obtained first. A description of a new core sampling tool is given. The characteristics of the technology of its use which promote preservation of the core are cited. Means of continued improvement of this tool are noted.
Modelling characteristics of ferromagnetic cores with the influence of temperature
International Nuclear Information System (INIS)
Górecki, K; Rogalska, M; Zarȩbski, J; Detka, K
2014-01-01
The paper is devoted to modelling characteristics of ferromagnetic cores with the use of SPICE software. Some disadvantages of the selected literature models of such cores are discussed. A modified model of ferromagnetic cores taking into account the influence of temperature on the magnetizing characteristics and the core losses is proposed. The form of the elaborated model is presented and discussed. The correctness of this model is verified by comparing the calculated and the measured characteristics of the selected ferromagnetic cores.
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
A Metal Fuel Core Concept for 1000 MWt Advanced Burner Reactor
International Nuclear Information System (INIS)
Yang, W.S.; Kim, T.K.; Grandy, C.
2007-01-01
This paper describes the core design and performance characteristics of a metal fuel core concept for a 1000 MWt Advanced Burner Reactor. A ternary metal fuel form of U-TRU-Zr was assumed with weapons grade plutonium feed for the startup core and TRU recovered from LWR spent fuel for the recycled equilibrium core. A compact burner core was developed by trade-off between the burnup reactivity loss and TRU conversion ratio, with a fixed cycle length of one-year. In the startup core, the average TRU enrichment is 15.5%, the TRU conversion ratio is 0.81, and the burnup reactivity loss over a cycle is 3.6% Δk. The heavy metal and TRU inventories are 13.1 and 2.0 metric tons, respectively. The average discharge burnup is 93 MWd/kg, and the TRU consumption rate is 55.5 kg/year. For the recycled equilibrium core, the average TRU enrichment is 22.1 %, the TRU conversion ratio is 0.73, and the burnup reactivity loss is 2.2% Δk. The TRU inventory and consumption rate are 2.9 metric tons and 81.6 kg/year, respectively. The evaluated reactivity coefficients provide sufficient negative feedbacks. The control systems provide shutdown margins that are more than adequate. The integral reactivity parameters for quasi-static reactivity balance analysis indicate favorable passive safety features, although detailed safety analyses are required to verify passive safety behavior. (authors)
Capacitive short circuit detection in transformer core laminations
International Nuclear Information System (INIS)
Schulz, Carl A.; Duchesne, Stephane; Roger, Daniel; Vincent, Jean-Noel
2008-01-01
A capacitive measurement procedure is proposed that serves to detect burr-induced short circuits in transformer core laminations. The tests are conducted on stacks of transformer steel sheets as used for transformer core production and yield a short-circuit probability indicative of the additional eddy current losses to be expected. Applied during the assembly of transformer cores, the measurements can help to decide whether the burr treatment process is working efficiently or has to be readjusted
EEL Calculations and Measurements of Graphite and Graphitic-CNx Core-Losses
International Nuclear Information System (INIS)
Seepujak, A; Bangert, U; Harvey, A J; Blank, V D; Kulnitskiy, B A; Batov, D V
2006-01-01
Core EEL spectra of MWCNTs (multi-wall carbon nanotubes) grown in a nitrogen atmosphere were acquired utilising a dedicated STEM equipped with a Gatan Enfina system. Splitting of the carbon K-edge π* resonance into two peaks provided evidence of two nondegenerate carbon bonding states. In order to confirm the presence of a CN x bonding state, a full-potential linearised augmented plane-wave method was utilised to simulate core EEL spectra of graphite and graphitic-CN x compounds. The simulations confirmed splitting of the carbon K-edge π* resonance in graphitic-CN x materials, with the pristine graphite π* resonance remaining unsplit. The simulations also confirmed the increasing degree of amorphicity with higher concentrations (25%) of substitutional nitrogen in graphite
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Directory of Open Access Journals (Sweden)
Rui Li
2016-12-01
Full Text Available The AC voltage control of a DC/DC converter based on the modular multilevel converter (MMC is considered under normal operation and during a local DC fault. By actively setting the AC voltage according to the two DC voltages of the DC/DC converter, the modulation index can be near unity, and the DC voltage is effectively utilized to output higher AC voltage. This significantly decreases submodule (SM capacitance and conduction losses of the DC/DC converter, yielding reduced capital cost, volume, and higher efficiency. Additionally, the AC voltage is limited in the controllable range of both the MMCs in the DC/DC converter; thus, over-modulation and uncontrolled currents are actively avoided. The AC voltage control of the DC/DC converter during local DC faults, i.e., standby operation, is also proposed, where only the MMC connected on the faulty cable is blocked, while the other MMC remains operational with zero AC voltage output. Thus, the capacitor voltages can be regulated at the rated value and the decrease of the SM capacitor voltages after the blocking of the DC/DC converter is avoided. Moreover, the fault can still be isolated as quickly as the conventional approach, where both MMCs are blocked and the DC/DC converter is not exposed to the risk of overcurrent. The proposed AC voltage control strategy is assessed in a three-terminal high-voltage direct current (HVDC system incorporating a DC/DC converter, and the simulation results confirm its feasibility.
Effect of single point defects on the confinement losses of air-guiding photonic bandgap fibers
Institute of Scientific and Technical Information of China (English)
Shi Wei-Hua; Zhao Yan; Qian Li-Guo; Chen He-Ming
2012-01-01
The confinement losses in air-guiding photonic bandgap fibers (PBGFs) with air hole missing are studied with the full-vector finite-element method.It is confirmed that there are two loss peaks (1.555 and 1.598 μm) if there is a hole missing in the cladding far from the core.The closer to the core the hole missing is,the larger the confinement losses are,and even no mode could propagate in the core.The main power of the fundamental mode leaks from the core to the cladding defect.The quality of PBGFs can be improved through controlling the number and position of defects.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
International Nuclear Information System (INIS)
Poirier, R.L.; Enegren, T.A.; Enchevich, I.B.
1991-05-01
The RF cavity for the booster synchrotron requires a frequency swing from 46 MHz at a repetition rate of 50 Hz and a maximum accelerating gap voltage of 65 kV. A DC biased prototype cavity built at LANL using perpendicular-biased yttrium-garnet ferrites, rather than the more conventional parallel-biased NiZn ferrites, has now undergone major reconstruction at TRIUMF for AC bias operation. RF signal level measurements have shown that the frequency swing at a repetition rate of 50 Hz can be accomplished and still handle the eddy current losses in the cavity structures with minimal effect on the magnetizing field. The prototype cavity is now undergoing high power RF tests with full power AC bias operation. The results of these tests and operational experience is reported. (Author) ref., 6 figs
International Nuclear Information System (INIS)
Silvestri, E.; Serra, S.; Paddleford, D.F.
1985-01-01
This paper discusses one particular aspect of the Probabilistic Safety Study conducted for the Italian reference PWR or Progetto Unificato Nucleare (PUN) design. The event scenario addressed involves the loss of offsite power (LOOSP) initiating event in conjunction with an independent loss of certain support systems (to the exclusion of the total independent loss of on-site power which is treated similarly in a separate event tree). An event tree is developed to address the potential for a consequential small LOCA due to reactor coolant pump (RCP) seal failure under conditions of inadequate seal cooling and the subsequent potential for core uncovery should emergency systems be unavailable and not recovered in adequate time. The event scenario and the quantification methodology used are described. Results and sensitivities are presented
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Cao, Jia; Yan, Zheng; He, Guangyu
2016-06-01
This paper introduces an efficient algorithm, multi-objective human learning optimization method (MOHLO), to solve AC/DC multi-objective optimal power flow problem (MOPF). Firstly, the model of AC/DC MOPF including wind farms is constructed, where includes three objective functions, operating cost, power loss, and pollutant emission. Combining the non-dominated sorting technique and the crowding distance index, the MOHLO method can be derived, which involves individual learning operator, social learning operator, random exploration learning operator and adaptive strategies. Both the proposed MOHLO method and non-dominated sorting genetic algorithm II (NSGAII) are tested on an improved IEEE 30-bus AC/DC hybrid system. Simulation results show that MOHLO method has excellent search efficiency and the powerful ability of searching optimal. Above all, MOHLO method can obtain more complete pareto front than that by NSGAII method. However, how to choose the optimal solution from pareto front depends mainly on the decision makers who stand from the economic point of view or from the energy saving and emission reduction point of view.
Xie, Liyuan; Huang, Xingyi; Li, Bao-Wen; Zhi, Chunyi; Tanaka, Toshikatsu; Jiang, Pingkai
2013-10-28
Dielectric polymer nanocomposites with high dielectric constant have wide applications in high energy density electronic devices. The introduction of high dielectric constant ceramic nanoparticles into a polymer represents an important route to fabricate nanocomposites with high dielectric constant. However, the nanocomposites prepared by this method generally suffer from relatively low breakdown strength and high dielectric loss, which limit the further increase of energy density and energy efficiency of the nanocomposites. In this contribution, by using core-satellite structured ultra-small silver (Ag) decorated barium titanate (BT) nanoassemblies, we successfully fabricated high dielectric constant polymer nanocomposites with enhanced breakdown strength and lower dielectric loss in comparison with conventional polymer-ceramic particulate nanocomposites. The discharged energy density and energy efficiency are derived from the dielectric displacement-electric field loops of the polymer nanocomposites. It is found that, by using the core-satellite structured Ag@BT nanoassemblies as fillers, the polymer nanocomposites can not only have higher discharged energy density but also have high energy efficiency. The mechanism behind the improved electrical properties was attributed to the Coulomb blockade effect and the quantum confinement effect of the introduced ultra-small Ag nanoparticles. This study could serve as an inspiration to enhance the energy storage densities of dielectric polymer nanocomposites.
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)